2F7DA

A mutant rabbit cathepsin k with a nitrile inhibitor
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
215
structure length
215
Chain Sequence
b'TPDSIDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQRNRGIDSEDAYPYVGQDESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDENCSSDNLNHAVLAVGYGIQKGNKHWIIKNSWGESWGNKGYILMARNKNNACGIANLASFPKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title Beta-substituted cyclohexanecarboxamide: a nonpeptidic framework for the design of potent inhibitors of cathepsin K.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Hydrolase
total genus 63
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2005-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2f7dA00
2AYNA 4YVAA 1U9WA 3KW9A 2DC9A 2P86A 3PDFA 2XU5A 4XR7A 5CHTA 3BPMA 2H7JA 5CHVA 4HWYA 3TNXA 3BPFA 2OULA 1NL6A 1KHQA 2O6XA 1EWOA 2F7DA 2HH5A 5EGWA 4YV8A 1PXVA 1F2BA 1STFE 4I07A 3O0UA 4MSXA 4K7CA 1AYUA 1PPPA 1Y4HA 3RVVA 3IOQA 2DC7A 2XU1A 4Q8GA 2FRQA 2NQIA 3H8BA 4CZWA 3D6SA 3WXGA 1VSNA 1BY8A 2JQGR 3MHHA 1SP4B 3H6SA 4P6EA 2B1MA 2GFOA 1MIRA 2XU4A 1F29A 4G54A 4PADA 2B1NA 4YYWA 1PPDA 3E1ZB 1CS8A 2BDLA 5CVNB 2AUZA 4W4UA 3PNRA 1MDWA 3MHSA 1AU3A 4CDEB 7PCKA 3S3RA 2FTDA 3HWNA 1POPA 2P7UA 2R6NA 1CJLA 2CB5A 1U9XA 2DCCA 1ICFA 1ME4A 3S3QA 3O1GA 2VHSA 3V6EA 1IWDA 1YT7A 2WBFX 4MZOA 4W5BA 3IUTA 4BS5A 1VJVA 1U9QX 5CVMA 3RVWA 1PIPA 1PE6A 2NQDB 5CVOB 3ZUAA 1ATKA 1KXRA 1XKGA 1MEMA 3MORA 9PAPA 2R9NA 1EWPA 1QOLA 3BC3A 2DC6A 4PP2E 3IHPA 1PBHA 4FK5A 1GMYA 4ZUXU 2AVWA 1GCBA 2XU3A 3HHAA 1Q6KA 3P5VA 4I05A 4DMXA 4MZSA 1U5IA 5K16A 2G8JA 1DEUA 3RVXA 1AU0A 4OELA 4PP1A 2AUXA 3I3TA 2BDZA 2E02A 1BQIA 3F75A 4OEMA 3I06A 4W5CA 5JH3A 1HUCB 1F2CA 4CDDB 3HD3A 1BP4A 3P5UA 2IPPB 4YYVA 2FO5A 2NQGA 2AS8A 4RY2A 3U8EA 2Y6EA 4BS6A 3V6CA 3OF8A 3BOWA 3OVXA 2ACTA 8PCHA 1NPZA 3KKUA 3KFQA 2FRAA 4WA6A 2JQFR 1JQPA 3PW3A 3IEJA 1QXPA 4I04A 2E03A 1AYVA 1X9YA 2YJ2A 3BWKA 6PADA 2PNSA 1MHWA 5A24A 1ZCMA 4FIPA 4BSQA 1M6DA 3LXSA 3LFYA 4Q8HA 2YJCA 1THEA 2HXZA 2VHFA 1AU2A 1CQDA 2Y5BA 4AXLA 1NLJA 1CB5A 1GECE 2R9CA 2DC8A 2YJ9A 3BCNA 3KSEA 3OF9A 1BGOA 1TLOA 2DCDA 3HHIA 2PADA 2AIMA 3KWZA 1QDQA 4QBBA 3M99A 1CPJA 4YYQA 3CH2X 1SNKA 2R9FA 4DMYA 3NHEA 2FUDA 3H8CA 4QH6A 2DCAA 2G7YA 1QMYA 3CH3X 2FT2A 3WXFA 3N3KA 5PADA 1EWLA 1F2AA 1KFUL 1ITOA 1ZIVA 2AU1A 1PPNA 1CSBB 3AI8A 4X6JA 2HHNA 1AYWA 3N4CA 2P0RA 1EF7A 3K9MA 4BPVA 2YJBA 1DF0A 2DJFB 4KLBA 2DZYA 1AIMA 1CTEA 1NB5A 1CV8A 4P6GA 3PBHA 3H89A 1YK7A 4QRVA 2DJGB 4AXMA 2ATOA 1S4VA 2FYEA 1YK8A 3H7DA 2R9OA 2F1GA 5JA7A 4QRGA 3GCBA 4CDFB 2ARYA 2IBIA 1MS6A 1CVZA 2PBHA 3B79A 4N79A 2FQ9A 3CBKA 1PCIA 3QJ3A 5EF4A 2OZ2A 3C9EA 4BQVA 2G8EA 3OISA 2GHUA 3USVA 4XUIA 4PI3A 1GLOA 3DF0A 1NQCA 2AYOA 2HD5A 4YYUA 3IMAA 1PPOA 4X6HA 1ME3A 1PADA 1MEGA 2C0YA 5F02A 3ERVA 3P5WA 1KFXL 3KWBX 4N8WA 3QT4A 1KHPA 3QSDA 2DCBA 2G6DA 2R9MA 4N4ZA 3K24A 1AECA 2CIOA 4FJCA 2DZZA 3N3GA 2E00A 1YALA 2NQAA 3CBJA 3WXEA 1O0EA 1TU6A 3MTNA 1Y08A 2YJ8A 4QRXA 1U9VA 3IV2A 1FH0A 5FPWA 1TL9A 3KX1A 4YYSA 1K3BB 3P5XA 2OP3A 2PREA 3OVZA 1AU4A 5J94A 1EWMA 3F5VA 4CDCB 1NB3A 1YVBA 4YYRA 4X6IA 2E01A 3K8UA 1A6RA
chains in the Genus database with same CATH superfamily
2AYNA 2BTWA 3ZNHA 4YVAA 1U9WA 4XZXA 3RNVA 3KW9A 4PT5A 2DC9A 2P86A 3PDFA 3OQCA 3BBAA 2XU5A 4XR7A 5CHTA 3BPMA 2H7JA 5CHVA 4HWYA 3TNXA 2HWKA 3BPFA 2OULA 1NL6A 1KHQA 2O6XA 1EWOA 2F7DA 2HH5A 3PRMA 3MP2A 5EGWA 4YV8A 1PXVA 4MM3B 1F2BA 1STFE 4I07A 3O0UA 4MSXA 4OW0A 4K7CA 1AYUA 1PPPA 3PRPA 1Y4HA 3MTVA 2JTCA 1UKFA 3TMPA 3RVVA 3IOQA 2DC7A 2XU1A 4Q8GA 2AGAA 2FRQA 2NQIA 3H8BA 4ZTBA 4CZWA 3D6SA 3WXGA 1VSNA 1BY8A 2JQGR 3MHHA 1SP4B 3H6SA 4OVZA 2B1MA 2GFOA 4P6EA 4IUMA 1MIRA 2XU4A 1F29A 4RNAA 4G54A 4PADA 2B1NA 4YYWA 1PPDA 3E1ZB 1CS8A 2BDLA 5CVNB 2AUZA 4W4UA 3PNRA 1MDWA 3PT2A 3MHSA 1AU3A 4CDEB 7PCKA 3S3RA 2FTDA 3HWNA 1POPA 2P7UA 2R6NA 1CJLA 2CB5A 1U9XA 2DCCA 1ICFA 1ME4A 3S3QA 3O1GA 2VHSA 3V6EA 1IWDA 1YT7A 2WBFX 4MZOA 4W5BA 3IUTA 4BS5A 4REZA 1VJVA 1U9QX 5CVMA 3RVWA 1PIPA 1PE6A 2NQDB 3PSEA 5CVOB 3ZUAA 1ATKA 1KXRA 1XKGA 3MORA 1MEMA 1YZBA 9PAPA 2R9NA 4D8BA 1EWPA 1QOLA 3BC3A 2DC6A 4PP2E 3IHPA 1PBHA 4FK5A 1GMYA 4D8EA 4ZUXU 2AVWA 1GCBA 2XU3A 3HHAA 1Q6KA 3P5VA 4I05A 3E9SA 4DMXA 4IP3A 4MI7A 4MZSA 1U5IA 5K16A 2G8JA 5KO3A 1DEUA 3RVXA 1AU0A 4OELA 4PP1A 2AUXA 3I3TA 2BDZA 2E02A 3W31A 1BQIA 3F75A 4OEMA 3I06A 4W5CA 5JH3A 1HUCB 1F2CA 4CDDB 3HD3A 1BP4A 3P5UA 2IPPB 4YYVA 2FO5A 2NQGA 2AS8A 2BTWB 4RY2A 3U8EA 2Y6EA 4BOUA 4BS6A 3V6CA 3OF8A 3BOWA 3OVXA 2ACTA 8PCHA 1NPZA 3KKUA 3KFQA 2FRAA 4WA6A 2JQFR 1JQPA 3PW3A 3IEJA 1QXPA 4I04A 2E03A 1AYVA 1X9YA 2YJ2A 3BWKA 6PADA 2PNSA 5JZEA 1MHWA 5A24A 1ZCMA 4FIPA 4BSQA 1M6DA 3BY4A 3LXSA 2DOSA 4BOQA 3LFYA 4Q8HA 2YJCA 1THEA 2HXZA 2VHFA 1AU2A 1CQDA 2Y5BA 4AXLA 1NLJA 1CB5A 1GECE 2R9CA 2DC8A 2YJ9A 2BU3A 3BCNA 3KSEA 3OF9A 2J7QC 2UZJA 1BGOA 1TLOA 2DCDA 3HHIA 2PADA 2AIMA 3KWZA 3W30A 1QDQA 4D8IA 4QBBA 3M99A 4RKXA 1CPJA 4BOPA 4OVZB 4YYQA 3CH2X 1SNKA 2R9FA 2J7QA 4DMYA 3NHEA 2FUDA 3H8CA 4QH6A 2DCAA 2G7YA 1QMYA 3CH3X 2FT2A 1DKIA 4WURA 3WXFA 3N3KA 5PADA 1EWLA 1F2AA 1KFUL 1ITOA 1ZIVA 2AU1A 1PPNA 1CSBB 4GUAA 3AI8A 4X6JA 2HHNA 1AYWA 3N4CA 2P0RA 1EF7A 3K9MA 4BPVA 2YJBA 1DF0A 2DJFB 4KLBA 2DZYA 1AIMA 4HXDB 1CTEA 1NB5A 1CV8A 4P6GA 3BB7A 3PBHA 3H89A 1YK7A 4QRVA 2DJGB 5EZSA 2FE8A 4AXMA 2ATOA 1S4VA 4M0WA 3IFUA 2FYEA 1YK8A 3PHWA 3C0RA 3H7DA 4RF1A 2R9OA 2F1GA 5JA7A 4QRGA 3GCBA 3B21A 4P16A 4CDFB 2ARYA 2Z84A 2IBIA 3PHUA 1MS6A 1CVZA 2PBHA 3B79A 4N79A 2FQ9A 3CBKA 1PCIA 3QJ3A 5EF4A 2OZ2A 3C9EA 4BQVA 2G8EA 3OISA 4A5UA 2GHUA 1PVJA 3USVA 4XUIA 4PI3A 1GLOA 3DF0A 1NQCA 2AYOA 4BOZA 2HD5A 4YYUA 3IMAA 1PPOA 4X6HA 1ME3A 1PADA 1MEGA 2C0YA 3MJ5A 5F02A 3ERVA 3P5WA 1KFXL 3KWBX 4N8WA 3QT4A 2JRIA 1KHPA 3QSDA 2DCBA 2G6DA 2R9MA 4N4ZA 3K24A 1AECA 2CIOA 4FJCA 2DZZA 3N3GA 2E00A 3PHXA 3TRKA 1YALA 2NQAA 3CBJA 3WXEA 1O0EA 1TU6A 3MTNA 1Y08A 2YJ8A 4QRXA 4R3DA 1U9VA 5E6JA 3IV2A 1FH0A 5FPWA 1TL9A 3KX1A 4YYSA 1K3BB 4RF0A 3P5XA 2OP3A 2PREA 3OVZA 1AU4A 5J94A 1EWMA 3F5VA 4CDCB 1NB3A 3O65A 1YVBA 4YYRA 4BOSA 4X6IA 5EZQA 2E01A 3K8UA 1A6RA
chains in the Genus database with same CATH topology
2AYNA 4YVAA 1U9WA 3KW9A 2DC9A 2P86A 3PDFA 2XU5A 4XR7A 5CHTA 3BPMA 2H7JA 5CHVA 4HWYA 3TNXA 3BPFA 2OULA 1NL6A 1KHQA 4C5PA 2VFCA 2O6XA 4NV8A 1EWOA 2F7DA 2HH5A 5EGWA 4YV8A 1PXVA 1F2BA 1STFE 4I07A 3O0UA 4MSXA 4K7CA 1AYUA 1PPPA 1Y4HA 3RVVA 3IOQA 2DC7A 2XU1A 4Q8GA 2FRQA 2NQIA 3H8BA 4CZWA 3D6SA 3WXGA 1VSNA 1BY8A 2JQGR 3MHHA 1SP4B 3H6SA 2B1MA 2GFOA 4P6EA 1MIRA 2XU4A 1F29A 4G54A 4PADA 2B1NA 4YYWA 1PPDA 3E1ZB 1CS8A 2BDLA 5CVNB 1W5RA 2AUZA 4W4UA 3PNRA 1MDWA 3MHSA 1AU3A 4CDEB 7PCKA 3S3RA 2FTDA 3HWNA 1POPA 2P7UA 2R6NA 1CJLA 2CB5A 1U9XA 2DCCA 1ICFA 1ME4A 3S3QA 3O1GA 2VHSA 3V6EA 1IWDA 1YT7A 2WBFX 4MZOA 4BGFA 4W5BA 3IUTA 2BSZA 4BS5A 1VJVA 4NV7A 1U9QX 5CVMA 3RVWA 1PIPA 1PE6A 2NQDB 5CVOB 3ZUAA 1ATKA 1KXRA 1XKGA 1MEMA 3MORA 9PAPA 2R9NA 1EWPA 1QOLA 3BC3A 2DC6A 4PP2E 3IHPA 1PBHA 4FK5A 1GMYA 4ZUXU 2AVWA 1GCBA 2XU3A 3HHAA 2VFBA 1Q6KA 3P5VA 1E2TA 4I05A 4DMXA 4MZSA 1U5IA 5K16A 2G8JA 1DEUA 3RVXA 1AU0A 4OELA 4PP1A 2AUXA 3I3TA 2BDZA 2E02A 1W4TA 1BQIA 3F75A 4OEMA 3I06A 4W5CA 5JH3A 1HUCB 1F2CA 4CDDB 3HD3A 1BP4A 3P5UA 2IPPB 4YYVA 2FO5A 2NQGA 2AS8A 4RY2A 3U8EA 2Y6EA 4BS6A 3V6CA 3OF8A 3BOWA 1GX3A 3OVXA 2ACTA 8PCHA 1NPZA 3KKUA 3KFQA 2FRAA 4WA6A 2JQFR 1JQPA 3PW3A 3IEJA 1QXPA 4I04A 2E03A 1AYVA 1X9YA 2YJ2A 3BWKA 6PADA 2PNSA 1MHWA 5A24A 1ZCMA 4FIPA 4BSQA 1M6DA 3LXSA 3LFYA 4Q8HA 2YJCA 1THEA 2HXZA 2VHFA 3LTWA 1AU2A 1CQDA 2Y5BA 1NLJA 1CB5A 4AXLA 1GECE 2R9CA 2DC8A 2YJ9A 3BCNA 3KSEA 4GUZA 3OF9A 1BGOA 1TLOA 2DCDA 3HHIA 2PADA 2AIMA 3KWZA 1QDQA 4QBBA 3M99A 1CPJA 4YYQA 3CH2X 1SNKA 2R9FA 4DMYA 3NHEA 2FUDA 3H8CA 4QH6A 2DCAA 2G7YA 1QMYA 3CH3X 2FT2A 3WXFA 3N3KA 5PADA 1EWLA 1F2AA 1KFUL 1ITOA 1ZIVA 2AU1A 1PPNA 1CSBB 3AI8A 4X6JA 2HHNA 1AYWA 3N4CA 2P0RA 1W6FA 1EF7A 3K9MA 4BPVA 2YJBA 1DF0A 2DJFB 4KLBA 2DZYA 1AIMA 1CTEA 1NB5A 1CV8A 4P6GA 3PBHA 3H89A 1YK7A 4QRVA 2DJGB 4AXMA 2ATOA 1S4VA 2FYEA 1YK8A 3H7DA 2R9OA 2F1GA 5JA7A 4QRGA 3GCBA 4CDFB 2ARYA 2IBIA 1MS6A 1CVZA 2PBHA 3B79A 4N79A 2FQ9A 3CBKA 1PCIA 3QJ3A 5EF4A 2OZ2A 3C9EA 4BQVA 2G8EA 3OISA 2GHUA 3USVA 4XUIA 4PI3A 1GLOA 3DF0A 1NQCA 2AYOA 2HD5A 4YYUA 3IMAA 1PPOA 4X6HA 1ME3A 1PADA 1MEGA 2C0YA 5F02A 3ERVA 3P5WA 1KFXL 3KWBX 4N8WA 3QT4A 1KHPA 3QSDA 2DCBA 2G6DA 2R9MA 4N4ZA 3K24A 1AECA 2CIOA 4FJCA 2DZZA 3N3GA 2E00A 4B55A 1YALA 3D9WA 2NQAA 3CBJA 3WXEA 1O0EA 1TU6A 3MTNA 1Y08A 2YJ8A 4QRXA 1U9VA 3IV2A 1FH0A 5FPWA 1TL9A 3KX1A 4YYSA 1K3BB 3P5XA 2OP3A 2PREA 3OVZA 1AU4A 5J94A 1EWMA 3F5VA 4CDCB 1NB3A 1YVBA 4YYRA 4X6IA 2E01A 3K8UA 1A6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AYN A;  4YVA A;  1U9W A;  3KW9 A;  2DC9 A;  2P86 A;  3PDF A;  2XU5 A;  4XR7 A;  5CHT A;  3BPM A;  2H7J A;  5CHV A;  4HWY A;  3TNX A;  3BPF A;  2OUL A;  1NL6 A;  1KHQ A;  2O6X A;  1EWO A;  2F7D A;  2HH5 A;  5EGW A;  4YV8 A;  1PXV A;  1F2B A;  1STF E;  4I07 A;  3O0U A;  4MSX A;  4K7C A;  1AYU A;  1PPP A;  1Y4H A;  3RVV A;  3IOQ A;  2DC7 A;  2XU1 A;  4Q8G A;  2FRQ A;  2NQI A;  3H8B A;  4CZW A;  3D6S A;  3WXG A;  1VSN A;  1BY8 A;  2JQG R;  3MHH A;  1SP4 B;  3H6S A;  4P6E A;  2B1M A;  2GFO A;  1MIR A;  2XU4 A;  1F29 A;  4G54 A;  4PAD A;  2B1N A;  4YYW A;  1PPD A;  3E1Z B;  1CS8 A;  2BDL A;  5CVN B;  2AUZ A;  4W4U A;  3PNR A;  1MDW A;  3MHS A;  1AU3 A;  4CDE B;  7PCK A;  3S3R A;  2FTD A;  3HWN A;  1POP A;  2P7U A;  2R6N A;  1CJL A;  2CB5 A;  1U9X A;  2DCC A;  1ICF A;  1ME4 A;  3S3Q A;  3O1G A;  2VHS A;  3V6E A;  1IWD A;  1YT7 A;  2WBF X;  4MZO A;  4W5B A;  3IUT A;  4BS5 A;  1VJV A;  1U9Q X;  5CVM A;  3RVW A;  1PIP A;  1PE6 A;  2NQD B;  5CVO B;  3ZUA A;  1ATK A;  1KXR A;  1XKG A;  1MEM A;  3MOR A;  9PAP A;  2R9N A;  1EWP A;  1QOL A;  3BC3 A;  2DC6 A;  4PP2 E;  3IHP A;  1PBH A;  4FK5 A;  1GMY A;  4ZUX U;  2AVW A;  1GCB A;  2XU3 A;  3HHA A;  1Q6K A;  3P5V A;  4I05 A;  4DMX A;  4MZS A;  1U5I A;  5K16 A;  2G8J A;  1DEU A;  3RVX A;  1AU0 A;  4OEL A;  4PP1 A;  2AUX A;  3I3T A;  2BDZ A;  2E02 A;  1BQI A;  3F75 A;  4OEM A;  3I06 A;  4W5C A;  5JH3 A;  1HUC B;  1F2C A;  4CDD B;  3HD3 A;  1BP4 A;  3P5U A;  2IPP B;  4YYV A;  2FO5 A;  2NQG A;  2AS8 A;  4RY2 A;  3U8E A;  2Y6E A;  4BS6 A;  3V6C A;  3OF8 A;  3BOW A;  3OVX A;  2ACT A;  8PCH A;  1NPZ A;  3KKU A;  3KFQ A;  2FRA A;  4WA6 A;  2JQF R;  1JQP A;  3PW3 A;  3IEJ A;  1QXP A;  4I04 A;  2E03 A;  1AYV A;  1X9Y A;  2YJ2 A;  3BWK A;  6PAD A;  2PNS A;  1MHW A;  5A24 A;  1ZCM A;  4FIP A;  4BSQ A;  1M6D A;  3LXS A;  3LFY A;  4Q8H A;  2YJC A;  1THE A;  2HXZ A;  2VHF A;  1AU2 A;  1CQD A;  2Y5B A;  4AXL A;  1NLJ A;  1CB5 A;  1GEC E;  2R9C A;  2DC8 A;  2YJ9 A;  3BCN A;  3KSE A;  3OF9 A;  1BGO A;  1TLO A;  2DCD A;  3HHI A;  2PAD A;  2AIM A;  3KWZ A;  1QDQ A;  4QBB A;  3M99 A;  1CPJ A;  4YYQ A;  3CH2 X;  1SNK A;  2R9F A;  4DMY A;  3NHE A;  2FUD A;  3H8C A;  4QH6 A;  2DCA A;  2G7Y A;  1QMY A;  3CH3 X;  2FT2 A;  3WXF A;  3N3K A;  5PAD A;  1EWL A;  1F2A A;  1KFU L;  1ITO A;  1ZIV A;  2AU1 A;  1PPN A;  1CSB B;  3AI8 A;  4X6J A;  2HHN A;  1AYW A;  3N4C A;  2P0R A;  1EF7 A;  3K9M A;  4BPV A;  2YJB A;  1DF0 A;  2DJF B;  4KLB A;  2DZY A;  1AIM A;  1CTE A;  1NB5 A;  1CV8 A;  4P6G A;  3PBH A;  3H89 A;  1YK7 A;  4QRV A;  2DJG B;  4AXM A;  2ATO A;  1S4V A;  2FYE A;  1YK8 A;  3H7D A;  2R9O A;  2F1G A;  5JA7 A;  4QRG A;  3GCB A;  4CDF B;  2ARY A;  2IBI A;  1MS6 A;  1CVZ A;  2PBH A;  3B79 A;  4N79 A;  2FQ9 A;  3CBK A;  1PCI A;  3QJ3 A;  5EF4 A;  2OZ2 A;  3C9E A;  4BQV A;  2G8E A;  3OIS A;  2GHU A;  3USV A;  4XUI A;  4PI3 A;  1GLO A;  3DF0 A;  1NQC A;  2AYO A;  2HD5 A;  4YYU A;  3IMA A;  1PPO A;  4X6H A;  1ME3 A;  1PAD A;  1MEG A;  2C0Y A;  5F02 A;  3ERV A;  3P5W A;  1KFX L;  3KWB X;  4N8W A;  3QT4 A;  1KHP A;  3QSD A;  2DCB A;  2G6D A;  2R9M A;  4N4Z A;  3K24 A;  1AEC A;  2CIO A;  4FJC A;  2DZZ A;  3N3G A;  2E00 A;  1YAL A;  2NQA A;  3CBJ A;  3WXE A;  1O0E A;  1TU6 A;  3MTN A;  1Y08 A;  2YJ8 A;  4QRX A;  1U9V A;  3IV2 A;  1FH0 A;  5FPW A;  1TL9 A;  3KX1 A;  4YYS A;  1K3B B;  3P5X A;  2OP3 A;  2PRE A;  3OVZ A;  1AU4 A;  5J94 A;  1EWM A;  3F5V A;  4CDC B;  1NB3 A;  1YVB A;  4YYR A;  4X6I A;  2E01 A;  3K8U A;  1A6R A; 
#chains in the Genus database with same CATH topology
 2AYN A;  2BTW A;  3ZNH A;  4YVA A;  1U9W A;  4XZX A;  3RNV A;  3KW9 A;  4PT5 A;  2DC9 A;  2P86 A;  3PDF A;  3OQC A;  3BBA A;  2XU5 A;  4XR7 A;  5CHT A;  3BPM A;  2H7J A;  5CHV A;  4HWY A;  3TNX A;  2HWK A;  3BPF A;  2OUL A;  1NL6 A;  1KHQ A;  2O6X A;  1EWO A;  2F7D A;  2HH5 A;  3PRM A;  3MP2 A;  5EGW A;  4YV8 A;  1PXV A;  4MM3 B;  1F2B A;  1STF E;  4I07 A;  3O0U A;  4MSX A;  4OW0 A;  4K7C A;  1AYU A;  1PPP A;  3PRP A;  1Y4H A;  3MTV A;  2JTC A;  1UKF A;  3TMP A;  3RVV A;  3IOQ A;  2DC7 A;  2XU1 A;  4Q8G A;  2AGA A;  2FRQ A;  2NQI A;  3H8B A;  4ZTB A;  4CZW A;  3D6S A;  3WXG A;  1VSN A;  1BY8 A;  2JQG R;  3MHH A;  1SP4 B;  3H6S A;  4OVZ A;  2B1M A;  2GFO A;  4P6E A;  4IUM A;  1MIR A;  2XU4 A;  1F29 A;  4RNA A;  4G54 A;  4PAD A;  2B1N A;  4YYW A;  1PPD A;  3E1Z B;  1CS8 A;  2BDL A;  5CVN B;  2AUZ A;  4W4U A;  3PNR A;  1MDW A;  3PT2 A;  3MHS A;  1AU3 A;  4CDE B;  7PCK A;  3S3R A;  2FTD A;  3HWN A;  1POP A;  2P7U A;  2R6N A;  1CJL A;  2CB5 A;  1U9X A;  2DCC A;  1ICF A;  1ME4 A;  3S3Q A;  3O1G A;  2VHS A;  3V6E A;  1IWD A;  1YT7 A;  2WBF X;  4MZO A;  4W5B A;  3IUT A;  4BS5 A;  4REZ A;  1VJV A;  1U9Q X;  5CVM A;  3RVW A;  1PIP A;  1PE6 A;  2NQD B;  3PSE A;  5CVO B;  3ZUA A;  1ATK A;  1KXR A;  1XKG A;  3MOR A;  1MEM A;  1YZB A;  9PAP A;  2R9N A;  4D8B A;  1EWP A;  1QOL A;  3BC3 A;  2DC6 A;  4PP2 E;  3IHP A;  1PBH A;  4FK5 A;  1GMY A;  4D8E A;  4ZUX U;  2AVW A;  1GCB A;  2XU3 A;  3HHA A;  1Q6K A;  3P5V A;  4I05 A;  3E9S A;  4DMX A;  4IP3 A;  4MI7 A;  4MZS A;  1U5I A;  5K16 A;  2G8J A;  5KO3 A;  1DEU A;  3RVX A;  1AU0 A;  4OEL A;  4PP1 A;  2AUX A;  3I3T A;  2BDZ A;  2E02 A;  3W31 A;  1BQI A;  3F75 A;  4OEM A;  3I06 A;  4W5C A;  5JH3 A;  1HUC B;  1F2C A;  4CDD B;  3HD3 A;  1BP4 A;  3P5U A;  2IPP B;  4YYV A;  2FO5 A;  2NQG A;  2AS8 A;  2BTW B;  4RY2 A;  3U8E A;  2Y6E A;  4BOU A;  4BS6 A;  3V6C A;  3OF8 A;  3BOW A;  3OVX A;  2ACT A;  8PCH A;  1NPZ A;  3KKU A;  3KFQ A;  2FRA A;  4WA6 A;  2JQF R;  1JQP A;  3PW3 A;  3IEJ A;  1QXP A;  4I04 A;  2E03 A;  1AYV A;  1X9Y A;  2YJ2 A;  3BWK A;  6PAD A;  2PNS A;  5JZE A;  1MHW A;  5A24 A;  1ZCM A;  4FIP A;  4BSQ A;  1M6D A;  3BY4 A;  3LXS A;  2DOS A;  4BOQ A;  3LFY A;  4Q8H A;  2YJC A;  1THE A;  2HXZ A;  2VHF A;  1AU2 A;  1CQD A;  2Y5B A;  4AXL A;  1NLJ A;  1CB5 A;  1GEC E;  2R9C A;  2DC8 A;  2YJ9 A;  2BU3 A;  3BCN A;  3KSE A;  3OF9 A;  2J7Q C;  2UZJ A;  1BGO A;  1TLO A;  2DCD A;  3HHI A;  2PAD A;  2AIM A;  3KWZ A;  3W30 A;  1QDQ A;  4D8I A;  4QBB A;  3M99 A;  4RKX A;  1CPJ A;  4BOP A;  4OVZ B;  4YYQ A;  3CH2 X;  1SNK A;  2R9F A;  2J7Q A;  4DMY A;  3NHE A;  2FUD A;  3H8C A;  4QH6 A;  2DCA A;  2G7Y A;  1QMY A;  3CH3 X;  2FT2 A;  1DKI A;  4WUR A;  3WXF A;  3N3K A;  5PAD A;  1EWL A;  1F2A A;  1KFU L;  1ITO A;  1ZIV A;  2AU1 A;  1PPN A;  1CSB B;  4GUA A;  3AI8 A;  4X6J A;  2HHN A;  1AYW A;  3N4C A;  2P0R A;  1EF7 A;  3K9M A;  4BPV A;  2YJB A;  1DF0 A;  2DJF B;  4KLB A;  2DZY A;  1AIM A;  4HXD B;  1CTE A;  1NB5 A;  1CV8 A;  4P6G A;  3BB7 A;  3PBH A;  3H89 A;  1YK7 A;  4QRV A;  2DJG B;  5EZS A;  2FE8 A;  4AXM A;  2ATO A;  1S4V A;  4M0W A;  3IFU A;  2FYE A;  1YK8 A;  3PHW A;  3C0R A;  3H7D A;  4RF1 A;  2R9O A;  2F1G A;  5JA7 A;  4QRG A;  3GCB A;  3B21 A;  4P16 A;  4CDF B;  2ARY A;  2Z84 A;  2IBI A;  3PHU A;  1MS6 A;  1CVZ A;  2PBH A;  3B79 A;  4N79 A;  2FQ9 A;  3CBK A;  1PCI A;  3QJ3 A;  5EF4 A;  2OZ2 A;  3C9E A;  4BQV A;  2G8E A;  3OIS A;  4A5U A;  2GHU A;  1PVJ A;  3USV A;  4XUI A;  4PI3 A;  1GLO A;  3DF0 A;  1NQC A;  2AYO A;  4BOZ A;  2HD5 A;  4YYU A;  3IMA A;  1PPO A;  4X6H A;  1ME3 A;  1PAD A;  1MEG A;  2C0Y A;  3MJ5 A;  5F02 A;  3ERV A;  3P5W A;  1KFX L;  3KWB X;  4N8W A;  3QT4 A;  2JRI A;  1KHP A;  3QSD A;  2DCB A;  2G6D A;  2R9M A;  4N4Z A;  3K24 A;  1AEC A;  2CIO A;  4FJC A;  2DZZ A;  3N3G A;  2E00 A;  3PHX A;  3TRK A;  1YAL A;  2NQA A;  3CBJ A;  3WXE A;  1O0E A;  1TU6 A;  3MTN A;  1Y08 A;  2YJ8 A;  4QRX A;  4R3D A;  1U9V A;  5E6J A;  3IV2 A;  1FH0 A;  5FPW A;  1TL9 A;  3KX1 A;  4YYS A;  1K3B B;  4RF0 A;  3P5X A;  2OP3 A;  2PRE A;  3OVZ A;  1AU4 A;  5J94 A;  1EWM A;  3F5V A;  4CDC B;  1NB3 A;  3O65 A;  1YVB A;  4YYR A;  4BOS A;  4X6I A;  5EZQ A;  2E01 A;  3K8U A;  1A6R A; 
#chains in the Genus database with same CATH homology
 2AYN A;  4YVA A;  1U9W A;  3KW9 A;  2DC9 A;  2P86 A;  3PDF A;  2XU5 A;  4XR7 A;  5CHT A;  3BPM A;  2H7J A;  5CHV A;  4HWY A;  3TNX A;  3BPF A;  2OUL A;  1NL6 A;  1KHQ A;  4C5P A;  2VFC A;  2O6X A;  4NV8 A;  1EWO A;  2F7D A;  2HH5 A;  5EGW A;  4YV8 A;  1PXV A;  1F2B A;  1STF E;  4I07 A;  3O0U A;  4MSX A;  4K7C A;  1AYU A;  1PPP A;  1Y4H A;  3RVV A;  3IOQ A;  2DC7 A;  2XU1 A;  4Q8G A;  2FRQ A;  2NQI A;  3H8B A;  4CZW A;  3D6S A;  3WXG A;  1VSN A;  1BY8 A;  2JQG R;  3MHH A;  1SP4 B;  3H6S A;  2B1M A;  2GFO A;  4P6E A;  1MIR A;  2XU4 A;  1F29 A;  4G54 A;  4PAD A;  2B1N A;  4YYW A;  1PPD A;  3E1Z B;  1CS8 A;  2BDL A;  5CVN B;  1W5R A;  2AUZ A;  4W4U A;  3PNR A;  1MDW A;  3MHS A;  1AU3 A;  4CDE B;  7PCK A;  3S3R A;  2FTD A;  3HWN A;  1POP A;  2P7U A;  2R6N A;  1CJL A;  2CB5 A;  1U9X A;  2DCC A;  1ICF A;  1ME4 A;  3S3Q A;  3O1G A;  2VHS A;  3V6E A;  1IWD A;  1YT7 A;  2WBF X;  4MZO A;  4BGF A;  4W5B A;  3IUT A;  2BSZ A;  4BS5 A;  1VJV A;  4NV7 A;  1U9Q X;  5CVM A;  3RVW A;  1PIP A;  1PE6 A;  2NQD B;  5CVO B;  3ZUA A;  1ATK A;  1KXR A;  1XKG A;  1MEM A;  3MOR A;  9PAP A;  2R9N A;  1EWP A;  1QOL A;  3BC3 A;  2DC6 A;  4PP2 E;  3IHP A;  1PBH A;  4FK5 A;  1GMY A;  4ZUX U;  2AVW A;  1GCB A;  2XU3 A;  3HHA A;  2VFB A;  1Q6K A;  3P5V A;  1E2T A;  4I05 A;  4DMX A;  4MZS A;  1U5I A;  5K16 A;  2G8J A;  1DEU A;  3RVX A;  1AU0 A;  4OEL A;  4PP1 A;  2AUX A;  3I3T A;  2BDZ A;  2E02 A;  1W4T A;  1BQI A;  3F75 A;  4OEM A;  3I06 A;  4W5C A;  5JH3 A;  1HUC B;  1F2C A;  4CDD B;  3HD3 A;  1BP4 A;  3P5U A;  2IPP B;  4YYV A;  2FO5 A;  2NQG A;  2AS8 A;  4RY2 A;  3U8E A;  2Y6E A;  4BS6 A;  3V6C A;  3OF8 A;  3BOW A;  1GX3 A;  3OVX A;  2ACT A;  8PCH A;  1NPZ A;  3KKU A;  3KFQ A;  2FRA A;  4WA6 A;  2JQF R;  1JQP A;  3PW3 A;  3IEJ A;  1QXP A;  4I04 A;  2E03 A;  1AYV A;  1X9Y A;  2YJ2 A;  3BWK A;  6PAD A;  2PNS A;  1MHW A;  5A24 A;  1ZCM A;  4FIP A;  4BSQ A;  1M6D A;  3LXS A;  3LFY A;  4Q8H A;  2YJC A;  1THE A;  2HXZ A;  2VHF A;  3LTW A;  1AU2 A;  1CQD A;  2Y5B A;  1NLJ A;  1CB5 A;  4AXL A;  1GEC E;  2R9C A;  2DC8 A;  2YJ9 A;  3BCN A;  3KSE A;  4GUZ A;  3OF9 A;  1BGO A;  1TLO A;  2DCD A;  3HHI A;  2PAD A;  2AIM A;  3KWZ A;  1QDQ A;  4QBB A;  3M99 A;  1CPJ A;  4YYQ A;  3CH2 X;  1SNK A;  2R9F A;  4DMY A;  3NHE A;  2FUD A;  3H8C A;  4QH6 A;  2DCA A;  2G7Y A;  1QMY A;  3CH3 X;  2FT2 A;  3WXF A;  3N3K A;  5PAD A;  1EWL A;  1F2A A;  1KFU L;  1ITO A;  1ZIV A;  2AU1 A;  1PPN A;  1CSB B;  3AI8 A;  4X6J A;  2HHN A;  1AYW A;  3N4C A;  2P0R A;  1W6F A;  1EF7 A;  3K9M A;  4BPV A;  2YJB A;  1DF0 A;  2DJF B;  4KLB A;  2DZY A;  1AIM A;  1CTE A;  1NB5 A;  1CV8 A;  4P6G A;  3PBH A;  3H89 A;  1YK7 A;  4QRV A;  2DJG B;  4AXM A;  2ATO A;  1S4V A;  2FYE A;  1YK8 A;  3H7D A;  2R9O A;  2F1G A;  5JA7 A;  4QRG A;  3GCB A;  4CDF B;  2ARY A;  2IBI A;  1MS6 A;  1CVZ A;  2PBH A;  3B79 A;  4N79 A;  2FQ9 A;  3CBK A;  1PCI A;  3QJ3 A;  5EF4 A;  2OZ2 A;  3C9E A;  4BQV A;  2G8E A;  3OIS A;  2GHU A;  3USV A;  4XUI A;  4PI3 A;  1GLO A;  3DF0 A;  1NQC A;  2AYO A;  2HD5 A;  4YYU A;  3IMA A;  1PPO A;  4X6H A;  1ME3 A;  1PAD A;  1MEG A;  2C0Y A;  5F02 A;  3ERV A;  3P5W A;  1KFX L;  3KWB X;  4N8W A;  3QT4 A;  1KHP A;  3QSD A;  2DCB A;  2G6D A;  2R9M A;  4N4Z A;  3K24 A;  1AEC A;  2CIO A;  4FJC A;  2DZZ A;  3N3G A;  2E00 A;  4B55 A;  1YAL A;  3D9W A;  2NQA A;  3CBJ A;  3WXE A;  1O0E A;  1TU6 A;  3MTN A;  1Y08 A;  2YJ8 A;  4QRX A;  1U9V A;  3IV2 A;  1FH0 A;  5FPW A;  1TL9 A;  3KX1 A;  4YYS A;  1K3B B;  3P5X A;  2OP3 A;  2PRE A;  3OVZ A;  1AU4 A;  5J94 A;  1EWM A;  3F5V A;  4CDC B;  1NB3 A;  1YVB A;  4YYR A;  4X6I A;  2E01 A;  3K8U A;  1A6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...