1AYVA

Crystal structure of cysteine protease human cathepsin k in complex with a covalent thiazolhydrazide inhibitor
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of potent and selective human cathepsin K inhibitors that span the active site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords CATHEPSIN K
total genus 61
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 1997-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1ayvA00
1CV8A 2G7YA 1ZIVA 3BOWA 2PREA 1ME3A 2DCCA 1EWOA 1BP4A 1ICFA 3HWNA 4P6EA 5EF4A 3PW3A 3HHIA 4CDCB 3IOQA 3M99A 2AUXA 2E00A 1ATKA 3K9MA 3H89A 3K24A 3KX1A 5CVOB 2CB5A 4PI3A 3F75A 2O6XA 2HD5A 1AU3A 3KKUA 2YJ2A 3V6EA 3KSEA 1QOLA 1KFUL 2YJBA 1NB5A 4I07A 4XUIA 1ME4A 1PXVA 1Y4HA 2IPPB 1GLOA 3LFYA 3I3TA 2G6DA 1X9YA 4X6JA 1CQDA 5A24A 3ERVA 2F7DA 2FRAA 4MZSA 2P86A 2YJ8A 4KLBA 4X6IA 1Q6KA 2C0YA 1DF0A 3IHPA 1TLOA 4BS5A 4X6HA 3CH3X 3IMAA 2E02A 2BDLA 4Q8GA 2DJFB 3N4CA 4QRXA 2B1NA 1KHQA 3KWZA 3MHHA 1AU4A 4BS6A 7PCKA 4PP2E 2OZ2A 3H6SA 3MHSA 2DC9A 2R9CA 2DC6A 3H8BA 1NPZA 1TL9A 1YALA 3RVVA 1EF7A 3N3GA 2XU1A 3WXGA 2FRQA 3OISA 5K16A 3PDFA 1KHPA 1PIPA 3I06A 2Y6EA 3BPFA 3OF9A 4W5BA 5EGWA 3ZUAA 1Y08A 5PADA 2VHFA 4MSXA 3WXFA 3MORA 1A6RA 3P5WA 2FUDA 2PNSA 1XKGA 4K7CA 4BPVA 4YYQA 4FJCA 2FTDA 4BQVA 4N4ZA 2OULA 1FH0A 1F2BA 1MEMA 4CZWA 2XU4A 3KWBX 1QXPA 5CVMA 3QSDA 2FT2A 3IV2A 4DMXA 5FPWA 1AECA 1CTEA 3DF0A 2R9OA 2DCDA 4YYSA 1S4VA 1F29A 5JH3A 2OP3A 2HH5A 3AI8A 3LXSA 1STFE 3E1ZB 3MTNA 4QH6A 2PBHA 4N8WA 1GECE 3N3KA 1F2CA 2AS8A 1VSNA 1O0EA 1SP4B 4YVAA 4QRGA 2AVWA 1K3BB 1IWDA 4DMYA 3QT4A 3OF8A 1F2AA 3P5VA 2XU5A 2JQFR 1JQPA 2DJGB 4YYUA 6PADA 3CBJA 2E01A 4OEMA 3C9EA 4BSQA 2P0RA 2H7JA 4AXLA 3F5VA 2AUZA 2FO5A 1YK7A 3H8CA 3HD3A 3QJ3A 1HUCB 1EWMA 3RVXA 3BCNA 1EWLA 1QMYA 4YV8A 4G54A 2HXZA 2FYEA 1MDWA 4RY2A 2ARYA 1PPNA 1VJVA 1M6DA 1GMYA 2IBIA 1NLJA 1NB3A 2AIMA 1CSBB 1PPOA 1THEA 3IUTA 2ACTA 4Q8HA 1EWPA 1U9VA 3CH2X 1NQCA 4QBBA 4HWYA 1CJLA 2YJCA 3S3RA 3S3QA 2DCBA 5F02A 1GCBA 4P6GA 3KW9A 4PADA 1PCIA 3CBKA 1KXRA 3PBHA 4QRVA 1CS8A 4PP1A 2R6NA 3OVZA 1PPPA 2WBFX 3P5XA 3RVWA 3V6CA 3PNRA 1AIMA 4FK5A 5CHTA 3NHEA 2E03A 2JQGR 1PPDA 2XU3A 2BDZA 2Y5BA 1SNKA 1BY8A 1AU0A 2G8EA 2AYOA 2DC8A 2NQIA 4XR7A 3B79A 2R9FA 1YT7A 4WA6A 1TU6A 3BPMA 4MZOA 5J94A 1U5IA 3KFQA 1CB5A 2AU1A 1BGOA 2AYNA 4YYVA 3U8EA 4YYRA 1POPA 3USVA 1CPJA 1ZCMA 1QDQA 3TNXA 4W5CA 4FIPA 1PBHA 4CDFB 1PADA 9PAPA 2NQAA 2DC7A 2DCAA 4AXMA 3P5UA 2ATOA 3HHAA 4N79A 1DEUA 2F1GA 2DZZA 3GCBA 3OVXA 1KFXL 2R9NA 2R9MA 3WXEA 4YYWA 5JA7A 1CVZA 4CDDB 3D6SA 1ITOA 1AYWA 3O1GA 3BWKA 2PADA 4ZUXU 4I05A 1U9XA 8PCHA 1AYUA 3H7DA 2NQGA 3O0UA 4CDEB 5CHVA 2GFOA 2B1MA 1YK8A 2G8JA 2GHUA 5CVNB 2DZYA 2YJ9A 2VHSA 4OELA 1MIRA 1YVBA 3K8UA 1U9WA 2FQ9A 2P7UA 3BC3A 4W4UA 2HHNA 1MS6A 1BQIA 1U9QX 3IEJA 1NL6A 1PE6A 4I04A 2CIOA 1MHWA 1MEGA 2NQDB 1AU2A 1AYVA
chains in the Genus database with same CATH superfamily
5JZEA 1CV8A 2G7YA 1ZIVA 3BOWA 2PREA 1ME3A 2DCCA 3TRKA 1EWOA 4M0WA 1BP4A 3E9SA 1ICFA 3HWNA 4P6EA 3PHUA 5EF4A 3PW3A 3HHIA 4CDCB 3C0RA 3IOQA 3M99A 2AUXA 2E00A 4BOZA 1ATKA 3K9MA 3H89A 2UZJA 3K24A 3KX1A 5CVOB 2CB5A 4PI3A 3F75A 2HWKA 2O6XA 2HD5A 4OVZA 3OQCA 1AU3A 3KKUA 2YJ2A 3V6EA 3KSEA 1QOLA 1KFUL 2YJBA 1NB5A 4D8IA 4I07A 4XUIA 1ME4A 1PXVA 1Y4HA 2IPPB 1GLOA 3LFYA 3I3TA 2G6DA 1X9YA 4X6JA 1CQDA 5A24A 3ERVA 2F7DA 2FRAA 4MZSA 2P86A 3ZNHA 2YJ8A 4IP3A 4KLBA 4X6IA 1Q6KA 2C0YA 4RF0A 1DF0A 3IHPA 1TLOA 4BS5A 4X6HA 3CH3X 3PT2A 3IMAA 2E02A 2BDLA 4Q8GA 2DJFB 3N4CA 4QRXA 2B1NA 1KHQA 3KWZA 3MHHA 1AU4A 3PRMA 4RNAA 1YZBA 4BS6A 2J7QA 7PCKA 4PP2E 2OZ2A 3H6SA 3MHSA 3PSEA 2DC9A 2R9CA 2DC6A 3H8BA 1NPZA 1TL9A 1YALA 3B21A 3RVVA 3BY4A 1EF7A 3N3GA 2XU1A 3WXGA 2FRQA 3OISA 5K16A 3PDFA 1KHPA 1DKIA 1PIPA 4ZTBA 3I06A 2Y6EA 4HXDB 3BPFA 3OF9A 4W5BA 3MJ5A 2BTWA 5EGWA 3ZUAA 4BOQA 4P16A 2DOSA 1Y08A 5PADA 2VHFA 4MSXA 2AGAA 3WXFA 3MORA 4OW0A 1A6RA 3P5WA 2FUDA 2PNSA 4A5UA 1XKGA 4K7CA 4BPVA 4MI7A 4YYQA 4FJCA 2FTDA 4BQVA 4N4ZA 2OULA 1FH0A 1F2BA 1MEMA 4CZWA 3W30A 2XU4A 3KWBX 3BB7A 1QXPA 5CVMA 3QSDA 2FT2A 3IV2A 4DMXA 2BTWB 5FPWA 1AECA 1CTEA 3DF0A 2R9OA 2DCDA 2BU3A 4YYSA 1S4VA 1F29A 4REZA 5JH3A 2OP3A 2HH5A 3AI8A 3LXSA 1STFE 3E1ZB 3MTNA 4QH6A 2PBHA 4RKXA 4N8WA 1GECE 3N3KA 1F2CA 2AS8A 1VSNA 1O0EA 1SP4B 4YVAA 4QRGA 2AVWA 1K3BB 1IWDA 3O65A 3BBAA 4DMYA 4D8EA 3QT4A 3OF8A 1F2AA 4MM3B 3P5VA 2XU5A 2JQFR 1JQPA 2DJGB 4YYUA 6PADA 3CBJA 2E01A 4OEMA 3C9EA 4BSQA 4R3DA 2P0RA 2H7JA 4AXLA 3F5VA 2AUZA 3MTVA 2FO5A 1YK7A 3H8CA 3HD3A 3QJ3A 4PT5A 1HUCB 1EWMA 2J7QC 3RVXA 4RF1A 1PVJA 3BCNA 1EWLA 4BOUA 1QMYA 4YV8A 4G54A 2HXZA 2FYEA 1MDWA 4RY2A 2ARYA 1PPNA 1VJVA 1M6DA 1GMYA 3PHXA 2IBIA 1NLJA 4XZXA 1NB3A 2AIMA 1CSBB 1PPOA 1THEA 3IUTA 2ACTA 4Q8HA 1EWPA 1U9VA 3CH2X 1NQCA 4QBBA 4HWYA 1CJLA 2YJCA 3S3RA 3S3QA 2DCBA 5F02A 1GCBA 3IFUA 4P6GA 3KW9A 4PADA 1PCIA 3CBKA 1KXRA 4OVZB 3PBHA 4QRVA 5EZSA 5KO3A 1CS8A 3RNVA 4PP1A 2R6NA 3OVZA 1PPPA 2WBFX 3P5XA 3RVWA 3V6CA 3PNRA 1AIMA 4FK5A 5CHTA 3NHEA 2E03A 2JQGR 4WURA 3TMPA 1PPDA 2XU3A 2BDZA 2Y5BA 1SNKA 1BY8A 1AU0A 2G8EA 2AYOA 2DC8A 2NQIA 1UKFA 4GUAA 4XR7A 3B79A 2R9FA 1YT7A 4WA6A 1TU6A 3BPMA 4MZOA 5J94A 1U5IA 3KFQA 4BOSA 1CB5A 2AU1A 1BGOA 2AYNA 3W31A 4YYVA 3U8EA 4YYRA 1POPA 3USVA 1CPJA 1ZCMA 1QDQA 3TNXA 4W5CA 4FIPA 1PBHA 5E6JA 4CDFB 1PADA 9PAPA 2NQAA 2DC7A 2DCAA 4AXMA 4BOPA 3P5UA 2ATOA 3HHAA 4N79A 1DEUA 2F1GA 2DZZA 2JRIA 3GCBA 3OVXA 4IUMA 1KFXL 4D8BA 2R9NA 2R9MA 3WXEA 4YYWA 5JA7A 1CVZA 4CDDB 3D6SA 1ITOA 2Z84A 2FE8A 1AYWA 3O1GA 3BWKA 2PADA 4ZUXU 3MP2A 4I05A 1U9XA 5EZQA 8PCHA 1AYUA 3H7DA 3PHWA 2NQGA 3O0UA 4CDEB 5CHVA 2GFOA 2B1MA 1YK8A 2G8JA 2GHUA 5CVNB 2DZYA 2YJ9A 2VHSA 4OELA 1MIRA 1YVBA 3K8UA 1U9WA 2FQ9A 2P7UA 3BC3A 4W4UA 2HHNA 1MS6A 1BQIA 3PRPA 1U9QX 3IEJA 1NL6A 1PE6A 4I04A 2CIOA 2JTCA 1MHWA 1MEGA 2NQDB 1AU2A 1AYVA
chains in the Genus database with same CATH topology
1CV8A 2G7YA 1ZIVA 3BOWA 2PREA 1ME3A 2DCCA 1EWOA 1BP4A 1ICFA 3HWNA 4P6EA 5EF4A 3PW3A 3HHIA 4CDCB 4C5PA 3IOQA 3M99A 2AUXA 2E00A 1ATKA 3K9MA 3H89A 3K24A 3KX1A 5CVOB 2CB5A 4PI3A 3F75A 2O6XA 2HD5A 1AU3A 3KKUA 2YJ2A 3V6EA 3KSEA 1QOLA 1KFUL 2YJBA 1NB5A 2VFCA 4GUZA 4I07A 4XUIA 1ME4A 1PXVA 1Y4HA 2IPPB 1GLOA 3LFYA 3I3TA 2G6DA 1X9YA 4X6JA 1CQDA 5A24A 3ERVA 2F7DA 2FRAA 4MZSA 2P86A 2YJ8A 4KLBA 4X6IA 1Q6KA 2C0YA 1DF0A 3IHPA 1TLOA 4BS5A 4X6HA 3CH3X 3IMAA 2E02A 2BDLA 4Q8GA 2DJFB 3N4CA 4QRXA 2B1NA 1KHQA 3KWZA 3MHHA 1AU4A 4BS6A 7PCKA 4PP2E 2OZ2A 3H6SA 3MHSA 2DC9A 2R9CA 2DC6A 3H8BA 1NPZA 1TL9A 1YALA 3RVVA 1EF7A 3N3GA 2XU1A 3WXGA 2FRQA 3OISA 5K16A 3PDFA 1E2TA 1KHPA 1PIPA 3I06A 2Y6EA 3BPFA 3OF9A 4W5BA 5EGWA 3ZUAA 1Y08A 5PADA 2VHFA 4MSXA 3WXFA 3MORA 3P5WA 1A6RA 2FUDA 2PNSA 1W4TA 1XKGA 4K7CA 4BPVA 4YYQA 4FJCA 2FTDA 4BQVA 4N4ZA 2OULA 1FH0A 1F2BA 1MEMA 4CZWA 2XU4A 3KWBX 1QXPA 5CVMA 3QSDA 2FT2A 3IV2A 3LTWA 4DMXA 5FPWA 1AECA 1CTEA 3DF0A 2R9OA 2DCDA 4YYSA 1S4VA 1F29A 5JH3A 2OP3A 2HH5A 3AI8A 3LXSA 1STFE 3E1ZB 3MTNA 1GX3A 4QH6A 2PBHA 4N8WA 1GECE 3N3KA 1F2CA 2AS8A 1VSNA 1O0EA 1SP4B 4YVAA 4QRGA 2AVWA 1K3BB 1IWDA 4DMYA 3QT4A 3OF8A 1F2AA 3P5VA 2XU5A 2JQFR 1JQPA 2DJGB 4YYUA 6PADA 3CBJA 2E01A 4OEMA 3C9EA 4BSQA 2P0RA 2H7JA 4AXLA 3F5VA 2AUZA 2FO5A 1YK7A 3H8CA 3HD3A 3QJ3A 1HUCB 1EWMA 3RVXA 3BCNA 1EWLA 1QMYA 4YV8A 4G54A 2HXZA 2FYEA 1MDWA 4RY2A 2ARYA 1PPNA 1W5RA 1VJVA 1M6DA 1GMYA 2IBIA 1NLJA 1NB3A 2AIMA 1CSBB 1PPOA 1THEA 3IUTA 2ACTA 4Q8HA 1EWPA 1U9VA 3CH2X 1NQCA 4QBBA 4HWYA 1CJLA 2YJCA 3S3RA 3S3QA 2DCBA 5F02A 1GCBA 4P6GA 3KW9A 4PADA 1PCIA 3CBKA 1KXRA 3PBHA 4QRVA 1CS8A 4PP1A 2R6NA 3OVZA 1PPPA 2WBFX 3P5XA 3RVWA 3V6CA 3PNRA 1AIMA 4FK5A 5CHTA 3NHEA 2E03A 2JQGR 1PPDA 2XU3A 2BSZA 4NV7A 2BDZA 2Y5BA 1SNKA 1BY8A 1AU0A 2G8EA 2AYOA 2DC8A 2NQIA 4B55A 4XR7A 3B79A 2R9FA 1YT7A 4WA6A 1TU6A 3BPMA 4MZOA 5J94A 1U5IA 3KFQA 1CB5A 2AU1A 1BGOA 2AYNA 4YYVA 3U8EA 4YYRA 1POPA 3USVA 1CPJA 1ZCMA 1QDQA 3TNXA 4W5CA 4FIPA 1PBHA 4CDFB 1PADA 9PAPA 2NQAA 2DC7A 3D9WA 2DCAA 4AXMA 3P5UA 2ATOA 3HHAA 4N79A 1DEUA 2F1GA 2DZZA 3GCBA 3OVXA 1KFXL 2R9NA 2R9MA 4NV8A 3WXEA 4YYWA 5JA7A 1CVZA 4CDDB 3D6SA 1ITOA 2VFBA 4BGFA 1AYWA 3O1GA 3BWKA 2PADA 4ZUXU 1W6FA 4I05A 1U9XA 8PCHA 1AYUA 3H7DA 2NQGA 3O0UA 4CDEB 5CHVA 2GFOA 2B1MA 1YK8A 2G8JA 2GHUA 5CVNB 2DZYA 2YJ9A 2VHSA 4OELA 1MIRA 1YVBA 3K8UA 1U9WA 2FQ9A 2P7UA 3BC3A 4W4UA 2HHNA 1MS6A 1BQIA 1U9QX 3IEJA 1NL6A 1PE6A 4I04A 2CIOA 1MHWA 1MEGA 2NQDB 1AU2A 1AYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CV8 A;  2G7Y A;  1ZIV A;  3BOW A;  2PRE A;  1ME3 A;  2DCC A;  1EWO A;  1BP4 A;  1ICF A;  3HWN A;  4P6E A;  5EF4 A;  3PW3 A;  3HHI A;  4CDC B;  3IOQ A;  3M99 A;  2AUX A;  2E00 A;  1ATK A;  3K9M A;  3H89 A;  3K24 A;  3KX1 A;  5CVO B;  2CB5 A;  4PI3 A;  3F75 A;  2O6X A;  2HD5 A;  1AU3 A;  3KKU A;  2YJ2 A;  3V6E A;  3KSE A;  1QOL A;  1KFU L;  2YJB A;  1NB5 A;  4I07 A;  4XUI A;  1ME4 A;  1PXV A;  1Y4H A;  2IPP B;  1GLO A;  3LFY A;  3I3T A;  2G6D A;  1X9Y A;  4X6J A;  1CQD A;  5A24 A;  3ERV A;  2F7D A;  2FRA A;  4MZS A;  2P86 A;  2YJ8 A;  4KLB A;  4X6I A;  1Q6K A;  2C0Y A;  1DF0 A;  3IHP A;  1TLO A;  4BS5 A;  4X6H A;  3CH3 X;  3IMA A;  2E02 A;  2BDL A;  4Q8G A;  2DJF B;  3N4C A;  4QRX A;  2B1N A;  1KHQ A;  3KWZ A;  3MHH A;  1AU4 A;  4BS6 A;  7PCK A;  4PP2 E;  2OZ2 A;  3H6S A;  3MHS A;  2DC9 A;  2R9C A;  2DC6 A;  3H8B A;  1NPZ A;  1TL9 A;  1YAL A;  3RVV A;  1EF7 A;  3N3G A;  2XU1 A;  3WXG A;  2FRQ A;  3OIS A;  5K16 A;  3PDF A;  1KHP A;  1PIP A;  3I06 A;  2Y6E A;  3BPF A;  3OF9 A;  4W5B A;  5EGW A;  3ZUA A;  1Y08 A;  5PAD A;  2VHF A;  4MSX A;  3WXF A;  3MOR A;  1A6R A;  3P5W A;  2FUD A;  2PNS A;  1XKG A;  4K7C A;  4BPV A;  4YYQ A;  4FJC A;  2FTD A;  4BQV A;  4N4Z A;  2OUL A;  1FH0 A;  1F2B A;  1MEM A;  4CZW A;  2XU4 A;  3KWB X;  1QXP A;  5CVM A;  3QSD A;  2FT2 A;  3IV2 A;  4DMX A;  5FPW A;  1AEC A;  1CTE A;  3DF0 A;  2R9O A;  2DCD A;  4YYS A;  1S4V A;  1F29 A;  5JH3 A;  2OP3 A;  2HH5 A;  3AI8 A;  3LXS A;  1STF E;  3E1Z B;  3MTN A;  4QH6 A;  2PBH A;  4N8W A;  1GEC E;  3N3K A;  1F2C A;  2AS8 A;  1VSN A;  1O0E A;  1SP4 B;  4YVA A;  4QRG A;  2AVW A;  1K3B B;  1IWD A;  4DMY A;  3QT4 A;  3OF8 A;  1F2A A;  3P5V A;  2XU5 A;  2JQF R;  1JQP A;  2DJG B;  4YYU A;  6PAD A;  3CBJ A;  2E01 A;  4OEM A;  3C9E A;  4BSQ A;  2P0R A;  2H7J A;  4AXL A;  3F5V A;  2AUZ A;  2FO5 A;  1YK7 A;  3H8C A;  3HD3 A;  3QJ3 A;  1HUC B;  1EWM A;  3RVX A;  3BCN A;  1EWL A;  1QMY A;  4YV8 A;  4G54 A;  2HXZ A;  2FYE A;  1MDW A;  4RY2 A;  2ARY A;  1PPN A;  1VJV A;  1M6D A;  1GMY A;  2IBI A;  1NLJ A;  1NB3 A;  2AIM A;  1CSB B;  1PPO A;  1THE A;  3IUT A;  2ACT A;  4Q8H A;  1EWP A;  1U9V A;  3CH2 X;  1NQC A;  4QBB A;  4HWY A;  1CJL A;  2YJC A;  3S3R A;  3S3Q A;  2DCB A;  5F02 A;  1GCB A;  4P6G A;  3KW9 A;  4PAD A;  1PCI A;  3CBK A;  1KXR A;  3PBH A;  4QRV A;  1CS8 A;  4PP1 A;  2R6N A;  3OVZ A;  1PPP A;  2WBF X;  3P5X A;  3RVW A;  3V6C A;  3PNR A;  1AIM A;  4FK5 A;  5CHT A;  3NHE A;  2E03 A;  2JQG R;  1PPD A;  2XU3 A;  2BDZ A;  2Y5B A;  1SNK A;  1BY8 A;  1AU0 A;  2G8E A;  2AYO A;  2DC8 A;  2NQI A;  4XR7 A;  3B79 A;  2R9F A;  1YT7 A;  4WA6 A;  1TU6 A;  3BPM A;  4MZO A;  5J94 A;  1U5I A;  3KFQ A;  1CB5 A;  2AU1 A;  1BGO A;  2AYN A;  4YYV A;  3U8E A;  4YYR A;  1POP A;  3USV A;  1CPJ A;  1ZCM A;  1QDQ A;  3TNX A;  4W5C A;  4FIP A;  1PBH A;  4CDF B;  1PAD A;  9PAP A;  2NQA A;  2DC7 A;  2DCA A;  4AXM A;  3P5U A;  2ATO A;  3HHA A;  4N79 A;  1DEU A;  2F1G A;  2DZZ A;  3GCB A;  3OVX A;  1KFX L;  2R9N A;  2R9M A;  3WXE A;  4YYW A;  5JA7 A;  1CVZ A;  4CDD B;  3D6S A;  1ITO A;  1AYW A;  3O1G A;  3BWK A;  2PAD A;  4ZUX U;  4I05 A;  1U9X A;  8PCH A;  1AYU A;  3H7D A;  2NQG A;  3O0U A;  4CDE B;  5CHV A;  2GFO A;  2B1M A;  1YK8 A;  2G8J A;  2GHU A;  5CVN B;  2DZY A;  2YJ9 A;  2VHS A;  4OEL A;  1MIR A;  1YVB A;  3K8U A;  1U9W A;  2FQ9 A;  2P7U A;  3BC3 A;  4W4U A;  2HHN A;  1MS6 A;  1BQI A;  1U9Q X;  3IEJ A;  1NL6 A;  1PE6 A;  4I04 A;  2CIO A;  1MHW A;  1MEG A;  2NQD B;  1AU2 A;  1AYV A; 
#chains in the Genus database with same CATH topology
 5JZE A;  1CV8 A;  2G7Y A;  1ZIV A;  3BOW A;  2PRE A;  1ME3 A;  2DCC A;  3TRK A;  1EWO A;  4M0W A;  1BP4 A;  3E9S A;  1ICF A;  3HWN A;  4P6E A;  3PHU A;  5EF4 A;  3PW3 A;  3HHI A;  4CDC B;  3C0R A;  3IOQ A;  3M99 A;  2AUX A;  2E00 A;  4BOZ A;  1ATK A;  3K9M A;  3H89 A;  2UZJ A;  3K24 A;  3KX1 A;  5CVO B;  2CB5 A;  4PI3 A;  3F75 A;  2HWK A;  2O6X A;  2HD5 A;  4OVZ A;  3OQC A;  1AU3 A;  3KKU A;  2YJ2 A;  3V6E A;  3KSE A;  1QOL A;  1KFU L;  2YJB A;  1NB5 A;  4D8I A;  4I07 A;  4XUI A;  1ME4 A;  1PXV A;  1Y4H A;  2IPP B;  1GLO A;  3LFY A;  3I3T A;  2G6D A;  1X9Y A;  4X6J A;  1CQD A;  5A24 A;  3ERV A;  2F7D A;  2FRA A;  4MZS A;  2P86 A;  3ZNH A;  2YJ8 A;  4IP3 A;  4KLB A;  4X6I A;  1Q6K A;  2C0Y A;  4RF0 A;  1DF0 A;  3IHP A;  1TLO A;  4BS5 A;  4X6H A;  3CH3 X;  3PT2 A;  3IMA A;  2E02 A;  2BDL A;  4Q8G A;  2DJF B;  3N4C A;  4QRX A;  2B1N A;  1KHQ A;  3KWZ A;  3MHH A;  1AU4 A;  3PRM A;  4RNA A;  1YZB A;  4BS6 A;  2J7Q A;  7PCK A;  4PP2 E;  2OZ2 A;  3H6S A;  3MHS A;  3PSE A;  2DC9 A;  2R9C A;  2DC6 A;  3H8B A;  1NPZ A;  1TL9 A;  1YAL A;  3B21 A;  3RVV A;  3BY4 A;  1EF7 A;  3N3G A;  2XU1 A;  3WXG A;  2FRQ A;  3OIS A;  5K16 A;  3PDF A;  1KHP A;  1DKI A;  1PIP A;  4ZTB A;  3I06 A;  2Y6E A;  4HXD B;  3BPF A;  3OF9 A;  4W5B A;  3MJ5 A;  2BTW A;  5EGW A;  3ZUA A;  4BOQ A;  4P16 A;  2DOS A;  1Y08 A;  5PAD A;  2VHF A;  4MSX A;  2AGA A;  3WXF A;  3MOR A;  4OW0 A;  1A6R A;  3P5W A;  2FUD A;  2PNS A;  4A5U A;  1XKG A;  4K7C A;  4BPV A;  4MI7 A;  4YYQ A;  4FJC A;  2FTD A;  4BQV A;  4N4Z A;  2OUL A;  1FH0 A;  1F2B A;  1MEM A;  4CZW A;  3W30 A;  2XU4 A;  3KWB X;  3BB7 A;  1QXP A;  5CVM A;  3QSD A;  2FT2 A;  3IV2 A;  4DMX A;  2BTW B;  5FPW A;  1AEC A;  1CTE A;  3DF0 A;  2R9O A;  2DCD A;  2BU3 A;  4YYS A;  1S4V A;  1F29 A;  4REZ A;  5JH3 A;  2OP3 A;  2HH5 A;  3AI8 A;  3LXS A;  1STF E;  3E1Z B;  3MTN A;  4QH6 A;  2PBH A;  4RKX A;  4N8W A;  1GEC E;  3N3K A;  1F2C A;  2AS8 A;  1VSN A;  1O0E A;  1SP4 B;  4YVA A;  4QRG A;  2AVW A;  1K3B B;  1IWD A;  3O65 A;  3BBA A;  4DMY A;  4D8E A;  3QT4 A;  3OF8 A;  1F2A A;  4MM3 B;  3P5V A;  2XU5 A;  2JQF R;  1JQP A;  2DJG B;  4YYU A;  6PAD A;  3CBJ A;  2E01 A;  4OEM A;  3C9E A;  4BSQ A;  4R3D A;  2P0R A;  2H7J A;  4AXL A;  3F5V A;  2AUZ A;  3MTV A;  2FO5 A;  1YK7 A;  3H8C A;  3HD3 A;  3QJ3 A;  4PT5 A;  1HUC B;  1EWM A;  2J7Q C;  3RVX A;  4RF1 A;  1PVJ A;  3BCN A;  1EWL A;  4BOU A;  1QMY A;  4YV8 A;  4G54 A;  2HXZ A;  2FYE A;  1MDW A;  4RY2 A;  2ARY A;  1PPN A;  1VJV A;  1M6D A;  1GMY A;  3PHX A;  2IBI A;  1NLJ A;  4XZX A;  1NB3 A;  2AIM A;  1CSB B;  1PPO A;  1THE A;  3IUT A;  2ACT A;  4Q8H A;  1EWP A;  1U9V A;  3CH2 X;  1NQC A;  4QBB A;  4HWY A;  1CJL A;  2YJC A;  3S3R A;  3S3Q A;  2DCB A;  5F02 A;  1GCB A;  3IFU A;  4P6G A;  3KW9 A;  4PAD A;  1PCI A;  3CBK A;  1KXR A;  4OVZ B;  3PBH A;  4QRV A;  5EZS A;  5KO3 A;  1CS8 A;  3RNV A;  4PP1 A;  2R6N A;  3OVZ A;  1PPP A;  2WBF X;  3P5X A;  3RVW A;  3V6C A;  3PNR A;  1AIM A;  4FK5 A;  5CHT A;  3NHE A;  2E03 A;  2JQG R;  4WUR A;  3TMP A;  1PPD A;  2XU3 A;  2BDZ A;  2Y5B A;  1SNK A;  1BY8 A;  1AU0 A;  2G8E A;  2AYO A;  2DC8 A;  2NQI A;  1UKF A;  4GUA A;  4XR7 A;  3B79 A;  2R9F A;  1YT7 A;  4WA6 A;  1TU6 A;  3BPM A;  4MZO A;  5J94 A;  1U5I A;  3KFQ A;  4BOS A;  1CB5 A;  2AU1 A;  1BGO A;  2AYN A;  3W31 A;  4YYV A;  3U8E A;  4YYR A;  1POP A;  3USV A;  1CPJ A;  1ZCM A;  1QDQ A;  3TNX A;  4W5C A;  4FIP A;  1PBH A;  5E6J A;  4CDF B;  1PAD A;  9PAP A;  2NQA A;  2DC7 A;  2DCA A;  4AXM A;  4BOP A;  3P5U A;  2ATO A;  3HHA A;  4N79 A;  1DEU A;  2F1G A;  2DZZ A;  2JRI A;  3GCB A;  3OVX A;  4IUM A;  1KFX L;  4D8B A;  2R9N A;  2R9M A;  3WXE A;  4YYW A;  5JA7 A;  1CVZ A;  4CDD B;  3D6S A;  1ITO A;  2Z84 A;  2FE8 A;  1AYW A;  3O1G A;  3BWK A;  2PAD A;  4ZUX U;  3MP2 A;  4I05 A;  1U9X A;  5EZQ A;  8PCH A;  1AYU A;  3H7D A;  3PHW A;  2NQG A;  3O0U A;  4CDE B;  5CHV A;  2GFO A;  2B1M A;  1YK8 A;  2G8J A;  2GHU A;  5CVN B;  2DZY A;  2YJ9 A;  2VHS A;  4OEL A;  1MIR A;  1YVB A;  3K8U A;  1U9W A;  2FQ9 A;  2P7U A;  3BC3 A;  4W4U A;  2HHN A;  1MS6 A;  1BQI A;  3PRP A;  1U9Q X;  3IEJ A;  1NL6 A;  1PE6 A;  4I04 A;  2CIO A;  2JTC A;  1MHW A;  1MEG A;  2NQD B;  1AU2 A;  1AYV A; 
#chains in the Genus database with same CATH homology
 1CV8 A;  2G7Y A;  1ZIV A;  3BOW A;  2PRE A;  1ME3 A;  2DCC A;  1EWO A;  1BP4 A;  1ICF A;  3HWN A;  4P6E A;  5EF4 A;  3PW3 A;  3HHI A;  4CDC B;  4C5P A;  3IOQ A;  3M99 A;  2AUX A;  2E00 A;  1ATK A;  3K9M A;  3H89 A;  3K24 A;  3KX1 A;  5CVO B;  2CB5 A;  4PI3 A;  3F75 A;  2O6X A;  2HD5 A;  1AU3 A;  3KKU A;  2YJ2 A;  3V6E A;  3KSE A;  1QOL A;  1KFU L;  2YJB A;  1NB5 A;  2VFC A;  4GUZ A;  4I07 A;  4XUI A;  1ME4 A;  1PXV A;  1Y4H A;  2IPP B;  1GLO A;  3LFY A;  3I3T A;  2G6D A;  1X9Y A;  4X6J A;  1CQD A;  5A24 A;  3ERV A;  2F7D A;  2FRA A;  4MZS A;  2P86 A;  2YJ8 A;  4KLB A;  4X6I A;  1Q6K A;  2C0Y A;  1DF0 A;  3IHP A;  1TLO A;  4BS5 A;  4X6H A;  3CH3 X;  3IMA A;  2E02 A;  2BDL A;  4Q8G A;  2DJF B;  3N4C A;  4QRX A;  2B1N A;  1KHQ A;  3KWZ A;  3MHH A;  1AU4 A;  4BS6 A;  7PCK A;  4PP2 E;  2OZ2 A;  3H6S A;  3MHS A;  2DC9 A;  2R9C A;  2DC6 A;  3H8B A;  1NPZ A;  1TL9 A;  1YAL A;  3RVV A;  1EF7 A;  3N3G A;  2XU1 A;  3WXG A;  2FRQ A;  3OIS A;  5K16 A;  3PDF A;  1E2T A;  1KHP A;  1PIP A;  3I06 A;  2Y6E A;  3BPF A;  3OF9 A;  4W5B A;  5EGW A;  3ZUA A;  1Y08 A;  5PAD A;  2VHF A;  4MSX A;  3WXF A;  3MOR A;  3P5W A;  1A6R A;  2FUD A;  2PNS A;  1W4T A;  1XKG A;  4K7C A;  4BPV A;  4YYQ A;  4FJC A;  2FTD A;  4BQV A;  4N4Z A;  2OUL A;  1FH0 A;  1F2B A;  1MEM A;  4CZW A;  2XU4 A;  3KWB X;  1QXP A;  5CVM A;  3QSD A;  2FT2 A;  3IV2 A;  3LTW A;  4DMX A;  5FPW A;  1AEC A;  1CTE A;  3DF0 A;  2R9O A;  2DCD A;  4YYS A;  1S4V A;  1F29 A;  5JH3 A;  2OP3 A;  2HH5 A;  3AI8 A;  3LXS A;  1STF E;  3E1Z B;  3MTN A;  1GX3 A;  4QH6 A;  2PBH A;  4N8W A;  1GEC E;  3N3K A;  1F2C A;  2AS8 A;  1VSN A;  1O0E A;  1SP4 B;  4YVA A;  4QRG A;  2AVW A;  1K3B B;  1IWD A;  4DMY A;  3QT4 A;  3OF8 A;  1F2A A;  3P5V A;  2XU5 A;  2JQF R;  1JQP A;  2DJG B;  4YYU A;  6PAD A;  3CBJ A;  2E01 A;  4OEM A;  3C9E A;  4BSQ A;  2P0R A;  2H7J A;  4AXL A;  3F5V A;  2AUZ A;  2FO5 A;  1YK7 A;  3H8C A;  3HD3 A;  3QJ3 A;  1HUC B;  1EWM A;  3RVX A;  3BCN A;  1EWL A;  1QMY A;  4YV8 A;  4G54 A;  2HXZ A;  2FYE A;  1MDW A;  4RY2 A;  2ARY A;  1PPN A;  1W5R A;  1VJV A;  1M6D A;  1GMY A;  2IBI A;  1NLJ A;  1NB3 A;  2AIM A;  1CSB B;  1PPO A;  1THE A;  3IUT A;  2ACT A;  4Q8H A;  1EWP A;  1U9V A;  3CH2 X;  1NQC A;  4QBB A;  4HWY A;  1CJL A;  2YJC A;  3S3R A;  3S3Q A;  2DCB A;  5F02 A;  1GCB A;  4P6G A;  3KW9 A;  4PAD A;  1PCI A;  3CBK A;  1KXR A;  3PBH A;  4QRV A;  1CS8 A;  4PP1 A;  2R6N A;  3OVZ A;  1PPP A;  2WBF X;  3P5X A;  3RVW A;  3V6C A;  3PNR A;  1AIM A;  4FK5 A;  5CHT A;  3NHE A;  2E03 A;  2JQG R;  1PPD A;  2XU3 A;  2BSZ A;  4NV7 A;  2BDZ A;  2Y5B A;  1SNK A;  1BY8 A;  1AU0 A;  2G8E A;  2AYO A;  2DC8 A;  2NQI A;  4B55 A;  4XR7 A;  3B79 A;  2R9F A;  1YT7 A;  4WA6 A;  1TU6 A;  3BPM A;  4MZO A;  5J94 A;  1U5I A;  3KFQ A;  1CB5 A;  2AU1 A;  1BGO A;  2AYN A;  4YYV A;  3U8E A;  4YYR A;  1POP A;  3USV A;  1CPJ A;  1ZCM A;  1QDQ A;  3TNX A;  4W5C A;  4FIP A;  1PBH A;  4CDF B;  1PAD A;  9PAP A;  2NQA A;  2DC7 A;  3D9W A;  2DCA A;  4AXM A;  3P5U A;  2ATO A;  3HHA A;  4N79 A;  1DEU A;  2F1G A;  2DZZ A;  3GCB A;  3OVX A;  1KFX L;  2R9N A;  2R9M A;  4NV8 A;  3WXE A;  4YYW A;  5JA7 A;  1CVZ A;  4CDD B;  3D6S A;  1ITO A;  2VFB A;  4BGF A;  1AYW A;  3O1G A;  3BWK A;  2PAD A;  4ZUX U;  1W6F A;  4I05 A;  1U9X A;  8PCH A;  1AYU A;  3H7D A;  2NQG A;  3O0U A;  4CDE B;  5CHV A;  2GFO A;  2B1M A;  1YK8 A;  2G8J A;  2GHU A;  5CVN B;  2DZY A;  2YJ9 A;  2VHS A;  4OEL A;  1MIR A;  1YVB A;  3K8U A;  1U9W A;  2FQ9 A;  2P7U A;  3BC3 A;  4W4U A;  2HHN A;  1MS6 A;  1BQI A;  1U9Q X;  3IEJ A;  1NL6 A;  1PE6 A;  4I04 A;  2CIO A;  1MHW A;  1MEG A;  2NQD B;  1AU2 A;  1AYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...