1AYVA

Crystal structure of cysteine protease human cathepsin k in complex with a covalent thiazolhydrazide inhibitor
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of potent and selective human cathepsin K inhibitors that span the active site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords CATHEPSIN K
total genus 61
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 1997-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1ayvA00
1CQDA 1XKGA 2DCBA 2DZYA 3KWZA 1SNKA 2CB5A 4YYRA 1U9XA 3OISA 3HWNA 4PP1A 2YJ9A 2F7DA 2FQ9A 1YVBA 4YYVA 1YK7A 2FT2A 3QT4A 3KKUA 1AU0A 1ME4A 9PAPA 2YJCA 1ZCMA 4BQVA 2E02A 3HD3A 3MHSA 4CDDB 2G7YA 3USVA 2IPPB 4PADA 1AU3A 1YT7A 2HXZA 4OELA 3TNXA 1NB3A 3H89A 1KHQA 3OVXA 2HD5A 2B1MA 5JA7A 2CIOA 4KLBA 3IUTA 2DCCA 1PBHA 2C0YA 4MSXA 4ZUXU 1MEMA 3CBKA 1PCIA 5CVMA 4BS5A 3IHPA 4P6EA 7PCKA 1NQCA 1YK8A 1IWDA 5EGWA 1AYVA 1EWPA 5EF4A 4K7CA 2ACTA 3I3TA 4BS6A 4N79A 2IBIA 2F1GA 1NLJA 2DCAA 2AYNA 4OEMA 2P86A 4Q8GA 2NQAA 3BOWA 1CS8A 1U9QX 3IEJA 3OVZA 1QMYA 1A6RA 2DC6A 1PPDA 2Y5BA 4N8WA 4YYUA 2Y6EA 1HUCB 3BPFA 3MHHA 2DCDA 1BGOA 1FH0A 3IMAA 2PNSA 3GCBA 1TLOA 1AU2A 1CSBB 2R9NA 3O1GA 1BY8A 2NQGA 1CTEA 3D6SA 2E01A 2XU5A 2O6XA 4W4UA 1ME3A 2BDZA 2FO5A 3OF9A 2OULA 1BP4A 2PBHA 3S3RA 3P5XA 3I06A 1BQIA 3NHEA 1EF7A 4YVAA 3O0UA 2B1NA 1PPPA 4P6GA 3DF0A 3KFQA 1NPZA 3HHAA 4AXLA 3KWBX 1YALA 2AUXA 3N4CA 2ATOA 4QRVA 4WA6A 2HHNA 3LXSA 3BC3A 4I05A 2G8JA 1CVZA 1PIPA 2XU1A 3LFYA 1U9VA 3QSDA 2E03A 4I04A 1EWMA 1GCBA 4XUIA 3H8BA 4QH6A 4YV8A 2DC9A 1PPNA 4MZOA 3ERVA 1MDWA 2XU3A 3RVXA 1K3BB 3AI8A 3U8EA 5F02A 2P0RA 3WXEA 4CDCB 3N3GA 3RVWA 2PREA 4X6IA 1ATKA 1MS6A 1ZIVA 5PADA 4W5CA 2OP3A 1PPOA 2R9MA 2YJ2A 3ZUAA 1PXVA 1F29A 2VHFA 4Q8HA 2R9FA 1Y08A 3F75A 1TL9A 1EWLA 4CDEB 4QRXA 4HWYA 1KFXL 3CH2X 3RVVA 1TU6A 2R6NA 1KXRA 4RY2A 3MORA 1F2CA 4CZWA 3P5UA 1CB5A 3N3KA 3E1ZB 4QBBA 3S3QA 2JQFR 2AIMA 2DC8A 1F2AA 1CPJA 3IOQA 1MHWA 1SP4B 4BSQA 1U5IA 2DC7A 4YYWA 3OF8A 4CDFB 1AU4A 1GMYA 2G6DA 1VJVA 3K9MA 1PE6A 1CV8A 2DJFB 2FYEA 3WXGA 3H6SA 4I07A 2HH5A 5J94A 1QOLA 4X6HA 2E00A 3K8UA 6PADA 3V6EA 3KW9A 1JQPA 4FJCA 1EWOA 1U9WA 5CHVA 3PDFA 2OZ2A 2FTDA 2AUZA 2JQGR 1M6DA 1QXPA 1NB5A 8PCHA 2GFOA 1KFUL 1AIMA 1GLOA 1Y4HA 2VHSA 5K16A 3H7DA 2YJBA 1ITOA 1STFE 3QJ3A 2NQDB 1VSNA 1S4VA 3PW3A 3M99A 1DEUA 3F5VA 2AVWA 2GHUA 3WXFA 2DJGB 3BWKA 1F2BA 2DZZA 1GECE 2AS8A 3C9EA 3HHIA 3B79A 4DMYA 3MTNA 4AXMA 1NL6A 4W5BA 2XU4A 4FIPA 3BPMA 1O0EA 4DMXA 1THEA 2P7UA 3H8CA 1AYWA 4G54A 3PNRA 2FRQA 4N4ZA 4FK5A 1QDQA 1PADA 5FPWA 1AYUA 3PBHA 1MEGA 4YYQA 2FUDA 2AYOA 2NQIA 4PI3A 2H7JA 4X6JA 3P5VA 1DF0A 2AU1A 3K24A 5A24A 3P5WA 1AECA 2PADA 4XR7A 1X9YA 2R9OA 5CHTA 2YJ8A 1POPA 4QRGA 4PP2E 1KHPA 3KSEA 2FRAA 1MIRA 1Q6KA 2ARYA 1ICFA 3CH3X 3BCNA 1CJLA 2R9CA 5CVNB 3V6CA 3IV2A 3KX1A 3CBJA 4BPVA 5JH3A 2WBFX 5CVOB 4YYSA 2BDLA 2G8EA 4MZSA
chains in the Genus database with same CATH superfamily
1CQDA 1XKGA 2DCBA 3PT2A 2DZYA 5EZQA 3KWZA 1SNKA 2CB5A 4BOUA 4YYRA 1U9XA 3OISA 3HWNA 4PP1A 2YJ9A 2F7DA 2FQ9A 4MM3B 3OQCA 1YVBA 2BU3A 4YYVA 1YK7A 2FT2A 3QT4A 3KKUA 1AU0A 1ME4A 9PAPA 2JRIA 2YJCA 1ZCMA 3BY4A 4BQVA 2E02A 3HD3A 3MHSA 4CDDB 2G7YA 3USVA 2IPPB 4PADA 1AU3A 1YT7A 2HXZA 4OELA 3TNXA 3W30A 2BTWB 1NB3A 3H89A 4RKXA 1KHQA 3OVXA 2HD5A 2B1MA 5JA7A 2CIOA 4KLBA 3IUTA 2DCCA 1PBHA 2C0YA 1DKIA 4MSXA 4ZUXU 1MEMA 3CBKA 1PCIA 5CVMA 3O65A 4BS5A 3IHPA 4P6EA 7PCKA 1NQCA 1YK8A 1IWDA 1UKFA 5EGWA 1AYVA 1EWPA 1YZBA 5EF4A 4K7CA 2ACTA 3I3TA 4BS6A 4N79A 2IBIA 4BOZA 2F1GA 1NLJA 3MJ5A 2DCAA 2AYNA 4OEMA 2P86A 4Q8GA 2NQAA 3BOWA 2JTCA 2Z84A 1CS8A 1U9QX 3IEJA 3OVZA 1QMYA 1A6RA 2DC6A 1PPDA 1PVJA 2Y5BA 4N8WA 4YYUA 2Y6EA 1HUCB 3BPFA 3MHHA 2DCDA 1BGOA 1FH0A 3IMAA 5E6JA 2PNSA 4XZXA 3GCBA 3PRPA 3C0RA 1TLOA 1AU2A 1CSBB 2R9NA 3O1GA 1BY8A 3BB7A 2NQGA 1CTEA 3D6SA 4D8BA 2E01A 2XU5A 2O6XA 4W4UA 1ME3A 4ZTBA 2BDZA 2FO5A 3OF9A 2OULA 1BP4A 2PBHA 4R3DA 3S3RA 3P5XA 3I06A 1BQIA 3NHEA 1EF7A 4YVAA 2UZJA 3O0UA 2B1NA 1PPPA 4P6GA 3DF0A 3KFQA 1NPZA 3HHAA 4AXLA 3KWBX 1YALA 2AUXA 4HXDB 3N4CA 2ATOA 4A5UA 4QRVA 4WA6A 2HHNA 3LXSA 3BC3A 3ZNHA 4I05A 2G8JA 1CVZA 1PIPA 2XU1A 3LFYA 1U9VA 3QSDA 2E03A 4I04A 1EWMA 4P16A 3TMPA 1GCBA 4XUIA 3H8BA 4QH6A 4YV8A 2DC9A 1PPNA 4MZOA 3W31A 3ERVA 1MDWA 2XU3A 3RVXA 1K3BB 4IUMA 3AI8A 3U8EA 5F02A 2P0RA 3WXEA 4CDCB 4D8IA 3N3GA 3RVWA 2PREA 4X6IA 1ATKA 1MS6A 1ZIVA 5PADA 4D8EA 4W5CA 4OW0A 4WURA 2OP3A 1PPOA 4RF0A 2R9MA 2YJ2A 3ZUAA 1PXVA 1F29A 2VHFA 4Q8HA 2DOSA 2R9FA 1Y08A 3F75A 1TL9A 5KO3A 1EWLA 4CDEB 4QRXA 4HWYA 1KFXL 3CH2X 3RVVA 2FE8A 1TU6A 2R6NA 1KXRA 4RY2A 3MORA 1F2CA 3PHXA 4CZWA 3P5UA 1CB5A 4RNAA 3N3KA 3E1ZB 4QBBA 3S3QA 2JQFR 3PRMA 2AIMA 2DC8A 1F2AA 1CPJA 3IOQA 1MHWA 3MP2A 1SP4B 4BSQA 1U5IA 2DC7A 4OVZA 4YYWA 3OF8A 4CDFB 1AU4A 1GMYA 3B21A 4BOSA 2G6DA 1VJVA 3K9MA 1PE6A 1CV8A 2DJFB 2FYEA 3WXGA 5EZSA 3H6SA 4I07A 2HH5A 5J94A 1QOLA 4X6HA 2E00A 3K8UA 6PADA 3V6EA 4PT5A 3KW9A 1JQPA 4FJCA 1EWOA 1U9WA 5CHVA 3PDFA 2OZ2A 2FTDA 2AUZA 2JQGR 1M6DA 1QXPA 1NB5A 8PCHA 2BTWA 3PHUA 2GFOA 1KFUL 1AIMA 1GLOA 1Y4HA 2VHSA 3H7DA 5K16A 2YJBA 1ITOA 1STFE 2J7QC 3QJ3A 2NQDB 4BOPA 1VSNA 1S4VA 3PW3A 3M99A 1DEUA 3F5VA 2AVWA 2GHUA 4BOQA 3WXFA 2DJGB 3BWKA 1F2BA 2DZZA 1GECE 2AS8A 3C9EA 3HHIA 3B79A 3BBAA 4DMYA 3MTNA 4AXMA 1NL6A 4W5BA 2XU4A 4FIPA 3BPMA 1O0EA 4DMXA 3E9SA 1THEA 2P7UA 3TRKA 3H8CA 1AYWA 4M0WA 4G54A 4GUAA 4MI7A 3PNRA 4OVZB 2FRQA 2J7QA 4N4ZA 4FK5A 1QDQA 1PADA 5FPWA 1AYUA 3PBHA 1MEGA 4YYQA 2FUDA 2AYOA 2NQIA 4IP3A 4PI3A 2H7JA 4X6JA 3IFUA 5JZEA 3P5VA 1DF0A 2AU1A 3K24A 5A24A 3P5WA 1AECA 2PADA 4XR7A 1X9YA 2AGAA 2R9OA 5CHTA 2YJ8A 1POPA 4QRGA 4PP2E 1KHPA 4RF1A 3KSEA 2FRAA 1MIRA 1Q6KA 3PSEA 2HWKA 2ARYA 3MTVA 1ICFA 3CH3X 3BCNA 1CJLA 4REZA 2R9CA 5CVNB 3V6CA 3RNVA 3IV2A 3KX1A 3CBJA 4BPVA 5JH3A 2WBFX 5CVOB 4YYSA 2BDLA 2G8EA 3PHWA 4MZSA
chains in the Genus database with same CATH topology
1CQDA 1XKGA 2DCBA 2DZYA 3KWZA 1GX3A 1SNKA 2CB5A 4YYRA 1U9XA 3OISA 3HWNA 4PP1A 2YJ9A 4B55A 2F7DA 4NV8A 2FQ9A 1YVBA 4YYVA 1YK7A 2FT2A 4C5PA 3QT4A 3KKUA 1AU0A 1ME4A 9PAPA 2YJCA 1ZCMA 4BQVA 2E02A 3HD3A 3MHSA 4CDDB 1W6FA 2G7YA 3USVA 2IPPB 4PADA 1AU3A 1YT7A 2HXZA 4OELA 3TNXA 1NB3A 3H89A 1KHQA 3OVXA 2HD5A 2B1MA 5JA7A 2CIOA 4KLBA 3IUTA 2DCCA 1PBHA 2C0YA 4MSXA 4ZUXU 1MEMA 3CBKA 1PCIA 5CVMA 4BS5A 3IHPA 4P6EA 7PCKA 1NQCA 1YK8A 1IWDA 5EGWA 1AYVA 1EWPA 5EF4A 4K7CA 2ACTA 3I3TA 4BS6A 4N79A 2IBIA 2F1GA 1NLJA 2DCAA 2AYNA 4OEMA 2P86A 4Q8GA 2NQAA 3BOWA 1CS8A 1U9QX 3IEJA 3OVZA 1QMYA 1A6RA 2DC6A 1PPDA 2Y5BA 4N8WA 4YYUA 2Y6EA 1HUCB 3BPFA 3MHHA 2DCDA 1BGOA 1FH0A 3IMAA 2PNSA 3GCBA 1TLOA 3LTWA 1AU2A 1CSBB 2R9NA 3O1GA 1BY8A 2NQGA 1CTEA 3D6SA 2E01A 2XU5A 2O6XA 4W4UA 1ME3A 2BDZA 2FO5A 3OF9A 2OULA 1BP4A 2PBHA 3S3RA 3P5XA 3I06A 1BQIA 3NHEA 1EF7A 4YVAA 3O0UA 2B1NA 1PPPA 4P6GA 3DF0A 4BGFA 3KFQA 1NPZA 3HHAA 4AXLA 3KWBX 1YALA 2AUXA 3N4CA 2ATOA 4QRVA 4WA6A 2HHNA 3LXSA 3BC3A 4I05A 2G8JA 1CVZA 1PIPA 2XU1A 3LFYA 1U9VA 3QSDA 2E03A 4I04A 1EWMA 1GCBA 4XUIA 3H8BA 4QH6A 4YV8A 2DC9A 1PPNA 4MZOA 3ERVA 1MDWA 2XU3A 3RVXA 1K3BB 3AI8A 3U8EA 5F02A 2P0RA 3WXEA 4CDCB 3N3GA 3RVWA 2PREA 4X6IA 1ATKA 1MS6A 1ZIVA 5PADA 4W5CA 2OP3A 1PPOA 2R9MA 2YJ2A 3ZUAA 1PXVA 1F29A 2VHFA 4Q8HA 2R9FA 1Y08A 3F75A 1TL9A 1EWLA 4CDEB 4QRXA 4HWYA 1KFXL 3CH2X 3RVVA 1TU6A 2R6NA 1KXRA 4RY2A 3MORA 1W5RA 1F2CA 4CZWA 3P5UA 1CB5A 3N3KA 3E1ZB 4QBBA 3S3QA 2JQFR 2AIMA 2DC8A 1F2AA 1CPJA 3IOQA 1MHWA 1SP4B 4BSQA 1U5IA 2DC7A 3D9WA 4YYWA 3OF8A 4CDFB 1AU4A 1GMYA 2G6DA 1VJVA 3K9MA 1PE6A 1CV8A 2DJFB 2FYEA 3WXGA 3H6SA 4I07A 2HH5A 5J94A 1QOLA 4X6HA 2E00A 3K8UA 6PADA 3V6EA 2VFCA 3KW9A 1JQPA 4FJCA 1EWOA 1U9WA 5CHVA 3PDFA 2OZ2A 2FTDA 2BSZA 2AUZA 2JQGR 1M6DA 1QXPA 1NB5A 8PCHA 2GFOA 1KFUL 1AIMA 1GLOA 1Y4HA 2VHSA 3H7DA 5K16A 2YJBA 1ITOA 1STFE 3QJ3A 2NQDB 4GUZA 1VSNA 1S4VA 3PW3A 3M99A 1DEUA 3F5VA 2AVWA 2GHUA 3WXFA 2DJGB 3BWKA 1F2BA 2DZZA 1GECE 2AS8A 3C9EA 3HHIA 3B79A 4DMYA 3MTNA 4AXMA 1NL6A 4W5BA 2XU4A 4FIPA 3BPMA 1O0EA 4DMXA 1THEA 2P7UA 3H8CA 1AYWA 4G54A 3PNRA 2FRQA 4N4ZA 4FK5A 1QDQA 1PADA 5FPWA 1AYUA 3PBHA 4NV7A 1MEGA 4YYQA 2FUDA 2AYOA 2NQIA 4PI3A 2H7JA 4X6JA 3P5VA 1W4TA 1DF0A 2AU1A 3K24A 5A24A 3P5WA 1AECA 2VFBA 2PADA 4XR7A 1X9YA 2R9OA 5CHTA 2YJ8A 1POPA 4QRGA 4PP2E 1KHPA 3KSEA 2FRAA 1MIRA 1Q6KA 1E2TA 2ARYA 1ICFA 3CH3X 3BCNA 1CJLA 2R9CA 5CVNB 3V6CA 3IV2A 3KX1A 3CBJA 4BPVA 5JH3A 2WBFX 5CVOB 4YYSA 2BDLA 2G8EA 4MZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CQD A;  1XKG A;  2DCB A;  2DZY A;  3KWZ A;  1SNK A;  2CB5 A;  4YYR A;  1U9X A;  3OIS A;  3HWN A;  4PP1 A;  2YJ9 A;  2F7D A;  2FQ9 A;  1YVB A;  4YYV A;  1YK7 A;  2FT2 A;  3QT4 A;  3KKU A;  1AU0 A;  1ME4 A;  9PAP A;  2YJC A;  1ZCM A;  4BQV A;  2E02 A;  3HD3 A;  3MHS A;  4CDD B;  2G7Y A;  3USV A;  2IPP B;  4PAD A;  1AU3 A;  1YT7 A;  2HXZ A;  4OEL A;  3TNX A;  1NB3 A;  3H89 A;  1KHQ A;  3OVX A;  2HD5 A;  2B1M A;  5JA7 A;  2CIO A;  4KLB A;  3IUT A;  2DCC A;  1PBH A;  2C0Y A;  4MSX A;  4ZUX U;  1MEM A;  3CBK A;  1PCI A;  5CVM A;  4BS5 A;  3IHP A;  4P6E A;  7PCK A;  1NQC A;  1YK8 A;  1IWD A;  5EGW A;  1AYV A;  1EWP A;  5EF4 A;  4K7C A;  2ACT A;  3I3T A;  4BS6 A;  4N79 A;  2IBI A;  2F1G A;  1NLJ A;  2DCA A;  2AYN A;  4OEM A;  2P86 A;  4Q8G A;  2NQA A;  3BOW A;  1CS8 A;  1U9Q X;  3IEJ A;  3OVZ A;  1QMY A;  1A6R A;  2DC6 A;  1PPD A;  2Y5B A;  4N8W A;  4YYU A;  2Y6E A;  1HUC B;  3BPF A;  3MHH A;  2DCD A;  1BGO A;  1FH0 A;  3IMA A;  2PNS A;  3GCB A;  1TLO A;  1AU2 A;  1CSB B;  2R9N A;  3O1G A;  1BY8 A;  2NQG A;  1CTE A;  3D6S A;  2E01 A;  2XU5 A;  2O6X A;  4W4U A;  1ME3 A;  2BDZ A;  2FO5 A;  3OF9 A;  2OUL A;  1BP4 A;  2PBH A;  3S3R A;  3P5X A;  3I06 A;  1BQI A;  3NHE A;  1EF7 A;  4YVA A;  3O0U A;  2B1N A;  1PPP A;  4P6G A;  3DF0 A;  3KFQ A;  1NPZ A;  3HHA A;  4AXL A;  3KWB X;  1YAL A;  2AUX A;  3N4C A;  2ATO A;  4QRV A;  4WA6 A;  2HHN A;  3LXS A;  3BC3 A;  4I05 A;  2G8J A;  1CVZ A;  1PIP A;  2XU1 A;  3LFY A;  1U9V A;  3QSD A;  2E03 A;  4I04 A;  1EWM A;  1GCB A;  4XUI A;  3H8B A;  4QH6 A;  4YV8 A;  2DC9 A;  1PPN A;  4MZO A;  3ERV A;  1MDW A;  2XU3 A;  3RVX A;  1K3B B;  3AI8 A;  3U8E A;  5F02 A;  2P0R A;  3WXE A;  4CDC B;  3N3G A;  3RVW A;  2PRE A;  4X6I A;  1ATK A;  1MS6 A;  1ZIV A;  5PAD A;  4W5C A;  2OP3 A;  1PPO A;  2R9M A;  2YJ2 A;  3ZUA A;  1PXV A;  1F29 A;  2VHF A;  4Q8H A;  2R9F A;  1Y08 A;  3F75 A;  1TL9 A;  1EWL A;  4CDE B;  4QRX A;  4HWY A;  1KFX L;  3CH2 X;  3RVV A;  1TU6 A;  2R6N A;  1KXR A;  4RY2 A;  3MOR A;  1F2C A;  4CZW A;  3P5U A;  1CB5 A;  3N3K A;  3E1Z B;  4QBB A;  3S3Q A;  2JQF R;  2AIM A;  2DC8 A;  1F2A A;  1CPJ A;  3IOQ A;  1MHW A;  1SP4 B;  4BSQ A;  1U5I A;  2DC7 A;  4YYW A;  3OF8 A;  4CDF B;  1AU4 A;  1GMY A;  2G6D A;  1VJV A;  3K9M A;  1PE6 A;  1CV8 A;  2DJF B;  2FYE A;  3WXG A;  3H6S A;  4I07 A;  2HH5 A;  5J94 A;  1QOL A;  4X6H A;  2E00 A;  3K8U A;  6PAD A;  3V6E A;  3KW9 A;  1JQP A;  4FJC A;  1EWO A;  1U9W A;  5CHV A;  3PDF A;  2OZ2 A;  2FTD A;  2AUZ A;  2JQG R;  1M6D A;  1QXP A;  1NB5 A;  8PCH A;  2GFO A;  1KFU L;  1AIM A;  1GLO A;  1Y4H A;  2VHS A;  5K16 A;  3H7D A;  2YJB A;  1ITO A;  1STF E;  3QJ3 A;  2NQD B;  1VSN A;  1S4V A;  3PW3 A;  3M99 A;  1DEU A;  3F5V A;  2AVW A;  2GHU A;  3WXF A;  2DJG B;  3BWK A;  1F2B A;  2DZZ A;  1GEC E;  2AS8 A;  3C9E A;  3HHI A;  3B79 A;  4DMY A;  3MTN A;  4AXM A;  1NL6 A;  4W5B A;  2XU4 A;  4FIP A;  3BPM A;  1O0E A;  4DMX A;  1THE A;  2P7U A;  3H8C A;  1AYW A;  4G54 A;  3PNR A;  2FRQ A;  4N4Z A;  4FK5 A;  1QDQ A;  1PAD A;  5FPW A;  1AYU A;  3PBH A;  1MEG A;  4YYQ A;  2FUD A;  2AYO A;  2NQI A;  4PI3 A;  2H7J A;  4X6J A;  3P5V A;  1DF0 A;  2AU1 A;  3K24 A;  5A24 A;  3P5W A;  1AEC A;  2PAD A;  4XR7 A;  1X9Y A;  2R9O A;  5CHT A;  2YJ8 A;  1POP A;  4QRG A;  4PP2 E;  1KHP A;  3KSE A;  2FRA A;  1MIR A;  1Q6K A;  2ARY A;  1ICF A;  3CH3 X;  3BCN A;  1CJL A;  2R9C A;  5CVN B;  3V6C A;  3IV2 A;  3KX1 A;  3CBJ A;  4BPV A;  5JH3 A;  2WBF X;  5CVO B;  4YYS A;  2BDL A;  2G8E A;  4MZS A; 
#chains in the Genus database with same CATH topology
 1CQD A;  1XKG A;  2DCB A;  3PT2 A;  2DZY A;  5EZQ A;  3KWZ A;  1SNK A;  2CB5 A;  4BOU A;  4YYR A;  1U9X A;  3OIS A;  3HWN A;  4PP1 A;  2YJ9 A;  2F7D A;  2FQ9 A;  4MM3 B;  3OQC A;  1YVB A;  2BU3 A;  4YYV A;  1YK7 A;  2FT2 A;  3QT4 A;  3KKU A;  1AU0 A;  1ME4 A;  9PAP A;  2JRI A;  2YJC A;  1ZCM A;  3BY4 A;  4BQV A;  2E02 A;  3HD3 A;  3MHS A;  4CDD B;  2G7Y A;  3USV A;  2IPP B;  4PAD A;  1AU3 A;  1YT7 A;  2HXZ A;  4OEL A;  3TNX A;  3W30 A;  2BTW B;  1NB3 A;  3H89 A;  4RKX A;  1KHQ A;  3OVX A;  2HD5 A;  2B1M A;  5JA7 A;  2CIO A;  4KLB A;  3IUT A;  2DCC A;  1PBH A;  2C0Y A;  1DKI A;  4MSX A;  4ZUX U;  1MEM A;  3CBK A;  1PCI A;  5CVM A;  3O65 A;  4BS5 A;  3IHP A;  4P6E A;  7PCK A;  1NQC A;  1YK8 A;  1IWD A;  1UKF A;  5EGW A;  1AYV A;  1EWP A;  1YZB A;  5EF4 A;  4K7C A;  2ACT A;  3I3T A;  4BS6 A;  4N79 A;  2IBI A;  4BOZ A;  2F1G A;  1NLJ A;  3MJ5 A;  2DCA A;  2AYN A;  4OEM A;  2P86 A;  4Q8G A;  2NQA A;  3BOW A;  2JTC A;  2Z84 A;  1CS8 A;  1U9Q X;  3IEJ A;  3OVZ A;  1QMY A;  1A6R A;  2DC6 A;  1PPD A;  1PVJ A;  2Y5B A;  4N8W A;  4YYU A;  2Y6E A;  1HUC B;  3BPF A;  3MHH A;  2DCD A;  1BGO A;  1FH0 A;  3IMA A;  5E6J A;  2PNS A;  4XZX A;  3GCB A;  3PRP A;  3C0R A;  1TLO A;  1AU2 A;  1CSB B;  2R9N A;  3O1G A;  1BY8 A;  3BB7 A;  2NQG A;  1CTE A;  3D6S A;  4D8B A;  2E01 A;  2XU5 A;  2O6X A;  4W4U A;  1ME3 A;  4ZTB A;  2BDZ A;  2FO5 A;  3OF9 A;  2OUL A;  1BP4 A;  2PBH A;  4R3D A;  3S3R A;  3P5X A;  3I06 A;  1BQI A;  3NHE A;  1EF7 A;  4YVA A;  2UZJ A;  3O0U A;  2B1N A;  1PPP A;  4P6G A;  3DF0 A;  3KFQ A;  1NPZ A;  3HHA A;  4AXL A;  3KWB X;  1YAL A;  2AUX A;  4HXD B;  3N4C A;  2ATO A;  4A5U A;  4QRV A;  4WA6 A;  2HHN A;  3LXS A;  3BC3 A;  3ZNH A;  4I05 A;  2G8J A;  1CVZ A;  1PIP A;  2XU1 A;  3LFY A;  1U9V A;  3QSD A;  2E03 A;  4I04 A;  1EWM A;  4P16 A;  3TMP A;  1GCB A;  4XUI A;  3H8B A;  4QH6 A;  4YV8 A;  2DC9 A;  1PPN A;  4MZO A;  3W31 A;  3ERV A;  1MDW A;  2XU3 A;  3RVX A;  1K3B B;  4IUM A;  3AI8 A;  3U8E A;  5F02 A;  2P0R A;  3WXE A;  4CDC B;  4D8I A;  3N3G A;  3RVW A;  2PRE A;  4X6I A;  1ATK A;  1MS6 A;  1ZIV A;  5PAD A;  4D8E A;  4W5C A;  4OW0 A;  4WUR A;  2OP3 A;  1PPO A;  4RF0 A;  2R9M A;  2YJ2 A;  3ZUA A;  1PXV A;  1F29 A;  2VHF A;  4Q8H A;  2DOS A;  2R9F A;  1Y08 A;  3F75 A;  1TL9 A;  5KO3 A;  1EWL A;  4CDE B;  4QRX A;  4HWY A;  1KFX L;  3CH2 X;  3RVV A;  2FE8 A;  1TU6 A;  2R6N A;  1KXR A;  4RY2 A;  3MOR A;  1F2C A;  3PHX A;  4CZW A;  3P5U A;  1CB5 A;  4RNA A;  3N3K A;  3E1Z B;  4QBB A;  3S3Q A;  2JQF R;  3PRM A;  2AIM A;  2DC8 A;  1F2A A;  1CPJ A;  3IOQ A;  1MHW A;  3MP2 A;  1SP4 B;  4BSQ A;  1U5I A;  2DC7 A;  4OVZ A;  4YYW A;  3OF8 A;  4CDF B;  1AU4 A;  1GMY A;  3B21 A;  4BOS A;  2G6D A;  1VJV A;  3K9M A;  1PE6 A;  1CV8 A;  2DJF B;  2FYE A;  3WXG A;  5EZS A;  3H6S A;  4I07 A;  2HH5 A;  5J94 A;  1QOL A;  4X6H A;  2E00 A;  3K8U A;  6PAD A;  3V6E A;  4PT5 A;  3KW9 A;  1JQP A;  4FJC A;  1EWO A;  1U9W A;  5CHV A;  3PDF A;  2OZ2 A;  2FTD A;  2AUZ A;  2JQG R;  1M6D A;  1QXP A;  1NB5 A;  8PCH A;  2BTW A;  3PHU A;  2GFO A;  1KFU L;  1AIM A;  1GLO A;  1Y4H A;  2VHS A;  3H7D A;  5K16 A;  2YJB A;  1ITO A;  1STF E;  2J7Q C;  3QJ3 A;  2NQD B;  4BOP A;  1VSN A;  1S4V A;  3PW3 A;  3M99 A;  1DEU A;  3F5V A;  2AVW A;  2GHU A;  4BOQ A;  3WXF A;  2DJG B;  3BWK A;  1F2B A;  2DZZ A;  1GEC E;  2AS8 A;  3C9E A;  3HHI A;  3B79 A;  3BBA A;  4DMY A;  3MTN A;  4AXM A;  1NL6 A;  4W5B A;  2XU4 A;  4FIP A;  3BPM A;  1O0E A;  4DMX A;  3E9S A;  1THE A;  2P7U A;  3TRK A;  3H8C A;  1AYW A;  4M0W A;  4G54 A;  4GUA A;  4MI7 A;  3PNR A;  4OVZ B;  2FRQ A;  2J7Q A;  4N4Z A;  4FK5 A;  1QDQ A;  1PAD A;  5FPW A;  1AYU A;  3PBH A;  1MEG A;  4YYQ A;  2FUD A;  2AYO A;  2NQI A;  4IP3 A;  4PI3 A;  2H7J A;  4X6J A;  3IFU A;  5JZE A;  3P5V A;  1DF0 A;  2AU1 A;  3K24 A;  5A24 A;  3P5W A;  1AEC A;  2PAD A;  4XR7 A;  1X9Y A;  2AGA A;  2R9O A;  5CHT A;  2YJ8 A;  1POP A;  4QRG A;  4PP2 E;  1KHP A;  4RF1 A;  3KSE A;  2FRA A;  1MIR A;  1Q6K A;  3PSE A;  2HWK A;  2ARY A;  3MTV A;  1ICF A;  3CH3 X;  3BCN A;  1CJL A;  4REZ A;  2R9C A;  5CVN B;  3V6C A;  3RNV A;  3IV2 A;  3KX1 A;  3CBJ A;  4BPV A;  5JH3 A;  2WBF X;  5CVO B;  4YYS A;  2BDL A;  2G8E A;  3PHW A;  4MZS A; 
#chains in the Genus database with same CATH homology
 1CQD A;  1XKG A;  2DCB A;  2DZY A;  3KWZ A;  1GX3 A;  1SNK A;  2CB5 A;  4YYR A;  1U9X A;  3OIS A;  3HWN A;  4PP1 A;  2YJ9 A;  4B55 A;  2F7D A;  4NV8 A;  2FQ9 A;  1YVB A;  4YYV A;  1YK7 A;  2FT2 A;  4C5P A;  3QT4 A;  3KKU A;  1AU0 A;  1ME4 A;  9PAP A;  2YJC A;  1ZCM A;  4BQV A;  2E02 A;  3HD3 A;  3MHS A;  4CDD B;  1W6F A;  2G7Y A;  3USV A;  2IPP B;  4PAD A;  1AU3 A;  1YT7 A;  2HXZ A;  4OEL A;  3TNX A;  1NB3 A;  3H89 A;  1KHQ A;  3OVX A;  2HD5 A;  2B1M A;  5JA7 A;  2CIO A;  4KLB A;  3IUT A;  2DCC A;  1PBH A;  2C0Y A;  4MSX A;  4ZUX U;  1MEM A;  3CBK A;  1PCI A;  5CVM A;  4BS5 A;  3IHP A;  4P6E A;  7PCK A;  1NQC A;  1YK8 A;  1IWD A;  5EGW A;  1AYV A;  1EWP A;  5EF4 A;  4K7C A;  2ACT A;  3I3T A;  4BS6 A;  4N79 A;  2IBI A;  2F1G A;  1NLJ A;  2DCA A;  2AYN A;  4OEM A;  2P86 A;  4Q8G A;  2NQA A;  3BOW A;  1CS8 A;  1U9Q X;  3IEJ A;  3OVZ A;  1QMY A;  1A6R A;  2DC6 A;  1PPD A;  2Y5B A;  4N8W A;  4YYU A;  2Y6E A;  1HUC B;  3BPF A;  3MHH A;  2DCD A;  1BGO A;  1FH0 A;  3IMA A;  2PNS A;  3GCB A;  1TLO A;  3LTW A;  1AU2 A;  1CSB B;  2R9N A;  3O1G A;  1BY8 A;  2NQG A;  1CTE A;  3D6S A;  2E01 A;  2XU5 A;  2O6X A;  4W4U A;  1ME3 A;  2BDZ A;  2FO5 A;  3OF9 A;  2OUL A;  1BP4 A;  2PBH A;  3S3R A;  3P5X A;  3I06 A;  1BQI A;  3NHE A;  1EF7 A;  4YVA A;  3O0U A;  2B1N A;  1PPP A;  4P6G A;  3DF0 A;  4BGF A;  3KFQ A;  1NPZ A;  3HHA A;  4AXL A;  3KWB X;  1YAL A;  2AUX A;  3N4C A;  2ATO A;  4QRV A;  4WA6 A;  2HHN A;  3LXS A;  3BC3 A;  4I05 A;  2G8J A;  1CVZ A;  1PIP A;  2XU1 A;  3LFY A;  1U9V A;  3QSD A;  2E03 A;  4I04 A;  1EWM A;  1GCB A;  4XUI A;  3H8B A;  4QH6 A;  4YV8 A;  2DC9 A;  1PPN A;  4MZO A;  3ERV A;  1MDW A;  2XU3 A;  3RVX A;  1K3B B;  3AI8 A;  3U8E A;  5F02 A;  2P0R A;  3WXE A;  4CDC B;  3N3G A;  3RVW A;  2PRE A;  4X6I A;  1ATK A;  1MS6 A;  1ZIV A;  5PAD A;  4W5C A;  2OP3 A;  1PPO A;  2R9M A;  2YJ2 A;  3ZUA A;  1PXV A;  1F29 A;  2VHF A;  4Q8H A;  2R9F A;  1Y08 A;  3F75 A;  1TL9 A;  1EWL A;  4CDE B;  4QRX A;  4HWY A;  1KFX L;  3CH2 X;  3RVV A;  1TU6 A;  2R6N A;  1KXR A;  4RY2 A;  3MOR A;  1W5R A;  1F2C A;  4CZW A;  3P5U A;  1CB5 A;  3N3K A;  3E1Z B;  4QBB A;  3S3Q A;  2JQF R;  2AIM A;  2DC8 A;  1F2A A;  1CPJ A;  3IOQ A;  1MHW A;  1SP4 B;  4BSQ A;  1U5I A;  2DC7 A;  3D9W A;  4YYW A;  3OF8 A;  4CDF B;  1AU4 A;  1GMY A;  2G6D A;  1VJV A;  3K9M A;  1PE6 A;  1CV8 A;  2DJF B;  2FYE A;  3WXG A;  3H6S A;  4I07 A;  2HH5 A;  5J94 A;  1QOL A;  4X6H A;  2E00 A;  3K8U A;  6PAD A;  3V6E A;  2VFC A;  3KW9 A;  1JQP A;  4FJC A;  1EWO A;  1U9W A;  5CHV A;  3PDF A;  2OZ2 A;  2FTD A;  2BSZ A;  2AUZ A;  2JQG R;  1M6D A;  1QXP A;  1NB5 A;  8PCH A;  2GFO A;  1KFU L;  1AIM A;  1GLO A;  1Y4H A;  2VHS A;  3H7D A;  5K16 A;  2YJB A;  1ITO A;  1STF E;  3QJ3 A;  2NQD B;  4GUZ A;  1VSN A;  1S4V A;  3PW3 A;  3M99 A;  1DEU A;  3F5V A;  2AVW A;  2GHU A;  3WXF A;  2DJG B;  3BWK A;  1F2B A;  2DZZ A;  1GEC E;  2AS8 A;  3C9E A;  3HHI A;  3B79 A;  4DMY A;  3MTN A;  4AXM A;  1NL6 A;  4W5B A;  2XU4 A;  4FIP A;  3BPM A;  1O0E A;  4DMX A;  1THE A;  2P7U A;  3H8C A;  1AYW A;  4G54 A;  3PNR A;  2FRQ A;  4N4Z A;  4FK5 A;  1QDQ A;  1PAD A;  5FPW A;  1AYU A;  3PBH A;  4NV7 A;  1MEG A;  4YYQ A;  2FUD A;  2AYO A;  2NQI A;  4PI3 A;  2H7J A;  4X6J A;  3P5V A;  1W4T A;  1DF0 A;  2AU1 A;  3K24 A;  5A24 A;  3P5W A;  1AEC A;  2VFB A;  2PAD A;  4XR7 A;  1X9Y A;  2R9O A;  5CHT A;  2YJ8 A;  1POP A;  4QRG A;  4PP2 E;  1KHP A;  3KSE A;  2FRA A;  1MIR A;  1Q6K A;  1E2T A;  2ARY A;  1ICF A;  3CH3 X;  3BCN A;  1CJL A;  2R9C A;  5CVN B;  3V6C A;  3IV2 A;  3KX1 A;  3CBJ A;  4BPV A;  5JH3 A;  2WBF X;  5CVO B;  4YYS A;  2BDL A;  2G8E A;  4MZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...