3H8CA

A combined crystallographic and molecular dynamics study of cathepsin-l retro-binding inhibitors (compound 14)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
220
structure length
214
Chain Sequence
b'APRSVDWREKGYVTPVKNQGQCGSWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYGFESNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin L1
publication title A Combined Crystallographic and Molecular Dynamics Study of Cathepsin L Retrobinding Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 66
structure length 214
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.4.22.15: Cathepsin L.
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3h8cA00
4YYVA 3D6SA 2Y6EA 2AUZA 4W5CA 2YJCA 1NPZA 4YV8A 1AU4A 1KHPA 5CHVA 2CB5A 1PADA 2DZYA 2GFOA 3H8BA 2E01A 2PADA 1PPDA 3BPFA 3MHSA 1GMYA 3HWNA 2AU1A 3PBHA 3V6EA 1QOLA 3PDFA 1ZIVA 4MZSA 2OULA 1BP4A 4W5BA 1MDWA 3USVA 4G54A 1ITOA 2BDLA 3KWZA 3HD3A 1MIRA 2E00A 2PNSA 2XU4A 4YVAA 2PBHA 4XR7A 4YYQA 2R9OA 4MSXA 1EWPA 5CVNB 2C0YA 1AYVA 3RVWA 2F1GA 2ATOA 3QJ3A 3TNXA 4BSQA 3ERVA 1F2CA 2DCCA 2DJGB 3OVZA 2ACTA 4W4UA 3O0UA 3PNRA 1BGOA 1AU2A 1VJVA 4MZOA 3CH3X 3P5XA 1Y08A 3F5VA 4CDFB 2FT2A 4PP2E 4DMYA 1EWMA 2P7UA 1F2AA 2YJ9A 1ME3A 4OEMA 4YYWA 5CVMA 2P0RA 2AS8A 1XKGA 4AXLA 3KWBX 3CH2X 1THEA 3HHIA 2YJBA 2O6XA 3IEJA 4P6GA 2AIMA 3CBKA 1CSBB 2HH5A 1PBHA 3BOWA 8PCHA 1U9QX 4X6JA 1NB3A 3MORA 1CVZA 4N4ZA 1KFUL 1STFE 1KFXL 1AU3A 2DC6A 1VSNA 2DCAA 4BS6A 1MEMA 3ZUAA 2AYOA 1POPA 3WXGA 3S3RA 2YJ2A 3E1ZB 2PREA 1PXVA 4CDEB 2FQ9A 4K7CA 6PADA 1GLOA 3H8CA 1TLOA 3CBJA 3GCBA 1YK8A 2VHSA 3OVXA 1ATKA 2JQGR 3KW9A 4BPVA 4BS5A 2AUXA 1SNKA 1AIMA 1MEGA 4QRGA 3I06A 1AYUA 7PCKA 2WBFX 1MS6A 5CVOB 3H6SA 1CB5A 1EWOA 1GECE 2R6NA 1AYWA 2NQAA 1PPNA 1F29A 3S3QA 1U9VA 3KSEA 4AXMA 5J94A 2NQDB 4QH6A 1ZCMA 2DZZA 3PW3A 1KXRA 4PI3A 3P5VA 4QBBA 2G8EA 1CJLA 2G8JA 1CQDA 3O1GA 3P5WA 4DMXA 4Q8HA 2P86A 2FUDA 3KFQA 1AECA 1EF7A 4XUIA 1F2BA 3QT4A 3F75A 3BWKA 2HXZA 2XU3A 3K9MA 2B1MA 2OP3A 2B1NA 1GCBA 3BC3A 3HHAA 2R9MA 1ME4A 1NL6A 1U9XA 2HD5A 3RVVA 2CIOA 4HWYA 3RVXA 4I05A 4BQVA 3H89A 2R9CA 4OELA 4YYUA 1PPOA 3DF0A 3N4CA 1DF0A 5PADA 1ICFA 1YK7A 3I3TA 4PP1A 1NLJA 1BY8A 3IMAA 3OF8A 1CTEA 1K3BB 2XU5A 3KKUA 1U5IA 3P5UA 3U8EA 3H7DA 4X6IA 2JQFR 4PADA 1QDQA 2BDZA 1MHWA 3OF9A 2IPPB 2HHNA 4RY2A 1AU0A 1PE6A 3WXEA 2E03A 4QRVA 1M6DA 2FRQA 5F02A 1Q6KA 3N3GA 3OISA 1PCIA 1QXPA 2NQIA 3LFYA 3V6CA 3K24A 1QMYA 5EF4A 1NQCA 1SP4B 4CZWA 1S4VA 4N8WA 5K16A 1U9WA 3IUTA 5EGWA 2AVWA 1TU6A 2FYEA 5JH3A 4I04A 1DEUA 4N79A 3MHHA 2IBIA 1HUCB 1EWLA 2F7DA 3LXSA 2DJFB 1CS8A 4I07A 5CHTA 2OZ2A 1PIPA 4P6EA 1X9YA 2E02A 2GHUA 3B79A 1A6RA 3WXFA 1JQPA 1O0EA 1YVBA 4FIPA 2FTDA 2R9FA 3C9EA 3QSDA 4FJCA 4FK5A 4CDCB 2NQGA 3NHEA 1TL9A 2R9NA 2VHFA 4QRXA 1CV8A 1NB5A 1BQIA 4Q8GA 4WA6A 1FH0A 2YJ8A 5JA7A 1YT7A 3BCNA 2DCBA 3AI8A 4ZUXU 3IV2A 1YALA 3K8UA 2DC8A 2DC7A 3N3KA 1Y4HA 4KLBA 3BPMA 2FRAA 2G7YA 2ARYA 3IOQA 9PAPA 2DCDA 3M99A 2FO5A 4YYRA 2G6DA 4YYSA 2Y5BA 3MTNA 5A24A 2AYNA 4CDDB 1CPJA 2H7JA 5FPWA 3KX1A 1PPPA 2XU1A 1IWDA 4X6HA 2DC9A 1KHQA 3IHPA
chains in the Genus database with same CATH superfamily
4YYVA 4XZXA 3D6SA 2Y6EA 2AUZA 4W5CA 2YJCA 1NPZA 4YV8A 1AU4A 1KHPA 5CHVA 2CB5A 1PADA 4RF0A 4M0WA 2DZYA 2GFOA 3H8BA 2E01A 2PADA 1PPDA 3BPFA 3MHSA 1GMYA 3HWNA 2AU1A 3PBHA 3V6EA 1QOLA 4BOPA 3PDFA 1ZIVA 4MZSA 2OULA 1BP4A 2HWKA 4W5BA 1MDWA 3USVA 4G54A 1ITOA 2BDLA 3KWZA 3HD3A 1MIRA 2E00A 2PNSA 2XU4A 4YVAA 2PBHA 4XR7A 4YYQA 2R9OA 4MSXA 1EWPA 5CVNB 2C0YA 1AYVA 3RVWA 2F1GA 2ATOA 3QJ3A 4MI7A 3TNXA 4BSQA 3ERVA 1F2CA 2DCCA 2BTWA 4BOQA 2DJGB 3OVZA 2ACTA 4W4UA 3O0UA 3PNRA 1BGOA 1AU2A 1VJVA 4MZOA 2JTCA 3CH3X 2BTWB 3P5XA 1Y08A 3F5VA 4CDFB 2FT2A 4PP2E 4DMYA 1EWMA 2P7UA 1F2AA 2YJ9A 1ME3A 4OEMA 4YYWA 5CVMA 3TRKA 2P0RA 2AS8A 3BY4A 1XKGA 4AXLA 3KWBX 4PT5A 3CH2X 1THEA 1PVJA 3HHIA 2YJBA 2O6XA 5KO3A 3IEJA 4P6GA 2AIMA 3PRMA 3CBKA 2BU3A 2FE8A 1CSBB 2HH5A 4MM3B 3IFUA 1PBHA 2J7QC 3BOWA 8PCHA 1U9QX 4X6JA 1NB3A 3MORA 3PHWA 1CVZA 4OVZA 4N4ZA 1KFUL 1STFE 4IUMA 1KFXL 1AU3A 2DC6A 3E9SA 1VSNA 2DCAA 1UKFA 1MEMA 4BS6A 3ZUAA 2AYOA 1POPA 3WXGA 3S3RA 2YJ2A 3E1ZB 2PREA 1PXVA 4CDEB 2FQ9A 3O65A 4K7CA 4BOZA 3PT2A 6PADA 2AGAA 1GLOA 3H8CA 1TLOA 3CBJA 3GCBA 1YK8A 4HXDB 2VHSA 3OVXA 1ATKA 2JQGR 3KW9A 4BPVA 4BS5A 4P16A 2AUXA 1SNKA 1AIMA 1MEGA 4QRGA 3I06A 1AYUA 4RF1A 1DKIA 7PCKA 4BOUA 2WBFX 1MS6A 5CVOB 3H6SA 1CB5A 3ZNHA 1EWOA 1GECE 2R6NA 1AYWA 2NQAA 3TMPA 1PPNA 1F29A 3S3QA 1U9VA 3KSEA 4AXMA 5J94A 2Z84A 2NQDB 4QH6A 1ZCMA 2DZZA 3PW3A 1KXRA 4PI3A 3P5VA 4QBBA 2G8EA 1CJLA 2G8JA 4ZTBA 1CQDA 3RNVA 3O1GA 3P5WA 4DMXA 4Q8HA 2P86A 2FUDA 3KFQA 2JRIA 1AECA 1EF7A 4XUIA 1F2BA 3QT4A 4GUAA 4REZA 3F75A 3BWKA 3B21A 4IP3A 2HXZA 2DOSA 2XU3A 3K9MA 2B1MA 2OP3A 2B1NA 2J7QA 1GCBA 3BC3A 3HHAA 5JZEA 2R9MA 4R3DA 4OW0A 1ME4A 1NL6A 1U9XA 2HD5A 3RVVA 2CIOA 4HWYA 3RVXA 4I05A 4BQVA 3H89A 2R9CA 4OELA 4YYUA 1PPOA 3DF0A 3N4CA 1DF0A 5PADA 1ICFA 1YK7A 3I3TA 3MJ5A 4PP1A 1NLJA 1BY8A 3IMAA 3OF8A 1CTEA 1K3BB 2XU5A 3KKUA 1U5IA 3P5UA 5EZQA 3U8EA 3H7DA 4X6IA 2JQFR 4PADA 1QDQA 2BDZA 1MHWA 3OF9A 2IPPB 2HHNA 4RY2A 1AU0A 1PE6A 3WXEA 2E03A 4OVZB 4QRVA 1M6DA 4RNAA 4D8EA 2FRQA 5F02A 1Q6KA 3N3GA 3OISA 1PCIA 1QXPA 2NQIA 3LFYA 3V6CA 5E6JA 3K24A 1QMYA 5EF4A 1NQCA 1SP4B 4CZWA 1S4VA 4N8WA 5K16A 1U9WA 3IUTA 5EGWA 2AVWA 1TU6A 3PRPA 2FYEA 3C0RA 5JH3A 4I04A 1DEUA 4N79A 3MHHA 3BBAA 2IBIA 1HUCB 3PHUA 1EWLA 2F7DA 3LXSA 2UZJA 2DJFB 3MP2A 1CS8A 4I07A 5CHTA 2OZ2A 1PIPA 4P6EA 1X9YA 2E02A 2GHUA 4BOSA 3B79A 3BB7A 1A6RA 3WXFA 1JQPA 1O0EA 1YVBA 4FIPA 2FTDA 2R9FA 3C9EA 3QSDA 4FJCA 4FK5A 4CDCB 2NQGA 3NHEA 1TL9A 2R9NA 2VHFA 4QRXA 1CV8A 1NB5A 1BQIA 4D8IA 4Q8GA 4WA6A 4A5UA 1YZBA 1FH0A 2YJ8A 5JA7A 1YT7A 3BCNA 3OQCA 2DCBA 3AI8A 4ZUXU 3W30A 3IV2A 1YALA 3K8UA 2DC8A 2DC7A 3N3KA 3PHXA 1Y4HA 4KLBA 4D8BA 3BPMA 2FRAA 2G7YA 2ARYA 3W31A 3IOQA 9PAPA 2DCDA 3M99A 2FO5A 4WURA 4YYRA 2G6DA 4YYSA 2Y5BA 3MTNA 5A24A 3PSEA 2AYNA 4CDDB 1CPJA 2H7JA 5EZSA 5FPWA 3KX1A 4RKXA 1PPPA 2XU1A 1IWDA 4X6HA 2DC9A 1KHQA 3MTVA 3IHPA
chains in the Genus database with same CATH topology
4YYVA 3D6SA 2Y6EA 2AUZA 4W5CA 2YJCA 1NPZA 4YV8A 1AU4A 1KHPA 5CHVA 2CB5A 1PADA 2DZYA 2GFOA 3H8BA 2E01A 2PADA 1PPDA 3BPFA 3MHSA 1GMYA 3HWNA 2AU1A 3PBHA 3V6EA 1QOLA 3PDFA 1ZIVA 4MZSA 2OULA 1BP4A 4W5BA 1MDWA 4C5PA 3USVA 4G54A 1ITOA 2BDLA 3KWZA 3HD3A 1MIRA 2E00A 2PNSA 2XU4A 4YVAA 2PBHA 4XR7A 4YYQA 2R9OA 4MSXA 1EWPA 5CVNB 2C0YA 1AYVA 3RVWA 2F1GA 2ATOA 3QJ3A 3TNXA 4BSQA 3ERVA 1F2CA 2DCCA 2DJGB 3OVZA 2ACTA 4W4UA 3O0UA 2BSZA 3PNRA 1BGOA 1AU2A 1VJVA 4MZOA 3CH3X 3P5XA 1Y08A 3F5VA 4CDFB 2FT2A 4PP2E 4DMYA 1EWMA 2P7UA 1F2AA 2YJ9A 1ME3A 4OEMA 4YYWA 5CVMA 2P0RA 2AS8A 1XKGA 4GUZA 4AXLA 2VFCA 3KWBX 3CH2X 1THEA 3HHIA 2YJBA 2O6XA 3IEJA 4P6GA 2AIMA 4B55A 3CBKA 1CSBB 2HH5A 1PBHA 3BOWA 8PCHA 1U9QX 4X6JA 1NB3A 3MORA 1CVZA 4N4ZA 1KFUL 1STFE 1KFXL 1AU3A 2DC6A 1VSNA 2DCAA 4BS6A 1MEMA 3ZUAA 2AYOA 1POPA 3WXGA 3S3RA 2YJ2A 3E1ZB 2PREA 1PXVA 4CDEB 2FQ9A 4K7CA 6PADA 1GLOA 3H8CA 1TLOA 3CBJA 3GCBA 1YK8A 2VHSA 3OVXA 1ATKA 2JQGR 3KW9A 4BPVA 4BS5A 1W6FA 2AUXA 1SNKA 1AIMA 1MEGA 4QRGA 4NV7A 3I06A 1AYUA 7PCKA 4NV8A 2WBFX 1MS6A 5CVOB 3H6SA 1CB5A 1EWOA 1GECE 2R6NA 1AYWA 2NQAA 1PPNA 1F29A 3S3QA 1U9VA 3KSEA 4AXMA 5J94A 2NQDB 4QH6A 1ZCMA 2DZZA 3PW3A 1KXRA 4PI3A 3P5VA 4QBBA 2G8EA 1CJLA 2G8JA 1CQDA 3O1GA 1W4TA 3P5WA 4DMXA 4Q8HA 2P86A 2FUDA 3KFQA 1AECA 1EF7A 4XUIA 1F2BA 3QT4A 3F75A 3BWKA 2HXZA 2XU3A 3K9MA 2B1MA 2OP3A 2B1NA 1GCBA 3BC3A 3HHAA 2R9MA 1ME4A 1NL6A 1U9XA 2HD5A 3RVVA 2CIOA 4BGFA 4HWYA 3RVXA 4I05A 4BQVA 3H89A 2R9CA 4OELA 4YYUA 1PPOA 3DF0A 3N4CA 1DF0A 5PADA 1ICFA 1YK7A 3I3TA 4PP1A 1NLJA 1BY8A 3IMAA 3OF8A 1CTEA 1K3BB 2XU5A 3KKUA 1U5IA 3P5UA 3U8EA 3H7DA 3LTWA 4X6IA 2JQFR 4PADA 1QDQA 2BDZA 1MHWA 3OF9A 2IPPB 2HHNA 4RY2A 1AU0A 1PE6A 3WXEA 2E03A 4QRVA 1M6DA 2FRQA 5F02A 1Q6KA 3N3GA 3OISA 1PCIA 1QXPA 2NQIA 1W5RA 3LFYA 3V6CA 3K24A 1QMYA 5EF4A 1NQCA 1SP4B 4CZWA 1S4VA 4N8WA 5K16A 1U9WA 3IUTA 5EGWA 2AVWA 1TU6A 2FYEA 5JH3A 4I04A 1DEUA 4N79A 3MHHA 2IBIA 1HUCB 1EWLA 2F7DA 3LXSA 2DJFB 1CS8A 4I07A 5CHTA 2OZ2A 1PIPA 4P6EA 1X9YA 2E02A 2VFBA 2GHUA 3B79A 1A6RA 3WXFA 1JQPA 1O0EA 1YVBA 4FIPA 2FTDA 2R9FA 3C9EA 3QSDA 4FJCA 4FK5A 4CDCB 2NQGA 3D9WA 3NHEA 1TL9A 2R9NA 2VHFA 4QRXA 1CV8A 1NB5A 1BQIA 4Q8GA 4WA6A 1FH0A 2YJ8A 5JA7A 1E2TA 1YT7A 3BCNA 2DCBA 3AI8A 4ZUXU 3IV2A 1YALA 3K8UA 2DC8A 2DC7A 3N3KA 1Y4HA 4KLBA 3BPMA 2FRAA 2G7YA 2ARYA 3IOQA 9PAPA 2DCDA 3M99A 2FO5A 4YYRA 2G6DA 4YYSA 2Y5BA 3MTNA 5A24A 2AYNA 4CDDB 1CPJA 2H7JA 5FPWA 3KX1A 1GX3A 1PPPA 2XU1A 1IWDA 4X6HA 2DC9A 1KHQA 3IHPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YYV A;  3D6S A;  2Y6E A;  2AUZ A;  4W5C A;  2YJC A;  1NPZ A;  4YV8 A;  1AU4 A;  1KHP A;  5CHV A;  2CB5 A;  1PAD A;  2DZY A;  2GFO A;  3H8B A;  2E01 A;  2PAD A;  1PPD A;  3BPF A;  3MHS A;  1GMY A;  3HWN A;  2AU1 A;  3PBH A;  3V6E A;  1QOL A;  3PDF A;  1ZIV A;  4MZS A;  2OUL A;  1BP4 A;  4W5B A;  1MDW A;  3USV A;  4G54 A;  1ITO A;  2BDL A;  3KWZ A;  3HD3 A;  1MIR A;  2E00 A;  2PNS A;  2XU4 A;  4YVA A;  2PBH A;  4XR7 A;  4YYQ A;  2R9O A;  4MSX A;  1EWP A;  5CVN B;  2C0Y A;  1AYV A;  3RVW A;  2F1G A;  2ATO A;  3QJ3 A;  3TNX A;  4BSQ A;  3ERV A;  1F2C A;  2DCC A;  2DJG B;  3OVZ A;  2ACT A;  4W4U A;  3O0U A;  3PNR A;  1BGO A;  1AU2 A;  1VJV A;  4MZO A;  3CH3 X;  3P5X A;  1Y08 A;  3F5V A;  4CDF B;  2FT2 A;  4PP2 E;  4DMY A;  1EWM A;  2P7U A;  1F2A A;  2YJ9 A;  1ME3 A;  4OEM A;  4YYW A;  5CVM A;  2P0R A;  2AS8 A;  1XKG A;  4AXL A;  3KWB X;  3CH2 X;  1THE A;  3HHI A;  2YJB A;  2O6X A;  3IEJ A;  4P6G A;  2AIM A;  3CBK A;  1CSB B;  2HH5 A;  1PBH A;  3BOW A;  8PCH A;  1U9Q X;  4X6J A;  1NB3 A;  3MOR A;  1CVZ A;  4N4Z A;  1KFU L;  1STF E;  1KFX L;  1AU3 A;  2DC6 A;  1VSN A;  2DCA A;  4BS6 A;  1MEM A;  3ZUA A;  2AYO A;  1POP A;  3WXG A;  3S3R A;  2YJ2 A;  3E1Z B;  2PRE A;  1PXV A;  4CDE B;  2FQ9 A;  4K7C A;  6PAD A;  1GLO A;  3H8C A;  1TLO A;  3CBJ A;  3GCB A;  1YK8 A;  2VHS A;  3OVX A;  1ATK A;  2JQG R;  3KW9 A;  4BPV A;  4BS5 A;  2AUX A;  1SNK A;  1AIM A;  1MEG A;  4QRG A;  3I06 A;  1AYU A;  7PCK A;  2WBF X;  1MS6 A;  5CVO B;  3H6S A;  1CB5 A;  1EWO A;  1GEC E;  2R6N A;  1AYW A;  2NQA A;  1PPN A;  1F29 A;  3S3Q A;  1U9V A;  3KSE A;  4AXM A;  5J94 A;  2NQD B;  4QH6 A;  1ZCM A;  2DZZ A;  3PW3 A;  1KXR A;  4PI3 A;  3P5V A;  4QBB A;  2G8E A;  1CJL A;  2G8J A;  1CQD A;  3O1G A;  3P5W A;  4DMX A;  4Q8H A;  2P86 A;  2FUD A;  3KFQ A;  1AEC A;  1EF7 A;  4XUI A;  1F2B A;  3QT4 A;  3F75 A;  3BWK A;  2HXZ A;  2XU3 A;  3K9M A;  2B1M A;  2OP3 A;  2B1N A;  1GCB A;  3BC3 A;  3HHA A;  2R9M A;  1ME4 A;  1NL6 A;  1U9X A;  2HD5 A;  3RVV A;  2CIO A;  4HWY A;  3RVX A;  4I05 A;  4BQV A;  3H89 A;  2R9C A;  4OEL A;  4YYU A;  1PPO A;  3DF0 A;  3N4C A;  1DF0 A;  5PAD A;  1ICF A;  1YK7 A;  3I3T A;  4PP1 A;  1NLJ A;  1BY8 A;  3IMA A;  3OF8 A;  1CTE A;  1K3B B;  2XU5 A;  3KKU A;  1U5I A;  3P5U A;  3U8E A;  3H7D A;  4X6I A;  2JQF R;  4PAD A;  1QDQ A;  2BDZ A;  1MHW A;  3OF9 A;  2IPP B;  2HHN A;  4RY2 A;  1AU0 A;  1PE6 A;  3WXE A;  2E03 A;  4QRV A;  1M6D A;  2FRQ A;  5F02 A;  1Q6K A;  3N3G A;  3OIS A;  1PCI A;  1QXP A;  2NQI A;  3LFY A;  3V6C A;  3K24 A;  1QMY A;  5EF4 A;  1NQC A;  1SP4 B;  4CZW A;  1S4V A;  4N8W A;  5K16 A;  1U9W A;  3IUT A;  5EGW A;  2AVW A;  1TU6 A;  2FYE A;  5JH3 A;  4I04 A;  1DEU A;  4N79 A;  3MHH A;  2IBI A;  1HUC B;  1EWL A;  2F7D A;  3LXS A;  2DJF B;  1CS8 A;  4I07 A;  5CHT A;  2OZ2 A;  1PIP A;  4P6E A;  1X9Y A;  2E02 A;  2GHU A;  3B79 A;  1A6R A;  3WXF A;  1JQP A;  1O0E A;  1YVB A;  4FIP A;  2FTD A;  2R9F A;  3C9E A;  3QSD A;  4FJC A;  4FK5 A;  4CDC B;  2NQG A;  3NHE A;  1TL9 A;  2R9N A;  2VHF A;  4QRX A;  1CV8 A;  1NB5 A;  1BQI A;  4Q8G A;  4WA6 A;  1FH0 A;  2YJ8 A;  5JA7 A;  1YT7 A;  3BCN A;  2DCB A;  3AI8 A;  4ZUX U;  3IV2 A;  1YAL A;  3K8U A;  2DC8 A;  2DC7 A;  3N3K A;  1Y4H A;  4KLB A;  3BPM A;  2FRA A;  2G7Y A;  2ARY A;  3IOQ A;  9PAP A;  2DCD A;  3M99 A;  2FO5 A;  4YYR A;  2G6D A;  4YYS A;  2Y5B A;  3MTN A;  5A24 A;  2AYN A;  4CDD B;  1CPJ A;  2H7J A;  5FPW A;  3KX1 A;  1PPP A;  2XU1 A;  1IWD A;  4X6H A;  2DC9 A;  1KHQ A;  3IHP A; 
#chains in the Genus database with same CATH topology
 4YYV A;  4XZX A;  3D6S A;  2Y6E A;  2AUZ A;  4W5C A;  2YJC A;  1NPZ A;  4YV8 A;  1AU4 A;  1KHP A;  5CHV A;  2CB5 A;  1PAD A;  4RF0 A;  4M0W A;  2DZY A;  2GFO A;  3H8B A;  2E01 A;  2PAD A;  1PPD A;  3BPF A;  3MHS A;  1GMY A;  3HWN A;  2AU1 A;  3PBH A;  3V6E A;  1QOL A;  4BOP A;  3PDF A;  1ZIV A;  4MZS A;  2OUL A;  1BP4 A;  2HWK A;  4W5B A;  1MDW A;  3USV A;  4G54 A;  1ITO A;  2BDL A;  3KWZ A;  3HD3 A;  1MIR A;  2E00 A;  2PNS A;  2XU4 A;  4YVA A;  2PBH A;  4XR7 A;  4YYQ A;  2R9O A;  4MSX A;  1EWP A;  5CVN B;  2C0Y A;  1AYV A;  3RVW A;  2F1G A;  2ATO A;  3QJ3 A;  4MI7 A;  3TNX A;  4BSQ A;  3ERV A;  1F2C A;  2DCC A;  2BTW A;  4BOQ A;  2DJG B;  3OVZ A;  2ACT A;  4W4U A;  3O0U A;  3PNR A;  1BGO A;  1AU2 A;  1VJV A;  4MZO A;  2JTC A;  3CH3 X;  2BTW B;  3P5X A;  1Y08 A;  3F5V A;  4CDF B;  2FT2 A;  4PP2 E;  4DMY A;  1EWM A;  2P7U A;  1F2A A;  2YJ9 A;  1ME3 A;  4OEM A;  4YYW A;  5CVM A;  3TRK A;  2P0R A;  2AS8 A;  3BY4 A;  1XKG A;  4AXL A;  3KWB X;  4PT5 A;  3CH2 X;  1THE A;  1PVJ A;  3HHI A;  2YJB A;  2O6X A;  5KO3 A;  3IEJ A;  4P6G A;  2AIM A;  3PRM A;  3CBK A;  2BU3 A;  2FE8 A;  1CSB B;  2HH5 A;  4MM3 B;  3IFU A;  1PBH A;  2J7Q C;  3BOW A;  8PCH A;  1U9Q X;  4X6J A;  1NB3 A;  3MOR A;  3PHW A;  1CVZ A;  4OVZ A;  4N4Z A;  1KFU L;  1STF E;  4IUM A;  1KFX L;  1AU3 A;  2DC6 A;  3E9S A;  1VSN A;  2DCA A;  1UKF A;  1MEM A;  4BS6 A;  3ZUA A;  2AYO A;  1POP A;  3WXG A;  3S3R A;  2YJ2 A;  3E1Z B;  2PRE A;  1PXV A;  4CDE B;  2FQ9 A;  3O65 A;  4K7C A;  4BOZ A;  3PT2 A;  6PAD A;  2AGA A;  1GLO A;  3H8C A;  1TLO A;  3CBJ A;  3GCB A;  1YK8 A;  4HXD B;  2VHS A;  3OVX A;  1ATK A;  2JQG R;  3KW9 A;  4BPV A;  4BS5 A;  4P16 A;  2AUX A;  1SNK A;  1AIM A;  1MEG A;  4QRG A;  3I06 A;  1AYU A;  4RF1 A;  1DKI A;  7PCK A;  4BOU A;  2WBF X;  1MS6 A;  5CVO B;  3H6S A;  1CB5 A;  3ZNH A;  1EWO A;  1GEC E;  2R6N A;  1AYW A;  2NQA A;  3TMP A;  1PPN A;  1F29 A;  3S3Q A;  1U9V A;  3KSE A;  4AXM A;  5J94 A;  2Z84 A;  2NQD B;  4QH6 A;  1ZCM A;  2DZZ A;  3PW3 A;  1KXR A;  4PI3 A;  3P5V A;  4QBB A;  2G8E A;  1CJL A;  2G8J A;  4ZTB A;  1CQD A;  3RNV A;  3O1G A;  3P5W A;  4DMX A;  4Q8H A;  2P86 A;  2FUD A;  3KFQ A;  2JRI A;  1AEC A;  1EF7 A;  4XUI A;  1F2B A;  3QT4 A;  4GUA A;  4REZ A;  3F75 A;  3BWK A;  3B21 A;  4IP3 A;  2HXZ A;  2DOS A;  2XU3 A;  3K9M A;  2B1M A;  2OP3 A;  2B1N A;  2J7Q A;  1GCB A;  3BC3 A;  3HHA A;  5JZE A;  2R9M A;  4R3D A;  4OW0 A;  1ME4 A;  1NL6 A;  1U9X A;  2HD5 A;  3RVV A;  2CIO A;  4HWY A;  3RVX A;  4I05 A;  4BQV A;  3H89 A;  2R9C A;  4OEL A;  4YYU A;  1PPO A;  3DF0 A;  3N4C A;  1DF0 A;  5PAD A;  1ICF A;  1YK7 A;  3I3T A;  3MJ5 A;  4PP1 A;  1NLJ A;  1BY8 A;  3IMA A;  3OF8 A;  1CTE A;  1K3B B;  2XU5 A;  3KKU A;  1U5I A;  3P5U A;  5EZQ A;  3U8E A;  3H7D A;  4X6I A;  2JQF R;  4PAD A;  1QDQ A;  2BDZ A;  1MHW A;  3OF9 A;  2IPP B;  2HHN A;  4RY2 A;  1AU0 A;  1PE6 A;  3WXE A;  2E03 A;  4OVZ B;  4QRV A;  1M6D A;  4RNA A;  4D8E A;  2FRQ A;  5F02 A;  1Q6K A;  3N3G A;  3OIS A;  1PCI A;  1QXP A;  2NQI A;  3LFY A;  3V6C A;  5E6J A;  3K24 A;  1QMY A;  5EF4 A;  1NQC A;  1SP4 B;  4CZW A;  1S4V A;  4N8W A;  5K16 A;  1U9W A;  3IUT A;  5EGW A;  2AVW A;  1TU6 A;  3PRP A;  2FYE A;  3C0R A;  5JH3 A;  4I04 A;  1DEU A;  4N79 A;  3MHH A;  3BBA A;  2IBI A;  1HUC B;  3PHU A;  1EWL A;  2F7D A;  3LXS A;  2UZJ A;  2DJF B;  3MP2 A;  1CS8 A;  4I07 A;  5CHT A;  2OZ2 A;  1PIP A;  4P6E A;  1X9Y A;  2E02 A;  2GHU A;  4BOS A;  3B79 A;  3BB7 A;  1A6R A;  3WXF A;  1JQP A;  1O0E A;  1YVB A;  4FIP A;  2FTD A;  2R9F A;  3C9E A;  3QSD A;  4FJC A;  4FK5 A;  4CDC B;  2NQG A;  3NHE A;  1TL9 A;  2R9N A;  2VHF A;  4QRX A;  1CV8 A;  1NB5 A;  1BQI A;  4D8I A;  4Q8G A;  4WA6 A;  4A5U A;  1YZB A;  1FH0 A;  2YJ8 A;  5JA7 A;  1YT7 A;  3BCN A;  3OQC A;  2DCB A;  3AI8 A;  4ZUX U;  3W30 A;  3IV2 A;  1YAL A;  3K8U A;  2DC8 A;  2DC7 A;  3N3K A;  3PHX A;  1Y4H A;  4KLB A;  4D8B A;  3BPM A;  2FRA A;  2G7Y A;  2ARY A;  3W31 A;  3IOQ A;  9PAP A;  2DCD A;  3M99 A;  2FO5 A;  4WUR A;  4YYR A;  2G6D A;  4YYS A;  2Y5B A;  3MTN A;  5A24 A;  3PSE A;  2AYN A;  4CDD B;  1CPJ A;  2H7J A;  5EZS A;  5FPW A;  3KX1 A;  4RKX A;  1PPP A;  2XU1 A;  1IWD A;  4X6H A;  2DC9 A;  1KHQ A;  3MTV A;  3IHP A; 
#chains in the Genus database with same CATH homology
 4YYV A;  3D6S A;  2Y6E A;  2AUZ A;  4W5C A;  2YJC A;  1NPZ A;  4YV8 A;  1AU4 A;  1KHP A;  5CHV A;  2CB5 A;  1PAD A;  2DZY A;  2GFO A;  3H8B A;  2E01 A;  2PAD A;  1PPD A;  3BPF A;  3MHS A;  1GMY A;  3HWN A;  2AU1 A;  3PBH A;  3V6E A;  1QOL A;  3PDF A;  1ZIV A;  4MZS A;  2OUL A;  1BP4 A;  4W5B A;  1MDW A;  4C5P A;  3USV A;  4G54 A;  1ITO A;  2BDL A;  3KWZ A;  3HD3 A;  1MIR A;  2E00 A;  2PNS A;  2XU4 A;  4YVA A;  2PBH A;  4XR7 A;  4YYQ A;  2R9O A;  4MSX A;  1EWP A;  5CVN B;  2C0Y A;  1AYV A;  3RVW A;  2F1G A;  2ATO A;  3QJ3 A;  3TNX A;  4BSQ A;  3ERV A;  1F2C A;  2DCC A;  2DJG B;  3OVZ A;  2ACT A;  4W4U A;  3O0U A;  2BSZ A;  3PNR A;  1BGO A;  1AU2 A;  1VJV A;  4MZO A;  3CH3 X;  3P5X A;  1Y08 A;  3F5V A;  4CDF B;  2FT2 A;  4PP2 E;  4DMY A;  1EWM A;  2P7U A;  1F2A A;  2YJ9 A;  1ME3 A;  4OEM A;  4YYW A;  5CVM A;  2P0R A;  2AS8 A;  1XKG A;  4GUZ A;  4AXL A;  2VFC A;  3KWB X;  3CH2 X;  1THE A;  3HHI A;  2YJB A;  2O6X A;  3IEJ A;  4P6G A;  2AIM A;  4B55 A;  3CBK A;  1CSB B;  2HH5 A;  1PBH A;  3BOW A;  8PCH A;  1U9Q X;  4X6J A;  1NB3 A;  3MOR A;  1CVZ A;  4N4Z A;  1KFU L;  1STF E;  1KFX L;  1AU3 A;  2DC6 A;  1VSN A;  2DCA A;  4BS6 A;  1MEM A;  3ZUA A;  2AYO A;  1POP A;  3WXG A;  3S3R A;  2YJ2 A;  3E1Z B;  2PRE A;  1PXV A;  4CDE B;  2FQ9 A;  4K7C A;  6PAD A;  1GLO A;  3H8C A;  1TLO A;  3CBJ A;  3GCB A;  1YK8 A;  2VHS A;  3OVX A;  1ATK A;  2JQG R;  3KW9 A;  4BPV A;  4BS5 A;  1W6F A;  2AUX A;  1SNK A;  1AIM A;  1MEG A;  4QRG A;  4NV7 A;  3I06 A;  1AYU A;  7PCK A;  4NV8 A;  2WBF X;  1MS6 A;  5CVO B;  3H6S A;  1CB5 A;  1EWO A;  1GEC E;  2R6N A;  1AYW A;  2NQA A;  1PPN A;  1F29 A;  3S3Q A;  1U9V A;  3KSE A;  4AXM A;  5J94 A;  2NQD B;  4QH6 A;  1ZCM A;  2DZZ A;  3PW3 A;  1KXR A;  4PI3 A;  3P5V A;  4QBB A;  2G8E A;  1CJL A;  2G8J A;  1CQD A;  3O1G A;  1W4T A;  3P5W A;  4DMX A;  4Q8H A;  2P86 A;  2FUD A;  3KFQ A;  1AEC A;  1EF7 A;  4XUI A;  1F2B A;  3QT4 A;  3F75 A;  3BWK A;  2HXZ A;  2XU3 A;  3K9M A;  2B1M A;  2OP3 A;  2B1N A;  1GCB A;  3BC3 A;  3HHA A;  2R9M A;  1ME4 A;  1NL6 A;  1U9X A;  2HD5 A;  3RVV A;  2CIO A;  4BGF A;  4HWY A;  3RVX A;  4I05 A;  4BQV A;  3H89 A;  2R9C A;  4OEL A;  4YYU A;  1PPO A;  3DF0 A;  3N4C A;  1DF0 A;  5PAD A;  1ICF A;  1YK7 A;  3I3T A;  4PP1 A;  1NLJ A;  1BY8 A;  3IMA A;  3OF8 A;  1CTE A;  1K3B B;  2XU5 A;  3KKU A;  1U5I A;  3P5U A;  3U8E A;  3H7D A;  3LTW A;  4X6I A;  2JQF R;  4PAD A;  1QDQ A;  2BDZ A;  1MHW A;  3OF9 A;  2IPP B;  2HHN A;  4RY2 A;  1AU0 A;  1PE6 A;  3WXE A;  2E03 A;  4QRV A;  1M6D A;  2FRQ A;  5F02 A;  1Q6K A;  3N3G A;  3OIS A;  1PCI A;  1QXP A;  2NQI A;  1W5R A;  3LFY A;  3V6C A;  3K24 A;  1QMY A;  5EF4 A;  1NQC A;  1SP4 B;  4CZW A;  1S4V A;  4N8W A;  5K16 A;  1U9W A;  3IUT A;  5EGW A;  2AVW A;  1TU6 A;  2FYE A;  5JH3 A;  4I04 A;  1DEU A;  4N79 A;  3MHH A;  2IBI A;  1HUC B;  1EWL A;  2F7D A;  3LXS A;  2DJF B;  1CS8 A;  4I07 A;  5CHT A;  2OZ2 A;  1PIP A;  4P6E A;  1X9Y A;  2E02 A;  2VFB A;  2GHU A;  3B79 A;  1A6R A;  3WXF A;  1JQP A;  1O0E A;  1YVB A;  4FIP A;  2FTD A;  2R9F A;  3C9E A;  3QSD A;  4FJC A;  4FK5 A;  4CDC B;  2NQG A;  3D9W A;  3NHE A;  1TL9 A;  2R9N A;  2VHF A;  4QRX A;  1CV8 A;  1NB5 A;  1BQI A;  4Q8G A;  4WA6 A;  1FH0 A;  2YJ8 A;  5JA7 A;  1E2T A;  1YT7 A;  3BCN A;  2DCB A;  3AI8 A;  4ZUX U;  3IV2 A;  1YAL A;  3K8U A;  2DC8 A;  2DC7 A;  3N3K A;  1Y4H A;  4KLB A;  3BPM A;  2FRA A;  2G7Y A;  2ARY A;  3IOQ A;  9PAP A;  2DCD A;  3M99 A;  2FO5 A;  4YYR A;  2G6D A;  4YYS A;  2Y5B A;  3MTN A;  5A24 A;  2AYN A;  4CDD B;  1CPJ A;  2H7J A;  5FPW A;  3KX1 A;  1GX3 A;  1PPP A;  2XU1 A;  1IWD A;  4X6H A;  2DC9 A;  1KHQ A;  3IHP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...