3H8CA

A combined crystallographic and molecular dynamics study of cathepsin-l retro-binding inhibitors (compound 14)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
220
structure length
214
Chain Sequence
APRSVDWREKGYVTPVKNQGQCGSWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYGFESNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Combined Crystallographic and Molecular Dynamics Study of Cathepsin L Retrobinding Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin L1
total genus 66
structure length 214
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.4.22.15: Cathepsin L.
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3h8cA00
1CJLA 3H89A 3WXGA 2B1MA 1NLJA 4YYUA 2VHFA 1BY8A 1CTEA 3PBHA 1YVBA 3KWBX 1BGOA 2HXZA 3BPFA 2DCCA 2P7UA 3MORA 3ZUAA 3BCNA 3H7DA 3MHHA 2DZYA 3K9MA 4PADA 1VSNA 1AECA 4AXLA 1Q6KA 3RVVA 2F1GA 5A24A 2VHSA 3KFQA 3PDFA 1VJVA 3TNXA 2Y6EA 3N4CA 3NHEA 1DEUA 3IUTA 2FYEA 1PXVA 2CB5A 2DCDA 1ITOA 4YYQA 3MHSA 3WXEA 3RVWA 2PREA 2DC9A 4W5CA 2C0YA 1GMYA 3H6SA 2E01A 3IMAA 1THEA 5CHTA 1U9VA 3GCBA 1O0EA 1TU6A 3KW9A 2DZZA 4ZUXU 4DMYA 1AU0A 5CVMA 4CZWA 5PADA 2F7DA 3P5VA 4PP2E 4BS6A 1CB5A 1PPDA 4MSXA 1QXPA 2E00A 2FTDA 3OISA 2GFOA 2HH5A 4BSQA 1AU2A 1MEMA 4FK5A 4YYVA 1PPOA 4YVAA 2AU1A 4YYSA 5JH3A 1CS8A 1ME4A 1YT7A 2DC7A 4P6EA 7PCKA 3PW3A 2AUZA 1QOLA 2OZ2A 3PNRA 4CDCB 4G54A 4W5BA 1MIRA 4Q8GA 1Y08A 2DJFB 3B79A 2BDZA 1AU3A 1ICFA 3OVXA 3KKUA 1AYWA 4DMXA 4XR7A 3F5VA 3QJ3A 3P5UA 2AIMA 1SP4B 2FUDA 1POPA 3I06A 4OEMA 4I05A 2DC8A 1STFE 2AS8A 3QT4A 3D6SA 2XU3A 2R9NA 4X6JA 1GLOA 2JQFR 1F2BA 4CDFB 1GCBA 3CH2X 1Y4HA 2WBFX 3MTNA 9PAPA 4QH6A 1NQCA 1K3BB 3RVXA 1ZCMA 3C9EA 2ARYA 1U9QX 1U9WA 5CVNB 6PADA 3H8CA 2FRQA 3O0UA 5JA7A 2G8EA 1XKGA 3KX1A 1BP4A 3K8UA 4KLBA 1AU4A 2O6XA 1EWPA 3H8BA 4X6IA 3KSEA 2PBHA 4I07A 4AXMA 2G7YA 2XU1A 1PPPA 1U5IA 4W4UA 4N4ZA 5FPWA 3N3KA 5K16A 5J94A 3BOWA 1CPJA 2YJ2A 3IOQA 2R9OA 3S3RA 3S3QA 3BWKA 2DCAA 4HWYA 4QRXA 1ATKA 1ME3A 4OELA 2P0RA 2R9FA 2DC6A 1EWLA 1PADA 5EF4A 4XUIA 1ZIVA 4X6HA 3I3TA 3WXFA 1AIMA 5F02A 2ACTA 4FJCA 1NL6A 1S4VA 3BC3A 2ATOA 3HD3A 3V6EA 3F75A 1NB3A 1AYUA 2NQIA 1F2CA 2Y5BA 3IEJA 1PPNA 2AYOA 4BS5A 3CH3X 3ERVA 1GECE 1TL9A 3KWZA 2E03A 3CBJA 2OULA 2YJ8A 1PCIA 1U9XA 2PADA 2IPPB 4N8WA 1KHPA 2NQAA 8PCHA 1CSBB 3U8EA 1PBHA 4FIPA 2BDLA 1F2AA 3V6CA 4QRVA 2YJBA 1AYVA 1KFUL 2G8JA 3OF9A 3LXSA 1IWDA 1M6DA 4N79A 4K7CA 2FO5A 1EWOA 4PI3A 2DCBA 1QDQA 3LFYA 2JQGR 1QMYA 2AVWA 2IBIA 1NB5A 4QBBA 3AI8A 3E1ZB 1PIPA 1A6RA 5CVOB 1PE6A 1NPZA 2R9MA 2GHUA 2FT2A 3QSDA 2B1NA 3HHAA 1JQPA 2NQGA 1KXRA 2AUXA 3O1GA 1YK8A 2H7JA 1CQDA 4QRGA 1DF0A 2DJGB 3CBKA 4I04A 1KFXL 2XU5A 3M99A 3DF0A 1F29A 3IV2A 4BQVA 1MDWA 1FH0A 1MS6A 4P6GA 3HHIA 1SNKA 2R6NA 3P5WA 2P86A 1EF7A 2G6DA 3N3GA 1X9YA 1KHQA 2CIOA 1YK7A 4PP1A 1TLOA 4CDDB 4Q8HA 2PNSA 2YJCA 4YYRA 2XU4A 5CHVA 4YYWA 3OVZA 2E02A 2R9CA 4WA6A 2FQ9A 4MZOA 3OF8A 1CVZA 3P5XA 1YALA 1CV8A 4MZSA 4BPVA 2OP3A 3IHPA 2YJ9A 2HD5A 4RY2A 5EGWA 3K24A 2AYNA 4CDEB 2NQDB 3HWNA 4YV8A 2HHNA 2FRAA 1HUCB 1BQIA 1EWMA 1MHWA 3USVA 1MEGA 3BPMA
chains in the Genus database with same CATH superfamily
3TMPA 1CJLA 3H89A 3WXGA 2B1MA 1NLJA 3RNVA 4YYUA 2VHFA 1BY8A 1CTEA 3PBHA 1YVBA 3KWBX 1BGOA 2HXZA 3BPFA 2DCCA 2P7UA 3MORA 1DKIA 3ZUAA 3BCNA 3H7DA 4RF1A 3MHHA 2DZYA 3K9MA 3TRKA 2BU3A 3W30A 4PADA 1VSNA 1AECA 4AXLA 1Q6KA 3RVVA 4REZA 2F1GA 4D8BA 5A24A 2VHSA 3KFQA 3PDFA 1VJVA 4BOUA 3TNXA 2Y6EA 3N4CA 3NHEA 1DEUA 3IUTA 2FYEA 1PXVA 2CB5A 3O65A 2DCDA 1ITOA 4YYQA 3MHSA 3WXEA 3RVWA 2PREA 2DC9A 4W5CA 2C0YA 1GMYA 3H6SA 2E01A 3IMAA 4MI7A 1THEA 4OW0A 5CHTA 1U9VA 3GCBA 1O0EA 1TU6A 3KW9A 2DZZA 4ZUXU 4DMYA 1AU0A 3USVA 5CVMA 4CZWA 5PADA 2F7DA 3P5VA 4PP2E 4BS6A 1CB5A 1PPDA 2JTCA 4MSXA 1QXPA 2E00A 2FTDA 3OISA 2GFOA 2HH5A 4BSQA 1AU2A 1MEMA 4FK5A 4YYVA 1PPOA 4YVAA 2AU1A 4YYSA 2AGAA 5JH3A 1CS8A 3PHWA 1ME4A 1YT7A 2DC7A 4P6EA 7PCKA 3MP2A 3PW3A 2AUZA 1QOLA 2OZ2A 3PRPA 3PNRA 4CDCB 4G54A 1MIRA 4W5BA 4Q8GA 1Y08A 2DJFB 3B79A 2BDZA 1AU3A 1ICFA 3OVXA 3KKUA 1AYWA 4DMXA 4XR7A 3F5VA 3QJ3A 3P5UA 3MJ5A 2AIMA 2BTWB 3BB7A 1SP4B 2FUDA 1POPA 3I06A 4OEMA 4I05A 2DC8A 1STFE 2AS8A 3QT4A 3D6SA 2XU3A 2R9NA 4X6JA 3BBAA 3PHUA 1YZBA 4A5UA 4P16A 4BOQA 3IFUA 1GLOA 4WURA 2JQFR 1F2BA 4CDFB 1GCBA 3CH2X 4OVZA 1Y4HA 2WBFX 3MTNA 9PAPA 4QH6A 1NQCA 3C0RA 1K3BB 3RVXA 2DOSA 1ZCMA 4ZTBA 3C9EA 5EZSA 2ARYA 1U9QX 1U9WA 5CVNB 6PADA 3H8CA 2FRQA 3O0UA 5JA7A 2G8EA 1XKGA 2FE8A 3KX1A 1BP4A 4R3DA 3K8UA 4KLBA 1AU4A 2O6XA 1EWPA 3H8BA 4X6IA 3KSEA 2PBHA 4I07A 4AXMA 2G7YA 2XU1A 1PPPA 1U5IA 4W4UA 4N4ZA 3PT2A 5FPWA 3N3KA 5K16A 4BOSA 5J94A 3BOWA 2J7QA 1CPJA 2YJ2A 1PVJA 3IOQA 2R9OA 3S3RA 3S3QA 3BWKA 2HWKA 2DCAA 5EZQA 4HWYA 4QRXA 1ATKA 1ME3A 4OELA 2P0RA 2R9FA 4MM3B 2DC6A 1EWLA 1PADA 4RKXA 5EF4A 4IP3A 4XUIA 1ZIVA 4X6HA 3I3TA 3WXFA 1AIMA 5F02A 2ACTA 4FJCA 1NL6A 1S4VA 3BC3A 2ATOA 3HD3A 3V6EA 3F75A 2UZJA 1NB3A 1AYUA 4GUAA 5JZEA 3B21A 2NQIA 1F2CA 2Y5BA 4OVZB 3IEJA 1PPNA 4PT5A 1UKFA 2AYOA 4BS5A 3CH3X 3ERVA 1GECE 1TL9A 3KWZA 2E03A 4M0WA 3CBJA 2OULA 2YJ8A 2J7QC 2Z84A 1PCIA 3ZNHA 1U9XA 2PADA 2IPPB 4N8WA 1KHPA 2NQAA 8PCHA 4D8IA 1CSBB 3U8EA 4RF0A 1PBHA 4FIPA 2BDLA 1F2AA 3V6CA 4QRVA 3OQCA 2YJBA 1AYVA 1KFUL 2G8JA 3OF9A 3LXSA 1IWDA 1M6DA 3MTVA 4N79A 4K7CA 2FO5A 4BOZA 2JRIA 1EWOA 4PI3A 2DCBA 1QDQA 3LFYA 2JQGR 1QMYA 2AVWA 2IBIA 1NB5A 4QBBA 3AI8A 3E1ZB 1PIPA 1A6RA 5CVOB 1PE6A 1NPZA 2R9MA 2GHUA 3E9SA 2FT2A 3QSDA 2B1NA 3HHAA 1JQPA 2NQGA 1KXRA 2AUXA 3O1GA 1YK8A 1CQDA 4QRGA 1DF0A 2DJGB 3CBKA 4I04A 1KFXL 2XU5A 3M99A 3DF0A 1F29A 3IV2A 4BQVA 1MDWA 1FH0A 1MS6A 4P6GA 5E6JA 3HHIA 1SNKA 2R6NA 3P5WA 2P86A 3PSEA 1EF7A 2G6DA 3N3GA 1X9YA 1KHQA 3W31A 2CIOA 1YK7A 2BTWA 4PP1A 4HXDB 1TLOA 4CDDB 4Q8HA 2PNSA 3BY4A 2YJCA 4YYRA 2XU4A 5CHVA 4YYWA 3OVZA 2E02A 2R9CA 4WA6A 2FQ9A 5KO3A 4MZOA 3OF8A 4D8EA 1CVZA 3P5XA 1YALA 1CV8A 4MZSA 4BPVA 2OP3A 3IHPA 4XZXA 3PHXA 2YJ9A 2HD5A 4RY2A 5EGWA 3PRMA 3K24A 2AYNA 4RNAA 4CDEB 2NQDB 3HWNA 4YV8A 4IUMA 2HHNA 2FRAA 4BOPA 1HUCB 1BQIA 1EWMA 1MHWA 2H7JA 1MEGA 3BPMA
chains in the Genus database with same CATH topology
1CJLA 3H89A 3WXGA 2B1MA 1NLJA 4YYUA 2VHFA 1BY8A 1CTEA 3D9WA 3PBHA 1YVBA 3KWBX 1BGOA 2HXZA 3BPFA 4C5PA 2DCCA 2P7UA 3MORA 3ZUAA 1E2TA 3BCNA 3H7DA 3MHHA 2DZYA 3K9MA 4PADA 1VSNA 1AECA 4AXLA 1Q6KA 3RVVA 2F1GA 5A24A 2VHSA 3KFQA 3PDFA 1VJVA 3TNXA 2Y6EA 3N4CA 3NHEA 1DEUA 3IUTA 2FYEA 1PXVA 2CB5A 1W5RA 2DCDA 1ITOA 4YYQA 3MHSA 3WXEA 3RVWA 2PREA 2DC9A 4W5CA 2C0YA 1GMYA 3H6SA 2E01A 3IMAA 1THEA 5CHTA 1U9VA 3GCBA 1O0EA 1TU6A 3KW9A 2DZZA 4ZUXU 1W4TA 4DMYA 1AU0A 3USVA 5CVMA 4CZWA 5PADA 2F7DA 3P5VA 4PP2E 4BS6A 1CB5A 1PPDA 4MSXA 1QXPA 2E00A 2FTDA 3OISA 2GFOA 2HH5A 4BSQA 1AU2A 1MEMA 4FK5A 4YYVA 1PPOA 4YVAA 2AU1A 4YYSA 5JH3A 1CS8A 1ME4A 2BSZA 1YT7A 4BGFA 2DC7A 4P6EA 7PCKA 3PW3A 2AUZA 1QOLA 2OZ2A 3PNRA 4CDCB 4G54A 4W5BA 1MIRA 4Q8GA 1Y08A 2DJFB 3B79A 2BDZA 1AU3A 1ICFA 4B55A 3OVXA 3KKUA 1AYWA 4DMXA 4XR7A 3F5VA 3QJ3A 3P5UA 2AIMA 1SP4B 2FUDA 1POPA 3I06A 4OEMA 4I05A 2DC8A 1STFE 2AS8A 3QT4A 3D6SA 2XU3A 2R9NA 4X6JA 1GLOA 2JQFR 1F2BA 4CDFB 1GCBA 3CH2X 1Y4HA 2WBFX 3MTNA 9PAPA 4QH6A 1NQCA 1K3BB 3RVXA 1ZCMA 2VFCA 3C9EA 2ARYA 1U9QX 1U9WA 2VFBA 5CVNB 6PADA 3H8CA 2FRQA 3O0UA 5JA7A 2G8EA 1XKGA 3KX1A 4NV8A 1BP4A 3K8UA 4KLBA 1AU4A 2O6XA 1EWPA 3H8BA 4X6IA 3KSEA 2PBHA 1W6FA 4I07A 4AXMA 2G7YA 2XU1A 1PPPA 1U5IA 4W4UA 4N4ZA 5FPWA 3N3KA 5K16A 5J94A 3BOWA 1CPJA 2YJ2A 3IOQA 2R9OA 3S3RA 3S3QA 3BWKA 2DCAA 4HWYA 4QRXA 1ATKA 1ME3A 4OELA 2P0RA 2R9FA 2DC6A 1EWLA 1PADA 5EF4A 4XUIA 1ZIVA 4X6HA 3I3TA 3WXFA 1AIMA 5F02A 2ACTA 4FJCA 1NL6A 1S4VA 3BC3A 2ATOA 3HD3A 3V6EA 3F75A 1NB3A 1AYUA 2NQIA 1F2CA 2Y5BA 3IEJA 1PPNA 2AYOA 4BS5A 3CH3X 3ERVA 1GECE 1TL9A 3KWZA 2E03A 3CBJA 2OULA 2YJ8A 1PCIA 1U9XA 2PADA 3LTWA 2IPPB 4N8WA 1KHPA 2NQAA 8PCHA 1CSBB 3U8EA 1PBHA 4FIPA 2BDLA 1F2AA 3V6CA 4QRVA 2YJBA 1AYVA 1KFUL 2G8JA 3OF9A 3LXSA 1IWDA 1M6DA 4N79A 4K7CA 2FO5A 1EWOA 4PI3A 2DCBA 1QDQA 3LFYA 2JQGR 1QMYA 2AVWA 2IBIA 1NB5A 4QBBA 3AI8A 3E1ZB 1PIPA 1A6RA 5CVOB 1PE6A 1NPZA 2R9MA 2GHUA 2FT2A 3QSDA 2B1NA 3HHAA 1JQPA 2NQGA 1KXRA 2AUXA 3O1GA 1YK8A 1CQDA 4QRGA 1DF0A 2DJGB 3CBKA 4I04A 1KFXL 2XU5A 3M99A 3DF0A 1F29A 3IV2A 4BQVA 1MDWA 1FH0A 1MS6A 4P6GA 3HHIA 1SNKA 2R6NA 3P5WA 2P86A 1EF7A 2G6DA 3N3GA 1X9YA 1KHQA 2CIOA 1YK7A 4PP1A 1TLOA 4CDDB 4Q8HA 2PNSA 2YJCA 4YYRA 2XU4A 5CHVA 4YYWA 3OVZA 2E02A 2R9CA 4WA6A 2FQ9A 4MZOA 3OF8A 1CVZA 4NV7A 3P5XA 1YALA 1CV8A 4MZSA 4BPVA 2OP3A 1GX3A 3IHPA 4GUZA 2YJ9A 2HD5A 4RY2A 5EGWA 3K24A 2AYNA 4CDEB 2NQDB 3HWNA 4YV8A 2HHNA 2FRAA 1HUCB 1BQIA 1EWMA 1MHWA 2H7JA 1MEGA 3BPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CJL A;  3H89 A;  3WXG A;  2B1M A;  1NLJ A;  4YYU A;  2VHF A;  1BY8 A;  1CTE A;  3PBH A;  1YVB A;  3KWB X;  1BGO A;  2HXZ A;  3BPF A;  2DCC A;  2P7U A;  3MOR A;  3ZUA A;  3BCN A;  3H7D A;  3MHH A;  2DZY A;  3K9M A;  4PAD A;  1VSN A;  1AEC A;  4AXL A;  1Q6K A;  3RVV A;  2F1G A;  5A24 A;  2VHS A;  3KFQ A;  3PDF A;  1VJV A;  3TNX A;  2Y6E A;  3N4C A;  3NHE A;  1DEU A;  3IUT A;  2FYE A;  1PXV A;  2CB5 A;  2DCD A;  1ITO A;  4YYQ A;  3MHS A;  3WXE A;  3RVW A;  2PRE A;  2DC9 A;  4W5C A;  2C0Y A;  1GMY A;  3H6S A;  2E01 A;  3IMA A;  1THE A;  5CHT A;  1U9V A;  3GCB A;  1O0E A;  1TU6 A;  3KW9 A;  2DZZ A;  4ZUX U;  4DMY A;  1AU0 A;  5CVM A;  4CZW A;  5PAD A;  2F7D A;  3P5V A;  4PP2 E;  4BS6 A;  1CB5 A;  1PPD A;  4MSX A;  1QXP A;  2E00 A;  2FTD A;  3OIS A;  2GFO A;  2HH5 A;  4BSQ A;  1AU2 A;  1MEM A;  4FK5 A;  4YYV A;  1PPO A;  4YVA A;  2AU1 A;  4YYS A;  5JH3 A;  1CS8 A;  1ME4 A;  1YT7 A;  2DC7 A;  4P6E A;  7PCK A;  3PW3 A;  2AUZ A;  1QOL A;  2OZ2 A;  3PNR A;  4CDC B;  4G54 A;  4W5B A;  1MIR A;  4Q8G A;  1Y08 A;  2DJF B;  3B79 A;  2BDZ A;  1AU3 A;  1ICF A;  3OVX A;  3KKU A;  1AYW A;  4DMX A;  4XR7 A;  3F5V A;  3QJ3 A;  3P5U A;  2AIM A;  1SP4 B;  2FUD A;  1POP A;  3I06 A;  4OEM A;  4I05 A;  2DC8 A;  1STF E;  2AS8 A;  3QT4 A;  3D6S A;  2XU3 A;  2R9N A;  4X6J A;  1GLO A;  2JQF R;  1F2B A;  4CDF B;  1GCB A;  3CH2 X;  1Y4H A;  2WBF X;  3MTN A;  9PAP A;  4QH6 A;  1NQC A;  1K3B B;  3RVX A;  1ZCM A;  3C9E A;  2ARY A;  1U9Q X;  1U9W A;  5CVN B;  6PAD A;  3H8C A;  2FRQ A;  3O0U A;  5JA7 A;  2G8E A;  1XKG A;  3KX1 A;  1BP4 A;  3K8U A;  4KLB A;  1AU4 A;  2O6X A;  1EWP A;  3H8B A;  4X6I A;  3KSE A;  2PBH A;  4I07 A;  4AXM A;  2G7Y A;  2XU1 A;  1PPP A;  1U5I A;  4W4U A;  4N4Z A;  5FPW A;  3N3K A;  5K16 A;  5J94 A;  3BOW A;  1CPJ A;  2YJ2 A;  3IOQ A;  2R9O A;  3S3R A;  3S3Q A;  3BWK A;  2DCA A;  4HWY A;  4QRX A;  1ATK A;  1ME3 A;  4OEL A;  2P0R A;  2R9F A;  2DC6 A;  1EWL A;  1PAD A;  5EF4 A;  4XUI A;  1ZIV A;  4X6H A;  3I3T A;  3WXF A;  1AIM A;  5F02 A;  2ACT A;  4FJC A;  1NL6 A;  1S4V A;  3BC3 A;  2ATO A;  3HD3 A;  3V6E A;  3F75 A;  1NB3 A;  1AYU A;  2NQI A;  1F2C A;  2Y5B A;  3IEJ A;  1PPN A;  2AYO A;  4BS5 A;  3CH3 X;  3ERV A;  1GEC E;  1TL9 A;  3KWZ A;  2E03 A;  3CBJ A;  2OUL A;  2YJ8 A;  1PCI A;  1U9X A;  2PAD A;  2IPP B;  4N8W A;  1KHP A;  2NQA A;  8PCH A;  1CSB B;  3U8E A;  1PBH A;  4FIP A;  2BDL A;  1F2A A;  3V6C A;  4QRV A;  2YJB A;  1AYV A;  1KFU L;  2G8J A;  3OF9 A;  3LXS A;  1IWD A;  1M6D A;  4N79 A;  4K7C A;  2FO5 A;  1EWO A;  4PI3 A;  2DCB A;  1QDQ A;  3LFY A;  2JQG R;  1QMY A;  2AVW A;  2IBI A;  1NB5 A;  4QBB A;  3AI8 A;  3E1Z B;  1PIP A;  1A6R A;  5CVO B;  1PE6 A;  1NPZ A;  2R9M A;  2GHU A;  2FT2 A;  3QSD A;  2B1N A;  3HHA A;  1JQP A;  2NQG A;  1KXR A;  2AUX A;  3O1G A;  1YK8 A;  2H7J A;  1CQD A;  4QRG A;  1DF0 A;  2DJG B;  3CBK A;  4I04 A;  1KFX L;  2XU5 A;  3M99 A;  3DF0 A;  1F29 A;  3IV2 A;  4BQV A;  1MDW A;  1FH0 A;  1MS6 A;  4P6G A;  3HHI A;  1SNK A;  2R6N A;  3P5W A;  2P86 A;  1EF7 A;  2G6D A;  3N3G A;  1X9Y A;  1KHQ A;  2CIO A;  1YK7 A;  4PP1 A;  1TLO A;  4CDD B;  4Q8H A;  2PNS A;  2YJC A;  4YYR A;  2XU4 A;  5CHV A;  4YYW A;  3OVZ A;  2E02 A;  2R9C A;  4WA6 A;  2FQ9 A;  4MZO A;  3OF8 A;  1CVZ A;  3P5X A;  1YAL A;  1CV8 A;  4MZS A;  4BPV A;  2OP3 A;  3IHP A;  2YJ9 A;  2HD5 A;  4RY2 A;  5EGW A;  3K24 A;  2AYN A;  4CDE B;  2NQD B;  3HWN A;  4YV8 A;  2HHN A;  2FRA A;  1HUC B;  1BQI A;  1EWM A;  1MHW A;  3USV A;  1MEG A;  3BPM A; 
#chains in the Genus database with same CATH topology
 3TMP A;  1CJL A;  3H89 A;  3WXG A;  2B1M A;  1NLJ A;  3RNV A;  4YYU A;  2VHF A;  1BY8 A;  1CTE A;  3PBH A;  1YVB A;  3KWB X;  1BGO A;  2HXZ A;  3BPF A;  2DCC A;  2P7U A;  3MOR A;  1DKI A;  3ZUA A;  3BCN A;  3H7D A;  4RF1 A;  3MHH A;  2DZY A;  3K9M A;  3TRK A;  2BU3 A;  3W30 A;  4PAD A;  1VSN A;  1AEC A;  4AXL A;  1Q6K A;  3RVV A;  4REZ A;  2F1G A;  4D8B A;  5A24 A;  2VHS A;  3KFQ A;  3PDF A;  1VJV A;  4BOU A;  3TNX A;  2Y6E A;  3N4C A;  3NHE A;  1DEU A;  3IUT A;  2FYE A;  1PXV A;  2CB5 A;  3O65 A;  2DCD A;  1ITO A;  4YYQ A;  3MHS A;  3WXE A;  3RVW A;  2PRE A;  2DC9 A;  4W5C A;  2C0Y A;  1GMY A;  3H6S A;  2E01 A;  3IMA A;  4MI7 A;  1THE A;  4OW0 A;  5CHT A;  1U9V A;  3GCB A;  1O0E A;  1TU6 A;  3KW9 A;  2DZZ A;  4ZUX U;  4DMY A;  1AU0 A;  3USV A;  5CVM A;  4CZW A;  5PAD A;  2F7D A;  3P5V A;  4PP2 E;  4BS6 A;  1CB5 A;  1PPD A;  2JTC A;  4MSX A;  1QXP A;  2E00 A;  2FTD A;  3OIS A;  2GFO A;  2HH5 A;  4BSQ A;  1AU2 A;  1MEM A;  4FK5 A;  4YYV A;  1PPO A;  4YVA A;  2AU1 A;  4YYS A;  2AGA A;  5JH3 A;  1CS8 A;  3PHW A;  1ME4 A;  1YT7 A;  2DC7 A;  4P6E A;  7PCK A;  3MP2 A;  3PW3 A;  2AUZ A;  1QOL A;  2OZ2 A;  3PRP A;  3PNR A;  4CDC B;  4G54 A;  1MIR A;  4W5B A;  4Q8G A;  1Y08 A;  2DJF B;  3B79 A;  2BDZ A;  1AU3 A;  1ICF A;  3OVX A;  3KKU A;  1AYW A;  4DMX A;  4XR7 A;  3F5V A;  3QJ3 A;  3P5U A;  3MJ5 A;  2AIM A;  2BTW B;  3BB7 A;  1SP4 B;  2FUD A;  1POP A;  3I06 A;  4OEM A;  4I05 A;  2DC8 A;  1STF E;  2AS8 A;  3QT4 A;  3D6S A;  2XU3 A;  2R9N A;  4X6J A;  3BBA A;  3PHU A;  1YZB A;  4A5U A;  4P16 A;  4BOQ A;  3IFU A;  1GLO A;  4WUR A;  2JQF R;  1F2B A;  4CDF B;  1GCB A;  3CH2 X;  4OVZ A;  1Y4H A;  2WBF X;  3MTN A;  9PAP A;  4QH6 A;  1NQC A;  3C0R A;  1K3B B;  3RVX A;  2DOS A;  1ZCM A;  4ZTB A;  3C9E A;  5EZS A;  2ARY A;  1U9Q X;  1U9W A;  5CVN B;  6PAD A;  3H8C A;  2FRQ A;  3O0U A;  5JA7 A;  2G8E A;  1XKG A;  2FE8 A;  3KX1 A;  1BP4 A;  4R3D A;  3K8U A;  4KLB A;  1AU4 A;  2O6X A;  1EWP A;  3H8B A;  4X6I A;  3KSE A;  2PBH A;  4I07 A;  4AXM A;  2G7Y A;  2XU1 A;  1PPP A;  1U5I A;  4W4U A;  4N4Z A;  3PT2 A;  5FPW A;  3N3K A;  5K16 A;  4BOS A;  5J94 A;  3BOW A;  2J7Q A;  1CPJ A;  2YJ2 A;  1PVJ A;  3IOQ A;  2R9O A;  3S3R A;  3S3Q A;  3BWK A;  2HWK A;  2DCA A;  5EZQ A;  4HWY A;  4QRX A;  1ATK A;  1ME3 A;  4OEL A;  2P0R A;  2R9F A;  4MM3 B;  2DC6 A;  1EWL A;  1PAD A;  4RKX A;  5EF4 A;  4IP3 A;  4XUI A;  1ZIV A;  4X6H A;  3I3T A;  3WXF A;  1AIM A;  5F02 A;  2ACT A;  4FJC A;  1NL6 A;  1S4V A;  3BC3 A;  2ATO A;  3HD3 A;  3V6E A;  3F75 A;  2UZJ A;  1NB3 A;  1AYU A;  4GUA A;  5JZE A;  3B21 A;  2NQI A;  1F2C A;  2Y5B A;  4OVZ B;  3IEJ A;  1PPN A;  4PT5 A;  1UKF A;  2AYO A;  4BS5 A;  3CH3 X;  3ERV A;  1GEC E;  1TL9 A;  3KWZ A;  2E03 A;  4M0W A;  3CBJ A;  2OUL A;  2YJ8 A;  2J7Q C;  2Z84 A;  1PCI A;  3ZNH A;  1U9X A;  2PAD A;  2IPP B;  4N8W A;  1KHP A;  2NQA A;  8PCH A;  4D8I A;  1CSB B;  3U8E A;  4RF0 A;  1PBH A;  4FIP A;  2BDL A;  1F2A A;  3V6C A;  4QRV A;  3OQC A;  2YJB A;  1AYV A;  1KFU L;  2G8J A;  3OF9 A;  3LXS A;  1IWD A;  1M6D A;  3MTV A;  4N79 A;  4K7C A;  2FO5 A;  4BOZ A;  2JRI A;  1EWO A;  4PI3 A;  2DCB A;  1QDQ A;  3LFY A;  2JQG R;  1QMY A;  2AVW A;  2IBI A;  1NB5 A;  4QBB A;  3AI8 A;  3E1Z B;  1PIP A;  1A6R A;  5CVO B;  1PE6 A;  1NPZ A;  2R9M A;  2GHU A;  3E9S A;  2FT2 A;  3QSD A;  2B1N A;  3HHA A;  1JQP A;  2NQG A;  1KXR A;  2AUX A;  3O1G A;  1YK8 A;  1CQD A;  4QRG A;  1DF0 A;  2DJG B;  3CBK A;  4I04 A;  1KFX L;  2XU5 A;  3M99 A;  3DF0 A;  1F29 A;  3IV2 A;  4BQV A;  1MDW A;  1FH0 A;  1MS6 A;  4P6G A;  5E6J A;  3HHI A;  1SNK A;  2R6N A;  3P5W A;  2P86 A;  3PSE A;  1EF7 A;  2G6D A;  3N3G A;  1X9Y A;  1KHQ A;  3W31 A;  2CIO A;  1YK7 A;  2BTW A;  4PP1 A;  4HXD B;  1TLO A;  4CDD B;  4Q8H A;  2PNS A;  3BY4 A;  2YJC A;  4YYR A;  2XU4 A;  5CHV A;  4YYW A;  3OVZ A;  2E02 A;  2R9C A;  4WA6 A;  2FQ9 A;  5KO3 A;  4MZO A;  3OF8 A;  4D8E A;  1CVZ A;  3P5X A;  1YAL A;  1CV8 A;  4MZS A;  4BPV A;  2OP3 A;  3IHP A;  4XZX A;  3PHX A;  2YJ9 A;  2HD5 A;  4RY2 A;  5EGW A;  3PRM A;  3K24 A;  2AYN A;  4RNA A;  4CDE B;  2NQD B;  3HWN A;  4YV8 A;  4IUM A;  2HHN A;  2FRA A;  4BOP A;  1HUC B;  1BQI A;  1EWM A;  1MHW A;  2H7J A;  1MEG A;  3BPM A; 
#chains in the Genus database with same CATH homology
 1CJL A;  3H89 A;  3WXG A;  2B1M A;  1NLJ A;  4YYU A;  2VHF A;  1BY8 A;  1CTE A;  3D9W A;  3PBH A;  1YVB A;  3KWB X;  1BGO A;  2HXZ A;  3BPF A;  4C5P A;  2DCC A;  2P7U A;  3MOR A;  3ZUA A;  1E2T A;  3BCN A;  3H7D A;  3MHH A;  2DZY A;  3K9M A;  4PAD A;  1VSN A;  1AEC A;  4AXL A;  1Q6K A;  3RVV A;  2F1G A;  5A24 A;  2VHS A;  3KFQ A;  3PDF A;  1VJV A;  3TNX A;  2Y6E A;  3N4C A;  3NHE A;  1DEU A;  3IUT A;  2FYE A;  1PXV A;  2CB5 A;  1W5R A;  2DCD A;  1ITO A;  4YYQ A;  3MHS A;  3WXE A;  3RVW A;  2PRE A;  2DC9 A;  4W5C A;  2C0Y A;  1GMY A;  3H6S A;  2E01 A;  3IMA A;  1THE A;  5CHT A;  1U9V A;  3GCB A;  1O0E A;  1TU6 A;  3KW9 A;  2DZZ A;  4ZUX U;  1W4T A;  4DMY A;  1AU0 A;  3USV A;  5CVM A;  4CZW A;  5PAD A;  2F7D A;  3P5V A;  4PP2 E;  4BS6 A;  1CB5 A;  1PPD A;  4MSX A;  1QXP A;  2E00 A;  2FTD A;  3OIS A;  2GFO A;  2HH5 A;  4BSQ A;  1AU2 A;  1MEM A;  4FK5 A;  4YYV A;  1PPO A;  4YVA A;  2AU1 A;  4YYS A;  5JH3 A;  1CS8 A;  1ME4 A;  2BSZ A;  1YT7 A;  4BGF A;  2DC7 A;  4P6E A;  7PCK A;  3PW3 A;  2AUZ A;  1QOL A;  2OZ2 A;  3PNR A;  4CDC B;  4G54 A;  4W5B A;  1MIR A;  4Q8G A;  1Y08 A;  2DJF B;  3B79 A;  2BDZ A;  1AU3 A;  1ICF A;  4B55 A;  3OVX A;  3KKU A;  1AYW A;  4DMX A;  4XR7 A;  3F5V A;  3QJ3 A;  3P5U A;  2AIM A;  1SP4 B;  2FUD A;  1POP A;  3I06 A;  4OEM A;  4I05 A;  2DC8 A;  1STF E;  2AS8 A;  3QT4 A;  3D6S A;  2XU3 A;  2R9N A;  4X6J A;  1GLO A;  2JQF R;  1F2B A;  4CDF B;  1GCB A;  3CH2 X;  1Y4H A;  2WBF X;  3MTN A;  9PAP A;  4QH6 A;  1NQC A;  1K3B B;  3RVX A;  1ZCM A;  2VFC A;  3C9E A;  2ARY A;  1U9Q X;  1U9W A;  2VFB A;  5CVN B;  6PAD A;  3H8C A;  2FRQ A;  3O0U A;  5JA7 A;  2G8E A;  1XKG A;  3KX1 A;  4NV8 A;  1BP4 A;  3K8U A;  4KLB A;  1AU4 A;  2O6X A;  1EWP A;  3H8B A;  4X6I A;  3KSE A;  2PBH A;  1W6F A;  4I07 A;  4AXM A;  2G7Y A;  2XU1 A;  1PPP A;  1U5I A;  4W4U A;  4N4Z A;  5FPW A;  3N3K A;  5K16 A;  5J94 A;  3BOW A;  1CPJ A;  2YJ2 A;  3IOQ A;  2R9O A;  3S3R A;  3S3Q A;  3BWK A;  2DCA A;  4HWY A;  4QRX A;  1ATK A;  1ME3 A;  4OEL A;  2P0R A;  2R9F A;  2DC6 A;  1EWL A;  1PAD A;  5EF4 A;  4XUI A;  1ZIV A;  4X6H A;  3I3T A;  3WXF A;  1AIM A;  5F02 A;  2ACT A;  4FJC A;  1NL6 A;  1S4V A;  3BC3 A;  2ATO A;  3HD3 A;  3V6E A;  3F75 A;  1NB3 A;  1AYU A;  2NQI A;  1F2C A;  2Y5B A;  3IEJ A;  1PPN A;  2AYO A;  4BS5 A;  3CH3 X;  3ERV A;  1GEC E;  1TL9 A;  3KWZ A;  2E03 A;  3CBJ A;  2OUL A;  2YJ8 A;  1PCI A;  1U9X A;  2PAD A;  3LTW A;  2IPP B;  4N8W A;  1KHP A;  2NQA A;  8PCH A;  1CSB B;  3U8E A;  1PBH A;  4FIP A;  2BDL A;  1F2A A;  3V6C A;  4QRV A;  2YJB A;  1AYV A;  1KFU L;  2G8J A;  3OF9 A;  3LXS A;  1IWD A;  1M6D A;  4N79 A;  4K7C A;  2FO5 A;  1EWO A;  4PI3 A;  2DCB A;  1QDQ A;  3LFY A;  2JQG R;  1QMY A;  2AVW A;  2IBI A;  1NB5 A;  4QBB A;  3AI8 A;  3E1Z B;  1PIP A;  1A6R A;  5CVO B;  1PE6 A;  1NPZ A;  2R9M A;  2GHU A;  2FT2 A;  3QSD A;  2B1N A;  3HHA A;  1JQP A;  2NQG A;  1KXR A;  2AUX A;  3O1G A;  1YK8 A;  1CQD A;  4QRG A;  1DF0 A;  2DJG B;  3CBK A;  4I04 A;  1KFX L;  2XU5 A;  3M99 A;  3DF0 A;  1F29 A;  3IV2 A;  4BQV A;  1MDW A;  1FH0 A;  1MS6 A;  4P6G A;  3HHI A;  1SNK A;  2R6N A;  3P5W A;  2P86 A;  1EF7 A;  2G6D A;  3N3G A;  1X9Y A;  1KHQ A;  2CIO A;  1YK7 A;  4PP1 A;  1TLO A;  4CDD B;  4Q8H A;  2PNS A;  2YJC A;  4YYR A;  2XU4 A;  5CHV A;  4YYW A;  3OVZ A;  2E02 A;  2R9C A;  4WA6 A;  2FQ9 A;  4MZO A;  3OF8 A;  1CVZ A;  4NV7 A;  3P5X A;  1YAL A;  1CV8 A;  4MZS A;  4BPV A;  2OP3 A;  1GX3 A;  3IHP A;  4GUZ A;  2YJ9 A;  2HD5 A;  4RY2 A;  5EGW A;  3K24 A;  2AYN A;  4CDE B;  2NQD B;  3HWN A;  4YV8 A;  2HHN A;  2FRA A;  1HUC B;  1BQI A;  1EWM A;  1MHW A;  2H7J A;  1MEG A;  3BPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...