2F7DA

A mutant rabbit cathepsin k with a nitrile inhibitor
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
215
structure length
215
Chain Sequence
TPDSIDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQRNRGIDSEDAYPYVGQDESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDENCSSDNLNHAVLAVGYGIQKGNKHWIIKNSWGESWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin K
publication title Beta-substituted cyclohexanecarboxamide: a nonpeptidic framework for the design of potent inhibitors of cathepsin K.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 63
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2005-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2f7dA00
4HWYA 2P0RA 1NB5A 1GECE 1S4VA 1U9VA 4FK5A 1EWMA 1SP4B 2OULA 2R6NA 4KLBA 4N79A 4K7CA 1AECA 3F5VA 5CHTA 1MEMA 1M6DA 1TLOA 2XU3A 3N3GA 1QXPA 2H7JA 2FQ9A 3MHSA 2F1GA 3RVXA 4FIPA 4CDFB 2AU1A 2DC9A 1DF0A 2PBHA 1YK7A 4RY2A 3O1GA 4YVAA 1CV8A 1PCIA 2E01A 2FTDA 3D6SA 3IOQA 1F2CA 1NL6A 5CVNB 4BS6A 4QBBA 2YJBA 2IBIA 1PIPA 1BQIA 1XKGA 1YALA 2C0YA 3OVZA 2VHSA 1MIRA 5JA7A 3PW3A 2R9FA 1PPNA 1GMYA 1QMYA 4PP1A 4YYQA 2NQAA 2DCAA 4QRXA 3HWNA 1CTEA 1KHQA 2AUZA 3MTNA 1ATKA 2HH5A 3P5VA 2AIMA 6PADA 1GCBA 3RVVA 3CH3X 8PCHA 2DC6A 1Q6KA 4X6HA 1KFXL 1AYVA 2HXZA 1K3BB 4FJCA 1KXRA 1ME4A 2R9NA 3QSDA 2XU1A 1BP4A 2Y5BA 5PADA 4W4UA 3OISA 3LXSA 1U9XA 1PPDA 2PREA 1EWOA 2JQGR 2YJ2A 3AI8A 4Q8HA 3WXFA 3IMAA 2FRAA 3M99A 2NQIA 2DCDA 3LFYA 1DEUA 4W5BA 1PE6A 1HUCB 3OF8A 2G7YA 3IV2A 3BWKA 2P7UA 4WA6A 3BCNA 1VSNA 2R9CA 1AU0A 4N4ZA 2HHNA 1QOLA 2DZYA 4P6EA 4X6IA 5CHVA 3KSEA 4N8WA 1AU4A 1CPJA 2AS8A 1MDWA 1PBHA 4BS5A 1KHPA 4YYRA 1VJVA 2CIOA 2FO5A 3CBJA 1ME3A 2DC7A 4PP2E 3WXEA 5A24A 1IWDA 4AXMA 3KX1A 2R9MA 4OELA 2Y6EA 4YYSA 1BGOA 1F29A 3TNXA 2BDZA 2WBFX 3BC3A 4DMXA 1NLJA 4DMYA 2ATOA 3HHIA 4P6GA 3KWZA 3OVXA 5J94A 5EGWA 3RVWA 3K9MA 2FYEA 3I06A 1U5IA 5FPWA 1STFE 3KKUA 2ACTA 4QRVA 2DCBA 3NHEA 2B1MA 4BPVA 1CQDA 3B79A 1QDQA 4PI3A 1TU6A 1MEGA 3HD3A 4CZWA 3CBKA 4XUIA 2GFOA 2G8EA 3P5WA 1YT7A 4Q8GA 2NQDB 2AYOA 5JH3A 3QT4A 1PPOA 2XU4A 1SNKA 2DC8A 1ZCMA 1ZIVA 1BY8A 1PADA 1CB5A 1AU3A 1AYUA 2AVWA 5K16A 4BQVA 4QRGA 2ARYA 3BPMA 1CJLA 4W5CA 3ERVA 2O6XA 1GLOA 2E00A 5EF4A 2YJCA 4I05A 3BPFA 1EWLA 2DCCA 2E03A 3ZUAA 4YV8A 2YJ8A 1PPPA 1ICFA 4CDCB 2AYNA 1O0EA 2GHUA 1EF7A 2PADA 1ITOA 1EWPA 3H6SA 4BSQA 1KFUL 9PAPA 2FT2A 3DF0A 3K8UA 4MSXA 3PBHA 2R9OA 1U9WA 3I3TA 4MZOA 2NQGA 2OZ2A 4ZUXU 2DZZA 1U9QX 3V6EA 4X6JA 3KW9A 1AIMA 4YYWA 3S3RA 2CB5A 3H8CA 1JQPA 2B1NA 2JQFR 3MORA 4CDEB 1FH0A 2DJGB 4I04A 3O0UA 1CSBB 5F02A 2G8JA 2BDLA 4AXLA 4OEMA 3IEJA 1YK8A 2FRQA 5CVOB 1F2BA 4XR7A 1YVBA 4I07A 2VHFA 4YYUA 1MHWA 1X9YA 3KWBX 4G54A 3GCBA 3PDFA 2YJ9A 3WXGA 1THEA 1AYWA 1TL9A 3S3QA 4YYVA 3F75A 3BOWA 3N4CA 3KFQA 2OP3A 3K24A 2XU5A 1F2AA 1MS6A 1NPZA 3PNRA 5CVMA 1CS8A 2DJFB 3U8EA 1AU2A 3C9EA 3IUTA 3V6CA 1A6RA 3IHPA 3P5UA 2G6DA 2FUDA 3P5XA 2P86A 2E02A 1POPA 1CVZA 3H8BA 3OF9A 1Y08A 4QH6A 1PXVA 4CDDB 3H7DA 1Y4HA 3QJ3A 3E1ZB 1NB3A 1NQCA 3N3KA 2HD5A 2IPPB 3HHAA 7PCKA 3CH2X 3H89A 3USVA 2PNSA 3MHHA 4PADA 4MZSA 2AUXA 2F7DA
chains in the Genus database with same CATH superfamily
2BU3A 4HWYA 2P0RA 1NB5A 1GECE 1S4VA 1U9VA 4MM3B 4FK5A 1EWMA 1SP4B 2OULA 2R6NA 4PT5A 4KLBA 4N79A 4K7CA 4RF0A 1AECA 3F5VA 4REZA 5CHTA 2DOSA 1MEMA 4RF1A 1M6DA 1TLOA 2XU3A 3N3GA 1QXPA 3RNVA 1UKFA 2H7JA 2FQ9A 3MHSA 2F1GA 3RVXA 4FIPA 4CDFB 2AU1A 2DC9A 1DF0A 2PBHA 1YK7A 4RY2A 3O1GA 4YVAA 1CV8A 4R3DA 1PCIA 3IFUA 2E01A 2FTDA 3D6SA 3IOQA 1F2CA 1NL6A 5CVNB 4BS6A 4QBBA 2YJBA 2IBIA 2HWKA 3PRPA 1PIPA 4BOUA 1BQIA 1XKGA 1YZBA 1YALA 2C0YA 3OVZA 2VHSA 3PT2A 1MIRA 5JA7A 3PW3A 2R9FA 1PPNA 1DKIA 1GMYA 1QMYA 4PP1A 3PRMA 2NQAA 4YYQA 2DCAA 4OW0A 4QRXA 3HWNA 1CTEA 1KHQA 2AUZA 3MTNA 1ATKA 4BOQA 2HH5A 3E9SA 3P5VA 2AIMA 6PADA 1GCBA 3RVVA 3CH3X 8PCHA 2JTCA 2DC6A 1Q6KA 4X6HA 1KFXL 1AYVA 2HXZA 1K3BB 4FJCA 1KXRA 1ME4A 2R9NA 3QSDA 2XU1A 1BP4A 4BOZA 2Y5BA 4GUAA 5PADA 4W4UA 3OISA 3LXSA 1U9XA 1PPDA 2PREA 1EWOA 2JQGR 2YJ2A 3AI8A 4Q8HA 3O65A 3WXFA 3IMAA 2FRAA 3M99A 2NQIA 2DCDA 3LFYA 1DEUA 4W5BA 1PE6A 1HUCB 3OF8A 2G7YA 3IV2A 3BWKA 2P7UA 3MJ5A 4WA6A 3BCNA 1VSNA 2R9CA 1AU0A 3W31A 4N4ZA 2HHNA 1QOLA 4P16A 2DZYA 3W30A 4P6EA 4OVZA 4X6IA 5CHVA 3KSEA 4N8WA 1AU4A 1CPJA 2AS8A 1MDWA 1PBHA 4BS5A 1KHPA 4RNAA 4YYRA 3ZNHA 1VJVA 5EZQA 5KO3A 2CIOA 2FO5A 3CBJA 1ME3A 2DC7A 4PP2E 3WXEA 5A24A 1IWDA 4AXMA 3KX1A 2R9MA 4OELA 2JRIA 2Y6EA 4BOPA 4YYSA 1BGOA 5E6JA 1F29A 3TNXA 2BDZA 2WBFX 3BC3A 4DMXA 1NLJA 4DMYA 2ATOA 3HHIA 4P6GA 3B21A 3KWZA 3OVXA 5EZSA 3PHWA 5J94A 5EGWA 3RVWA 3K9MA 2FYEA 3I06A 1U5IA 5FPWA 1STFE 3KKUA 2ACTA 4QRVA 2DCBA 3NHEA 2B1MA 2Z84A 4BPVA 1CQDA 3B79A 1QDQA 4PI3A 1TU6A 4MI7A 1MEGA 3HD3A 4CZWA 3CBKA 4XUIA 2GFOA 2G8EA 3P5WA 1YT7A 4Q8GA 3BB7A 2NQDB 2AYOA 5JH3A 3QT4A 1PPOA 2XU4A 1SNKA 2DC8A 2BTWA 1ZCMA 4IUMA 2FE8A 3PSEA 1ZIVA 4BOSA 1BY8A 1PADA 1CB5A 1AU3A 1AYUA 2AVWA 5K16A 4BQVA 3BBAA 4QRGA 2ARYA 3BPMA 1CJLA 4W5CA 3ERVA 2O6XA 1GLOA 2E00A 5EF4A 2YJCA 4I05A 3BPFA 1EWLA 2DCCA 2E03A 3ZUAA 4YV8A 2YJ8A 1PPPA 4D8BA 1ICFA 4HXDB 4IP3A 2AYNA 4CDCB 1O0EA 2GHUA 1EF7A 2PADA 3MP2A 1ITOA 1EWPA 3H6SA 4BSQA 1KFUL 9PAPA 2FT2A 3DF0A 3K8UA 2BTWB 4A5UA 4MSXA 3PBHA 2R9OA 1U9WA 2J7QA 3I3TA 4MZOA 2NQGA 2OZ2A 3BY4A 4ZUXU 2DZZA 1U9QX 1PVJA 3TMPA 4D8EA 3V6EA 4X6JA 3KW9A 1AIMA 4YYWA 3S3RA 2CB5A 3H8CA 5JZEA 1JQPA 2B1NA 2JQFR 3MORA 4CDEB 1FH0A 2DJGB 4I04A 3O0UA 3PHUA 1CSBB 5F02A 2G8JA 4ZTBA 2BDLA 4AXLA 4OEMA 3IEJA 1YK8A 2FRQA 5CVOB 3C0RA 4OVZB 4WURA 1F2BA 4XR7A 1YVBA 4I07A 2VHFA 2J7QC 4YYUA 1MHWA 1X9YA 4M0WA 3KWBX 4G54A 3GCBA 3PDFA 3MTVA 2YJ9A 3WXGA 4D8IA 1THEA 1AYWA 1TL9A 3S3QA 4YYVA 3F75A 3BOWA 3N4CA 3KFQA 3PHXA 4RKXA 2OP3A 3K24A 2XU5A 3PNRA 1F2AA 1MS6A 1NPZA 5CVMA 1CS8A 2DJFB 3U8EA 1AU2A 3C9EA 3IUTA 3V6CA 1A6RA 2AGAA 3IHPA 3P5UA 2G6DA 2FUDA 3P5XA 2P86A 2E02A 1POPA 1CVZA 3H8BA 3OF9A 1Y08A 4XZXA 3OQCA 4QH6A 1PXVA 4CDDB 3H7DA 1Y4HA 3QJ3A 3E1ZB 1NB3A 1NQCA 3N3KA 2HD5A 2IPPB 3HHAA 7PCKA 3CH2X 3H89A 3USVA 2PNSA 2UZJA 3MHHA 4PADA 4MZSA 2AUXA 3TRKA 2F7DA
chains in the Genus database with same CATH topology
4HWYA 2P0RA 1NB5A 1GECE 1S4VA 1U9VA 4FK5A 1EWMA 1SP4B 2OULA 2R6NA 4KLBA 4N79A 4K7CA 1AECA 3F5VA 5CHTA 1MEMA 1W4TA 1M6DA 1TLOA 2XU3A 3N3GA 1QXPA 2H7JA 2FQ9A 3MHSA 2F1GA 3RVXA 4FIPA 4CDFB 2AU1A 2DC9A 1DF0A 2PBHA 1YK7A 4RY2A 3O1GA 4YVAA 1CV8A 1PCIA 2E01A 2FTDA 3D6SA 3IOQA 1F2CA 1NL6A 5CVNB 4BS6A 4QBBA 2YJBA 2IBIA 1PIPA 1BQIA 1XKGA 1YALA 2C0YA 3OVZA 2VHSA 1MIRA 5JA7A 3PW3A 2R9FA 1PPNA 1GMYA 1QMYA 4PP1A 4YYQA 2NQAA 2DCAA 4QRXA 3HWNA 1CTEA 1KHQA 2AUZA 3MTNA 1ATKA 1W5RA 2HH5A 3P5VA 2AIMA 2BSZA 6PADA 1GCBA 3D9WA 3RVVA 3CH3X 8PCHA 2DC6A 1Q6KA 4X6HA 1KFXL 1AYVA 2HXZA 1K3BB 4FJCA 1KXRA 1ME4A 2R9NA 3QSDA 2XU1A 1BP4A 2Y5BA 5PADA 4W4UA 3OISA 4B55A 3LXSA 1U9XA 1PPDA 2PREA 1EWOA 2JQGR 2YJ2A 3AI8A 4Q8HA 2VFBA 3WXFA 3IMAA 2FRAA 3M99A 2NQIA 2DCDA 3LFYA 1DEUA 4W5BA 1PE6A 1HUCB 3OF8A 4GUZA 2G7YA 3IV2A 3BWKA 2P7UA 4WA6A 3BCNA 1VSNA 2R9CA 1AU0A 4N4ZA 2HHNA 1QOLA 2DZYA 4P6EA 4X6IA 5CHVA 3KSEA 4N8WA 1AU4A 1CPJA 2AS8A 1MDWA 1PBHA 4BS5A 1KHPA 4YYRA 1VJVA 2CIOA 2FO5A 3CBJA 1ME3A 2DC7A 4PP2E 3WXEA 5A24A 1IWDA 4AXMA 3KX1A 2R9MA 4OELA 2Y6EA 4YYSA 1BGOA 1F29A 3TNXA 2BDZA 2WBFX 3BC3A 4DMXA 1NLJA 4DMYA 2ATOA 3HHIA 4P6GA 3KWZA 3OVXA 5J94A 5EGWA 3RVWA 3K9MA 2FYEA 3I06A 1U5IA 5FPWA 1STFE 3KKUA 4C5PA 2ACTA 4QRVA 4BGFA 2DCBA 3NHEA 2B1MA 4BPVA 1CQDA 3B79A 1QDQA 4PI3A 1TU6A 1MEGA 3HD3A 4CZWA 3CBKA 4XUIA 2GFOA 2G8EA 3P5WA 1YT7A 4Q8GA 2NQDB 2AYOA 5JH3A 3QT4A 1PPOA 2XU4A 1SNKA 2DC8A 1ZCMA 1ZIVA 1BY8A 1PADA 1CB5A 1AU3A 1AYUA 2AVWA 5K16A 4BQVA 4QRGA 2ARYA 3BPMA 1CJLA 4W5CA 3ERVA 2O6XA 1GLOA 2E00A 5EF4A 2YJCA 4I05A 3BPFA 1EWLA 2DCCA 2E03A 3ZUAA 4YV8A 2YJ8A 1PPPA 1ICFA 4CDCB 2AYNA 1O0EA 2GHUA 1EF7A 2PADA 1ITOA 1EWPA 3H6SA 4BSQA 1KFUL 9PAPA 2FT2A 3DF0A 3K8UA 4MSXA 3PBHA 2R9OA 1U9WA 1W6FA 3I3TA 4MZOA 2NQGA 2OZ2A 4ZUXU 2DZZA 1U9QX 3V6EA 4X6JA 3KW9A 1AIMA 4YYWA 3S3RA 2CB5A 3H8CA 1JQPA 2B1NA 2JQFR 3MORA 4CDEB 1FH0A 2DJGB 4I04A 3O0UA 1CSBB 5F02A 2G8JA 2BDLA 4AXLA 4OEMA 3IEJA 1YK8A 2FRQA 5CVOB 1F2BA 4XR7A 1YVBA 4I07A 2VHFA 4YYUA 1MHWA 1X9YA 4NV8A 3KWBX 4G54A 3GCBA 3PDFA 2YJ9A 3WXGA 1THEA 1AYWA 1TL9A 3S3QA 4YYVA 3F75A 3BOWA 3N4CA 3KFQA 2VFCA 2OP3A 3K24A 2XU5A 1F2AA 1MS6A 1NPZA 3PNRA 5CVMA 1CS8A 2DJFB 3U8EA 1AU2A 3C9EA 1E2TA 3IUTA 3V6CA 1A6RA 3IHPA 3P5UA 4NV7A 2G6DA 2FUDA 3P5XA 2P86A 2E02A 1POPA 1CVZA 3H8BA 3OF9A 1Y08A 4QH6A 1PXVA 4CDDB 3H7DA 1Y4HA 3QJ3A 3E1ZB 1NB3A 1NQCA 3N3KA 2HD5A 2IPPB 3HHAA 7PCKA 3CH2X 3H89A 3USVA 2PNSA 3LTWA 3MHHA 4PADA 4MZSA 2AUXA 2F7DA 1GX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWY A;  2P0R A;  1NB5 A;  1GEC E;  1S4V A;  1U9V A;  4FK5 A;  1EWM A;  1SP4 B;  2OUL A;  2R6N A;  4KLB A;  4N79 A;  4K7C A;  1AEC A;  3F5V A;  5CHT A;  1MEM A;  1M6D A;  1TLO A;  2XU3 A;  3N3G A;  1QXP A;  2H7J A;  2FQ9 A;  3MHS A;  2F1G A;  3RVX A;  4FIP A;  4CDF B;  2AU1 A;  2DC9 A;  1DF0 A;  2PBH A;  1YK7 A;  4RY2 A;  3O1G A;  4YVA A;  1CV8 A;  1PCI A;  2E01 A;  2FTD A;  3D6S A;  3IOQ A;  1F2C A;  1NL6 A;  5CVN B;  4BS6 A;  4QBB A;  2YJB A;  2IBI A;  1PIP A;  1BQI A;  1XKG A;  1YAL A;  2C0Y A;  3OVZ A;  2VHS A;  1MIR A;  5JA7 A;  3PW3 A;  2R9F A;  1PPN A;  1GMY A;  1QMY A;  4PP1 A;  4YYQ A;  2NQA A;  2DCA A;  4QRX A;  3HWN A;  1CTE A;  1KHQ A;  2AUZ A;  3MTN A;  1ATK A;  2HH5 A;  3P5V A;  2AIM A;  6PAD A;  1GCB A;  3RVV A;  3CH3 X;  8PCH A;  2DC6 A;  1Q6K A;  4X6H A;  1KFX L;  1AYV A;  2HXZ A;  1K3B B;  4FJC A;  1KXR A;  1ME4 A;  2R9N A;  3QSD A;  2XU1 A;  1BP4 A;  2Y5B A;  5PAD A;  4W4U A;  3OIS A;  3LXS A;  1U9X A;  1PPD A;  2PRE A;  1EWO A;  2JQG R;  2YJ2 A;  3AI8 A;  4Q8H A;  3WXF A;  3IMA A;  2FRA A;  3M99 A;  2NQI A;  2DCD A;  3LFY A;  1DEU A;  4W5B A;  1PE6 A;  1HUC B;  3OF8 A;  2G7Y A;  3IV2 A;  3BWK A;  2P7U A;  4WA6 A;  3BCN A;  1VSN A;  2R9C A;  1AU0 A;  4N4Z A;  2HHN A;  1QOL A;  2DZY A;  4P6E A;  4X6I A;  5CHV A;  3KSE A;  4N8W A;  1AU4 A;  1CPJ A;  2AS8 A;  1MDW A;  1PBH A;  4BS5 A;  1KHP A;  4YYR A;  1VJV A;  2CIO A;  2FO5 A;  3CBJ A;  1ME3 A;  2DC7 A;  4PP2 E;  3WXE A;  5A24 A;  1IWD A;  4AXM A;  3KX1 A;  2R9M A;  4OEL A;  2Y6E A;  4YYS A;  1BGO A;  1F29 A;  3TNX A;  2BDZ A;  2WBF X;  3BC3 A;  4DMX A;  1NLJ A;  4DMY A;  2ATO A;  3HHI A;  4P6G A;  3KWZ A;  3OVX A;  5J94 A;  5EGW A;  3RVW A;  3K9M A;  2FYE A;  3I06 A;  1U5I A;  5FPW A;  1STF E;  3KKU A;  2ACT A;  4QRV A;  2DCB A;  3NHE A;  2B1M A;  4BPV A;  1CQD A;  3B79 A;  1QDQ A;  4PI3 A;  1TU6 A;  1MEG A;  3HD3 A;  4CZW A;  3CBK A;  4XUI A;  2GFO A;  2G8E A;  3P5W A;  1YT7 A;  4Q8G A;  2NQD B;  2AYO A;  5JH3 A;  3QT4 A;  1PPO A;  2XU4 A;  1SNK A;  2DC8 A;  1ZCM A;  1ZIV A;  1BY8 A;  1PAD A;  1CB5 A;  1AU3 A;  1AYU A;  2AVW A;  5K16 A;  4BQV A;  4QRG A;  2ARY A;  3BPM A;  1CJL A;  4W5C A;  3ERV A;  2O6X A;  1GLO A;  2E00 A;  5EF4 A;  2YJC A;  4I05 A;  3BPF A;  1EWL A;  2DCC A;  2E03 A;  3ZUA A;  4YV8 A;  2YJ8 A;  1PPP A;  1ICF A;  4CDC B;  2AYN A;  1O0E A;  2GHU A;  1EF7 A;  2PAD A;  1ITO A;  1EWP A;  3H6S A;  4BSQ A;  1KFU L;  9PAP A;  2FT2 A;  3DF0 A;  3K8U A;  4MSX A;  3PBH A;  2R9O A;  1U9W A;  3I3T A;  4MZO A;  2NQG A;  2OZ2 A;  4ZUX U;  2DZZ A;  1U9Q X;  3V6E A;  4X6J A;  3KW9 A;  1AIM A;  4YYW A;  3S3R A;  2CB5 A;  3H8C A;  1JQP A;  2B1N A;  2JQF R;  3MOR A;  4CDE B;  1FH0 A;  2DJG B;  4I04 A;  3O0U A;  1CSB B;  5F02 A;  2G8J A;  2BDL A;  4AXL A;  4OEM A;  3IEJ A;  1YK8 A;  2FRQ A;  5CVO B;  1F2B A;  4XR7 A;  1YVB A;  4I07 A;  2VHF A;  4YYU A;  1MHW A;  1X9Y A;  3KWB X;  4G54 A;  3GCB A;  3PDF A;  2YJ9 A;  3WXG A;  1THE A;  1AYW A;  1TL9 A;  3S3Q A;  4YYV A;  3F75 A;  3BOW A;  3N4C A;  3KFQ A;  2OP3 A;  3K24 A;  2XU5 A;  1F2A A;  1MS6 A;  1NPZ A;  3PNR A;  5CVM A;  1CS8 A;  2DJF B;  3U8E A;  1AU2 A;  3C9E A;  3IUT A;  3V6C A;  1A6R A;  3IHP A;  3P5U A;  2G6D A;  2FUD A;  3P5X A;  2P86 A;  2E02 A;  1POP A;  1CVZ A;  3H8B A;  3OF9 A;  1Y08 A;  4QH6 A;  1PXV A;  4CDD B;  3H7D A;  1Y4H A;  3QJ3 A;  3E1Z B;  1NB3 A;  1NQC A;  3N3K A;  2HD5 A;  2IPP B;  3HHA A;  7PCK A;  3CH2 X;  3H89 A;  3USV A;  2PNS A;  3MHH A;  4PAD A;  4MZS A;  2AUX A;  2F7D A; 
#chains in the Genus database with same CATH topology
 2BU3 A;  4HWY A;  2P0R A;  1NB5 A;  1GEC E;  1S4V A;  1U9V A;  4MM3 B;  4FK5 A;  1EWM A;  1SP4 B;  2OUL A;  2R6N A;  4PT5 A;  4KLB A;  4N79 A;  4K7C A;  4RF0 A;  1AEC A;  3F5V A;  4REZ A;  5CHT A;  2DOS A;  1MEM A;  4RF1 A;  1M6D A;  1TLO A;  2XU3 A;  3N3G A;  1QXP A;  3RNV A;  1UKF A;  2H7J A;  2FQ9 A;  3MHS A;  2F1G A;  3RVX A;  4FIP A;  4CDF B;  2AU1 A;  2DC9 A;  1DF0 A;  2PBH A;  1YK7 A;  4RY2 A;  3O1G A;  4YVA A;  1CV8 A;  4R3D A;  1PCI A;  3IFU A;  2E01 A;  2FTD A;  3D6S A;  3IOQ A;  1F2C A;  1NL6 A;  5CVN B;  4BS6 A;  4QBB A;  2YJB A;  2IBI A;  2HWK A;  3PRP A;  1PIP A;  4BOU A;  1BQI A;  1XKG A;  1YZB A;  1YAL A;  2C0Y A;  3OVZ A;  2VHS A;  3PT2 A;  1MIR A;  5JA7 A;  3PW3 A;  2R9F A;  1PPN A;  1DKI A;  1GMY A;  1QMY A;  4PP1 A;  3PRM A;  2NQA A;  4YYQ A;  2DCA A;  4OW0 A;  4QRX A;  3HWN A;  1CTE A;  1KHQ A;  2AUZ A;  3MTN A;  1ATK A;  4BOQ A;  2HH5 A;  3E9S A;  3P5V A;  2AIM A;  6PAD A;  1GCB A;  3RVV A;  3CH3 X;  8PCH A;  2JTC A;  2DC6 A;  1Q6K A;  4X6H A;  1KFX L;  1AYV A;  2HXZ A;  1K3B B;  4FJC A;  1KXR A;  1ME4 A;  2R9N A;  3QSD A;  2XU1 A;  1BP4 A;  4BOZ A;  2Y5B A;  4GUA A;  5PAD A;  4W4U A;  3OIS A;  3LXS A;  1U9X A;  1PPD A;  2PRE A;  1EWO A;  2JQG R;  2YJ2 A;  3AI8 A;  4Q8H A;  3O65 A;  3WXF A;  3IMA A;  2FRA A;  3M99 A;  2NQI A;  2DCD A;  3LFY A;  1DEU A;  4W5B A;  1PE6 A;  1HUC B;  3OF8 A;  2G7Y A;  3IV2 A;  3BWK A;  2P7U A;  3MJ5 A;  4WA6 A;  3BCN A;  1VSN A;  2R9C A;  1AU0 A;  3W31 A;  4N4Z A;  2HHN A;  1QOL A;  4P16 A;  2DZY A;  3W30 A;  4P6E A;  4OVZ A;  4X6I A;  5CHV A;  3KSE A;  4N8W A;  1AU4 A;  1CPJ A;  2AS8 A;  1MDW A;  1PBH A;  4BS5 A;  1KHP A;  4RNA A;  4YYR A;  3ZNH A;  1VJV A;  5EZQ A;  5KO3 A;  2CIO A;  2FO5 A;  3CBJ A;  1ME3 A;  2DC7 A;  4PP2 E;  3WXE A;  5A24 A;  1IWD A;  4AXM A;  3KX1 A;  2R9M A;  4OEL A;  2JRI A;  2Y6E A;  4BOP A;  4YYS A;  1BGO A;  5E6J A;  1F29 A;  3TNX A;  2BDZ A;  2WBF X;  3BC3 A;  4DMX A;  1NLJ A;  4DMY A;  2ATO A;  3HHI A;  4P6G A;  3B21 A;  3KWZ A;  3OVX A;  5EZS A;  3PHW A;  5J94 A;  5EGW A;  3RVW A;  3K9M A;  2FYE A;  3I06 A;  1U5I A;  5FPW A;  1STF E;  3KKU A;  2ACT A;  4QRV A;  2DCB A;  3NHE A;  2B1M A;  2Z84 A;  4BPV A;  1CQD A;  3B79 A;  1QDQ A;  4PI3 A;  1TU6 A;  4MI7 A;  1MEG A;  3HD3 A;  4CZW A;  3CBK A;  4XUI A;  2GFO A;  2G8E A;  3P5W A;  1YT7 A;  4Q8G A;  3BB7 A;  2NQD B;  2AYO A;  5JH3 A;  3QT4 A;  1PPO A;  2XU4 A;  1SNK A;  2DC8 A;  2BTW A;  1ZCM A;  4IUM A;  2FE8 A;  3PSE A;  1ZIV A;  4BOS A;  1BY8 A;  1PAD A;  1CB5 A;  1AU3 A;  1AYU A;  2AVW A;  5K16 A;  4BQV A;  3BBA A;  4QRG A;  2ARY A;  3BPM A;  1CJL A;  4W5C A;  3ERV A;  2O6X A;  1GLO A;  2E00 A;  5EF4 A;  2YJC A;  4I05 A;  3BPF A;  1EWL A;  2DCC A;  2E03 A;  3ZUA A;  4YV8 A;  2YJ8 A;  1PPP A;  4D8B A;  1ICF A;  4HXD B;  4IP3 A;  2AYN A;  4CDC B;  1O0E A;  2GHU A;  1EF7 A;  2PAD A;  3MP2 A;  1ITO A;  1EWP A;  3H6S A;  4BSQ A;  1KFU L;  9PAP A;  2FT2 A;  3DF0 A;  3K8U A;  2BTW B;  4A5U A;  4MSX A;  3PBH A;  2R9O A;  1U9W A;  2J7Q A;  3I3T A;  4MZO A;  2NQG A;  2OZ2 A;  3BY4 A;  4ZUX U;  2DZZ A;  1U9Q X;  1PVJ A;  3TMP A;  4D8E A;  3V6E A;  4X6J A;  3KW9 A;  1AIM A;  4YYW A;  3S3R A;  2CB5 A;  3H8C A;  5JZE A;  1JQP A;  2B1N A;  2JQF R;  3MOR A;  4CDE B;  1FH0 A;  2DJG B;  4I04 A;  3O0U A;  3PHU A;  1CSB B;  5F02 A;  2G8J A;  4ZTB A;  2BDL A;  4AXL A;  4OEM A;  3IEJ A;  1YK8 A;  2FRQ A;  5CVO B;  3C0R A;  4OVZ B;  4WUR A;  1F2B A;  4XR7 A;  1YVB A;  4I07 A;  2VHF A;  2J7Q C;  4YYU A;  1MHW A;  1X9Y A;  4M0W A;  3KWB X;  4G54 A;  3GCB A;  3PDF A;  3MTV A;  2YJ9 A;  3WXG A;  4D8I A;  1THE A;  1AYW A;  1TL9 A;  3S3Q A;  4YYV A;  3F75 A;  3BOW A;  3N4C A;  3KFQ A;  3PHX A;  4RKX A;  2OP3 A;  3K24 A;  2XU5 A;  3PNR A;  1F2A A;  1MS6 A;  1NPZ A;  5CVM A;  1CS8 A;  2DJF B;  3U8E A;  1AU2 A;  3C9E A;  3IUT A;  3V6C A;  1A6R A;  2AGA A;  3IHP A;  3P5U A;  2G6D A;  2FUD A;  3P5X A;  2P86 A;  2E02 A;  1POP A;  1CVZ A;  3H8B A;  3OF9 A;  1Y08 A;  4XZX A;  3OQC A;  4QH6 A;  1PXV A;  4CDD B;  3H7D A;  1Y4H A;  3QJ3 A;  3E1Z B;  1NB3 A;  1NQC A;  3N3K A;  2HD5 A;  2IPP B;  3HHA A;  7PCK A;  3CH2 X;  3H89 A;  3USV A;  2PNS A;  2UZJ A;  3MHH A;  4PAD A;  4MZS A;  2AUX A;  3TRK A;  2F7D A; 
#chains in the Genus database with same CATH homology
 4HWY A;  2P0R A;  1NB5 A;  1GEC E;  1S4V A;  1U9V A;  4FK5 A;  1EWM A;  1SP4 B;  2OUL A;  2R6N A;  4KLB A;  4N79 A;  4K7C A;  1AEC A;  3F5V A;  5CHT A;  1MEM A;  1W4T A;  1M6D A;  1TLO A;  2XU3 A;  3N3G A;  1QXP A;  2H7J A;  2FQ9 A;  3MHS A;  2F1G A;  3RVX A;  4FIP A;  4CDF B;  2AU1 A;  2DC9 A;  1DF0 A;  2PBH A;  1YK7 A;  4RY2 A;  3O1G A;  4YVA A;  1CV8 A;  1PCI A;  2E01 A;  2FTD A;  3D6S A;  3IOQ A;  1F2C A;  1NL6 A;  5CVN B;  4BS6 A;  4QBB A;  2YJB A;  2IBI A;  1PIP A;  1BQI A;  1XKG A;  1YAL A;  2C0Y A;  3OVZ A;  2VHS A;  1MIR A;  5JA7 A;  3PW3 A;  2R9F A;  1PPN A;  1GMY A;  1QMY A;  4PP1 A;  4YYQ A;  2NQA A;  2DCA A;  4QRX A;  3HWN A;  1CTE A;  1KHQ A;  2AUZ A;  3MTN A;  1ATK A;  1W5R A;  2HH5 A;  3P5V A;  2AIM A;  2BSZ A;  6PAD A;  1GCB A;  3D9W A;  3RVV A;  3CH3 X;  8PCH A;  2DC6 A;  1Q6K A;  4X6H A;  1KFX L;  1AYV A;  2HXZ A;  1K3B B;  4FJC A;  1KXR A;  1ME4 A;  2R9N A;  3QSD A;  2XU1 A;  1BP4 A;  2Y5B A;  5PAD A;  4W4U A;  3OIS A;  4B55 A;  3LXS A;  1U9X A;  1PPD A;  2PRE A;  1EWO A;  2JQG R;  2YJ2 A;  3AI8 A;  4Q8H A;  2VFB A;  3WXF A;  3IMA A;  2FRA A;  3M99 A;  2NQI A;  2DCD A;  3LFY A;  1DEU A;  4W5B A;  1PE6 A;  1HUC B;  3OF8 A;  4GUZ A;  2G7Y A;  3IV2 A;  3BWK A;  2P7U A;  4WA6 A;  3BCN A;  1VSN A;  2R9C A;  1AU0 A;  4N4Z A;  2HHN A;  1QOL A;  2DZY A;  4P6E A;  4X6I A;  5CHV A;  3KSE A;  4N8W A;  1AU4 A;  1CPJ A;  2AS8 A;  1MDW A;  1PBH A;  4BS5 A;  1KHP A;  4YYR A;  1VJV A;  2CIO A;  2FO5 A;  3CBJ A;  1ME3 A;  2DC7 A;  4PP2 E;  3WXE A;  5A24 A;  1IWD A;  4AXM A;  3KX1 A;  2R9M A;  4OEL A;  2Y6E A;  4YYS A;  1BGO A;  1F29 A;  3TNX A;  2BDZ A;  2WBF X;  3BC3 A;  4DMX A;  1NLJ A;  4DMY A;  2ATO A;  3HHI A;  4P6G A;  3KWZ A;  3OVX A;  5J94 A;  5EGW A;  3RVW A;  3K9M A;  2FYE A;  3I06 A;  1U5I A;  5FPW A;  1STF E;  3KKU A;  4C5P A;  2ACT A;  4QRV A;  4BGF A;  2DCB A;  3NHE A;  2B1M A;  4BPV A;  1CQD A;  3B79 A;  1QDQ A;  4PI3 A;  1TU6 A;  1MEG A;  3HD3 A;  4CZW A;  3CBK A;  4XUI A;  2GFO A;  2G8E A;  3P5W A;  1YT7 A;  4Q8G A;  2NQD B;  2AYO A;  5JH3 A;  3QT4 A;  1PPO A;  2XU4 A;  1SNK A;  2DC8 A;  1ZCM A;  1ZIV A;  1BY8 A;  1PAD A;  1CB5 A;  1AU3 A;  1AYU A;  2AVW A;  5K16 A;  4BQV A;  4QRG A;  2ARY A;  3BPM A;  1CJL A;  4W5C A;  3ERV A;  2O6X A;  1GLO A;  2E00 A;  5EF4 A;  2YJC A;  4I05 A;  3BPF A;  1EWL A;  2DCC A;  2E03 A;  3ZUA A;  4YV8 A;  2YJ8 A;  1PPP A;  1ICF A;  4CDC B;  2AYN A;  1O0E A;  2GHU A;  1EF7 A;  2PAD A;  1ITO A;  1EWP A;  3H6S A;  4BSQ A;  1KFU L;  9PAP A;  2FT2 A;  3DF0 A;  3K8U A;  4MSX A;  3PBH A;  2R9O A;  1U9W A;  1W6F A;  3I3T A;  4MZO A;  2NQG A;  2OZ2 A;  4ZUX U;  2DZZ A;  1U9Q X;  3V6E A;  4X6J A;  3KW9 A;  1AIM A;  4YYW A;  3S3R A;  2CB5 A;  3H8C A;  1JQP A;  2B1N A;  2JQF R;  3MOR A;  4CDE B;  1FH0 A;  2DJG B;  4I04 A;  3O0U A;  1CSB B;  5F02 A;  2G8J A;  2BDL A;  4AXL A;  4OEM A;  3IEJ A;  1YK8 A;  2FRQ A;  5CVO B;  1F2B A;  4XR7 A;  1YVB A;  4I07 A;  2VHF A;  4YYU A;  1MHW A;  1X9Y A;  4NV8 A;  3KWB X;  4G54 A;  3GCB A;  3PDF A;  2YJ9 A;  3WXG A;  1THE A;  1AYW A;  1TL9 A;  3S3Q A;  4YYV A;  3F75 A;  3BOW A;  3N4C A;  3KFQ A;  2VFC A;  2OP3 A;  3K24 A;  2XU5 A;  1F2A A;  1MS6 A;  1NPZ A;  3PNR A;  5CVM A;  1CS8 A;  2DJF B;  3U8E A;  1AU2 A;  3C9E A;  1E2T A;  3IUT A;  3V6C A;  1A6R A;  3IHP A;  3P5U A;  4NV7 A;  2G6D A;  2FUD A;  3P5X A;  2P86 A;  2E02 A;  1POP A;  1CVZ A;  3H8B A;  3OF9 A;  1Y08 A;  4QH6 A;  1PXV A;  4CDD B;  3H7D A;  1Y4H A;  3QJ3 A;  3E1Z B;  1NB3 A;  1NQC A;  3N3K A;  2HD5 A;  2IPP B;  3HHA A;  7PCK A;  3CH2 X;  3H89 A;  3USV A;  2PNS A;  3LTW A;  3MHH A;  4PAD A;  4MZS A;  2AUX A;  2F7D A;  1GX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...