4RNAA

Crystal structure of plpro from middle east respiratory syndrome (mers) coronavirus
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
321
structure length
319
Chain Sequence
LTIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVDKVRSLKLSDNNYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSDCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibitor Recognition Specificity of MERS-CoV Papain-like Protease May Differ from That of SARS-CoV.
pubmed doi rcsb
source organism Human betacoronavirus 2c emc/2012
molecule tags Hydrolase
molecule keywords papain-like protease
total genus 92
structure length 319
sequence length 321
ec nomenclature ec 3.4.22.-:
pdb deposition date 2014-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4rnaA02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rnaA01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4rnaA03
5KO3A 3MJ5A 4MM3B 4R3DA 4OW0A 4M0WA 4OVZA 4RF1A 4PT5A 4RF0A 4REZA 5E6JA 4P16A 2FE8A 4OVZB 3MP2A 3E9SA 4WURA 4RNAA
chains in the Genus database with same CATH superfamily
1TF0B 4RM8A 4DUYM 1UELA 2DBYA 1VCBA 4WWOA 4GKJM 1AU0A 1IN7A 2NTTA 3EUB2 4JI8M 3U2SC 3PRPA 2D5GA 1YE9A 5EE1A 2JP7A 4KSLC 4BOSC 3IEJA 1T6OA 3T8MA 1E7UA 4G3XB 3U52E 1NNUC 1PDXA 3L13A 1B9RA 4BVUC 3AFHA 1QOGA 3OQCA 4PS7A 1W5SA 1TS2A 3ZH9B 1EM7A 1WYGA 3TCAA 2O5RA 1K51A 3PGEA 5BO4B 1QANA 3FTEA 1XCTL 2PE6B 4BZAA 1D6EC 3IT4B 2CRUA 4GUAA 4AW4A 3GO8A 4DV6M 2KC1A 3FUTA 4Q7JA 3DCGA 4TV3A 3IHPA 4IM2A 4DXFA 2ZAMA 2V4LA 1G8PA 2JZ1A 2K47A 5IWAM 4EZKA 3VTUA 3T6PA 4AQ7A 1R2YA 1N34M 2LNHC 3U6QA 1IGDA 2C7NB 4P1CC 4JWUC 2DZNB 1AU3A 2MJ5B 1J5EM 3LDZE 1SIFA 1M4VA 3ETRA 4DR1M 3SU8X 1J7CA 2K8HA 3AEBB 4FA6A 2N4FA 2I1KA 1KFYB 4HVBA 4IC7B 4GHLA 2DAKA 2AEHA 2NBWB 3VUYA 4WA6A 3OTOM 2HJ8A 3RMKC 3VFKA 2ACZB 2JXNA 2WXPA 2MR9A 4TSSA 2O6VA 1XLQA 3GS2A 2K22A 4AKHA 1YOVB 5LXHA 2FFJA 4LFCM 3BK2A 1TS3A 3Q3NC 3SAWA 3NJTA 3APDA 4W5WA 1I4HA 1D0KA 3ZDTA 1Q02A 3R7QA 3ZC7B 3JVZX 2ZPYA 4G0NB 4CHTB 2GBJA 1AYWA 3GP1A 4B0MA 1XNQM 2EKIA 1O0EA 4ZTBA 2DYMA 1Q1OA 2MQJA 3ZJVA 2CU3A 4W9LA 4IWPA 1TJEA 2KKCA 4G4NA 3V6CA 1J0GA 2ZAOA 3MP2A 1VDDA 3HUIA 2D7EA 2DCBA 5KPTA 4CISA 4C7YA 2RGFA 3NZSA 4BKSD 3A1QA 3SHQA 1E7PB 4LJ6A 3ZNGC 1EUVB 4JIOU 2LVNC 3O65A 2XK5A 2OHFA 1E9MA 3WALA 1YLAA 1X37A 1XMQM 4BOPA 1MS6A 4CGYB 4OVVA 2KHWB 1I4XA 1VQ1A 3SATA 2XEPA 1WXQA 3ZVVA 3C8YA 1YK8A 3DBRI 4BKGA 4S12A 1YZBA 3P5XA 1G41A 5JZEA 3PZ7A 4AI6A 1KTKA 4NZLB 1XB2B 1D0LA 2BWES 3DZDA 2ZCBA 4LF6M 1QOAA 2N7EA 1XNRM 1ZV1A 4P1BC 4Q8HA 3DFZA 2E5LM 2HH5A 3R3MA 3HHXA 4HPMB 3RNBC 4C7ZA 5DFLA 4MEMA 2DVWB 4FXCA 3KUCB 1I94M 3L2AA 3BY4B 3B0AA 5EE9A 2OZ2A 1UBIA 2I38A 4PI3A 2QNJA 3HIZA 5E26A 2L1AA 2N1VA 4ZYNA 5C1BA 3IFWB 3H4MA 4PDGA 5KPRA 1I7HA 3F92A 5AZGA 2UXDM 1NLJA 1WZ3A 4I5SA 4TUWA 3PHWA 3QAQA 2JNHA 2AYOA 2LI5A 3O1GA 3K92A 1WXAA 1SP4B 4P6EA 2JXTA 1ZQ9A 5DPRA 3MC0B 3AE8B 3DVGY 3X0WA 1DOIA 3ZKJC 3TWMA 4CDCB 4KT0F 1NHGC 3MHSD 4KVGB 3HWSA 3GE8C 4IJEA 3JR4A 4WIPA 4CDDB 1HNZM 3QA8A 2AS8A 1YQ3B 3A98B 1HQYE 2VH2A 2D10A 2NTSA 1K53A 3DBSA 3S3QA 2WSFF 4AKIA 1XD3B 1WE7A 2M56B 4XBOA 2DWQA 3DPDA 1C1KA 3TWKA 2K39A 1V97A 4KODA 2D11A 3KXEC 2CV2A 3H8BA 1FFUA 3DBLI 3J27B 2DWLA 3PDFA 1FJGM 4K7UA 4YYUA 1V49A 4P17A 4K3CA 4HJGE 1SJED 3SD5A 2NQAA 2MGWA 4ANUA 2WDRB 3HY5A 3PVSA 3ZNHA 2CE7A 4IW0A 4M9XA 3BB7A 4E74A 1LV7A 1SNKA 1OAIA 2M0XA 1PJSA 1CJEA 3GPYA 2Y3AA 2Z4RA 3BZDB 3FUVA 1SXJA 2KN5A 4WWNA 2GBRA 2WBFX 1HE8A 2YJ2A 2C9OA 3RVVA 2JYEA 1E10A 2LVQD 3QWLA 3UK6A 4JXJA 3Q8GA 3ZNID 3RUIB 1WXVA 4HJKA 4YSXB 2I2YA 4EKUA 1E32A 3B1LX 1QUSA 4OEMA 4GITA 2BS2B 3KUZA 4BKSA 2BU3A 2R2QA 4OZBA 1NVMA 5ITXA 3E9SA 2JY7A 2WX1A 1N32M 4O1NA 2LUMA 1DEUA 2KTRB 3H9DA 1V80A 3NWLA 3O13A 2BDZA 3DQVA 2DJGB 4JI1M 4CJ6A 1PCIA 3KWLA 4JWSC 1D0MA 4LF8M 4NRWA 1ZCMA 1HUCB 4IM3A 4P6GA 4ZOHC 4N58A 4X6IA 1HA5A 2G3QB 3H7PB 1HNWM 5F02A 2AL3A 2IY1B 3V6CB 3AKZA 4ICUA 1WI0A 4OW0A 3CGWA 1A5TA 3RE8A 2L3ZA 4B3SM 2CV0A 1NQCA 3E1ZB 1KFUL 1DO2A 1SJHD 3VLFB 3ERVA 4ANWA 5J2RA 5BR8M 1EF7A 2FO5A 2XU5A 4DWFA 4KLBA 5FTNA 4AOFA 2PJHA 5AUIA 1Q10A 2EJSA 3UQAA 1JQPA 4DV5M 3M0EA 3UIOB 4BSQA 2Z4SA 1MG8A 2QJLA 1ZUD2 2FCQA 2MBBB 4DV4M 4XX5A 1SXJD 3HM3A 1F9JA 2HAKA 2HDEA 2IPKD 1XXHA 2IYDB 1VJVA 5HKHA 1R4NB 2X8XX 3A9KB 3GPUA 4C4VB 4W9GA 5IAAC 3TNXA 3I3TB 2PW9A 2L7RA 1CMXB 2Z59B 2CJOA 2F1GA 2IZVB 2N7DA 2FH0A 1CQVA 3GRUA 1JMLA 3R9XB 3W67A 1TL9A 3PLUA 2O6XA 2CHZA 2M5ZA 1THEA 1XHBA 4AG5A 3ZRCA 2L52A 1TDZA 2LVOC 1ZXIA 4HDQA 5DPTA 5JH3A 3BVMA 1WFYA 1KXRA 1GKIA 3BBAA 1PE6A 4YSZB 3Q69A 2C98A 4XGAB 3FKEA 1MHHE 4IBGA 4K3BA 4BB9A 4BLCA 4TKNA 1YN5A 2N0SB 5BMGA 2DZMA 3N3KA 4DK5A 4A55A 1RFAA 1F2RI 1IN8A 3IG3A 1VRAB 2BWFA 3J9CA 3VUXA 3W1YA 1TLOA 3WXGA 1GAQB 3U6DA 2JZ0A 2HCBA 2FS1A 2MCNB 3D6SA 2J7NA 4LJ5A 1U4AA 5ITRA 1WM3A 3P2BA 4YXDB 2BNKA 2KO3A 3R8FA 2OQ4A 4M02A 1P3QQ 1FM0D 2K0BX 3HHZA 1MI0A 1L1TA 2BF8B 3CMMB 3OJ3A 4GMVA 4MH0E 1NB3A 4G3OA 3VKHA 1KFXL 4YL8A 3N32A 1F2AA 1SE3A 1LXDA 5IZ7D 3MMPA 4MJSB 3L25A 2Z0DB 3P63A 3IV2A 3I51A 3H1UA 1ZW7A 4J3OD 4NL4H 4QRXA 5D3IB 4RGNA 2LHCA 2QENA 5LMUM 3ZYYX 3PVLA 3U5ZA 2W9NA 2B1MA 3LJ3A 5BYSA 3HHWA 3KH0A 1E94E 1PQSA 1SSNA 4DV3M 1N36M 5KO3A 2MLBA 4X57B 2MBEA 2BBCA 3GCBA 2LGIA 4NNJB 5HG2A 2CHVA 4MZSA 1WGGA 2FAZA 4BFRA 2ZVNA 4FJYA 2DC7A 1Z5BA 3K2LA 5ITQA 3IG8A 1VD2A 4RKUF 1NNJA 1TKGA 4G6ZA 1WRDB 4GDLA 1XO3A 2FQ9A 1KLGD 1WGKA 2B1NA 1EWYC 3P5VA 4JI0M 5AZFA 2DENA 3D32A 2AIMA 2CUZA 3GLGB 3TUOA 5FTJA 2HTHA 1FNUA 1WX9A 1RU3A 4L15A 4NPNA 2FCNA 3GLIB 2AYNA 3GQ3A 2QPAA 1IBXA 1CQDA 4IIWA 1YJJA 4LLGM 2R6FA 3U6CA 4MM3B 1P3QU 2G45B 2XLJA 1L5PA 2L32A 2LVOA 2KZUA 3TL5A 1UH6A 1NHWC 5CHFA 4BOZA 2XEWA 1FCCC 3S3RA 3M6AA 3RNEC 4L16A 2KFKA 2BS4B 3U8EA 2WSCF 1ZKHA 2DXIA 1QOLA 2D3GA 2LZ6A 1HTQA 3N3KB 3PNRA 2ARYA 2MJEA 4A3PA 1FNNA 4WWMA 1MPEA 4LK0M 1TYGB 2WXKA 3WANA 3A33B 3AU4A 3B08A 4WURA 3ZXRA 5ITYA 1JQ4A 1ICFA 7CATA 1ATKA 4RGMA 3IG5A 2JUOA 2L00B 3HZJA 2BWBA 3DWMA 3B7NA 4C00A 3NHEA 3J81S 2NQGA 3AB5A 1GABA 4USAA 1I4RA 3HGIA 1Z5CA 1TKEA 3IFUA 4L6V6 4II3B 1N61A 2JPHA 4MI7A 1PPOA 2UZJA 1UWMA 3GLFA 2KNZA 5T8IA 3FILB 2ONQA 4GH9A 1C77A 1WF9A 2R4JA 5D3DA 1GJZA 1FMAD 3U6OA 5CVMA 2FIFA 2O2VA 4NSOB 3KYCD 1SEBD 1KHPA 1IBMM 2DCDA 3PRMA 3ZW3A 3KDSE 1SE4A 4AP4C 3L16A 5GXGB 3ZRFA 1NPZA 1XLNA 1WGRA 2DX5B 4FBJB 1K52A 2WP9B 3QIJA 4CO7A 2JRHA 3VDZA 2INPE 2KYWA 4JX1C 3W1SA 2MJ3A 2OOBB 1FNVA 3Q3FA 2WQYB 5FR3A 1DO0A 2L8JA 3NVYA 3KVFB 3WIMA 3P5WA 2QBYB 2RD0A 3MHZA 4DR6M 2R65A 1OFHA 3SEBA 4ZHOA 2KC2A 2X4AA 5DPWA 1GC6A 5CTRC 3AULA 1LTMA 4KV2A 4KGRA 4A3OA 1HTOA 3FC4A 8PCHA 2I1JA 3EIEA 1D2NA 1TZOA 5J94A 3VH4B 4GHAA 4ZUXU 3VR8B 1KLUD 2QEJC 1H6UA 1JALA 1QAMA 3W0FA 4LG2A 1TZ1A 2KT7A 1BP4A 3TMPA 3RYTA 3AH7A 1WE6A 5CX3A 3P4QB 2CV1A 3R2IA 5AEKB 5BYRA 4JV5M 2KWCA 3MC8A 1NYRA 2K25A 3E4RA 2BWEA 1V2YA 2DZYA 3E46A 3AE9B 2L2DA 1L1ZA 1T0SC 2BW2A 4JLCA 2KW0A 3E21A 3FE3A 2KD0A 4B3RM 3Q8EA 4B95A 4RY2A 4A6QA 3CWIA 4ITKA 2KQ7A 2QDFA 1SG9A 4ANVA 3GPPA 3WXFA 5FTKA 3HJSA 5EDSA 2FNAA 4IBCA 3GQ4A 2IDYA 3BYTB 2IPPB 2HJ1A 1YQBA 3NVVA 3SASA 3VDUA 2A5UA 2LFIA 5JXVA 1H8CA 3BC3A 5BPVA 3P4RB 1KRHA 4GDLB 2C99A 1G4AE 4KKJA 4AUQC 5CHVA 1GOZA 4CHKA 2WX0A 2IJ0A 3PZ8A 5L8RF 1FXAA 3AI5A 2KX0A 3ZIMA 3UMMA 2NPTA 4G4OA 1V8CA 3OAWA 4HEOA 1VEKA 1FPYA 1C1YB 4I6PA 3KLSX 3DWGC 1ZGUB 4ZDVA 1L2DA 4DXAB 4ARCA 4EEWA 4L2YA 2GI9A 3PZDA 3PTFC 3IUTA 1UBQA 2G7YA 1PGAA 2DZZA 3GRRA 3I57A 5IP4D 3CBJA 2WXMA 4FHJA 5DYIA 1TY0A 4PADA 1MFWA 1R4MI 4GKKM 2DLBA 2CHGA 3RGSA 4KX6B 5KHQA 4XGIA 3QHTA 5JI2E 4GN1A 2PBHA 2PREA 1RWSA 2Y0QA 4ZRJA 2JTCA 1PJQA 2V3NA 2WXRA 2NBVB 4DR5M 1P0RA 4NXNM 5EE3A 1NJFA 3ML8A 4DR2M 2V1CA 3BYYB 4X66M 2E02A 1FO4A 5LNK1 3LVVA 2YJ8A 2D7HA 1LM8B 4HPPA 1ZP0B 2DHRA 2JZPA 5HHDG 1MJDA 1Q39A 3AOEA 1YX5B 2LRUA 4IBDA 2Y5BB 4CIZA 1BXTA 1DGHB 2V3SA 1GL6A 1FRDA 1D5ZC 1WXMA 3WAPA 4IJFA 3BWKA 4QH6A 2R18A 1JR3E 2KACA 3FUWA 3W5VB 3JYUA 3GLHB 3N9YC 4IG7B 4NC6A 2LASA 3OISA 5EF4A 4YTPB 3VR9B 2VDBB 1RAXA 1SF0A 1C4AA 3VVWB 3RPFC 3O65B 4FJVB 1WJ6A 1A70A 3FAHA 1EF5A 3GPXA 4XK8F 4KIKB 3QCAA 1TTEA 3W2DA 3BPFA 1ZE3D 4ZYSA 1R4GA 1DOYA 4XZ4A 1YN3A 1WIVA 3CSTA 1MEMA 1IY1A 2LUEA 2DZLA 3MTNA 3M63B 1F1HA 4NJ6A 1J7KA 2R9CA 1NB5A 4HWIB 2EA0A 3HD3A 3QSDA 3FTCA 3T3NA 1ESFA 2DAJA 3LCVB 3SMPA 1D3ZA 1AWDA 1RM6C 5J18A 2XN9C 1V81A 3IAM1 1FCLA 1H4RA 2BTEA 5A24A 2JWZA 3O0UA 3QX1A 1FFVA 3DVGX 3RCZA 2KEBA 4NOOB 1PUTA 2M17A 2WSEF 2VQEM 3AXCA 4LNKA 5C1ZA 3LFYA 1JCKB 5JHBA 4MELA 2KRUA 3ZO5B 2DOSA 2AYOB 2D3BA 2GBNA 2XFTA 1WJ7A 3PFIA 2QCZA 3IXSA 3L10B 1QOFA 2C60A 4LNIA 3I01M 1SXTA 1XEEA 3EHVA 3BY4A 3QARA 1E9SA 1L7YA 2ZNVB 4RFBA 2DCAA 2CS4A 4MH8A 2LXAA 4DHZB 1ZPSA 2BDLA 1VZ6A 3ZGZA 1FXIA 1UWXA 3SBJA 2DKLA 2KTRA 3C9PA 3BPMA 2XK5B 2CKHB 4DQOC 1U9XA 3GP7A 2IY0B 3K24A 3SAUA 1F77A 4IBEA 4ICVA 2MH7A 4XR7A 2MH8A 4YYWA 2DWNA 1OKSA 2IBIA 2FT2A 5FLXS 2Y20A 1JR3A 3GQ5A 2L05A 2DC6A 1RYJA 4BS6A 2BTWA 4I4LA 3ZCBB 1ISNA 4MB7A 4KGTA 2IO2B 3M62B 1VEGA 3AECB 2ACTA 4XUIA 2QBYA 2DAIA 3FD9A 2K1FA 1KOTA 2YLMA 3KOZE 4NQLB 3GZNI 4FCWA 2DZJA 4HPLB 2PADA 3F5VA 5EQTA 2LWPA 3J7AS 3BWUD 3VHTC 1I35A 4GGQA 1PVJA 2P0RA 1JW9D 3KOXE 4ZRPA 1WM2A 1YK7A 4LGYA 4ANXA 4Q8GA 2CR5A 4ACFA 4AWJA 1WYWB 1HT1E 2Y0TA 3TSSA 3NS1A 2C9WB 3UJNA 3HVZA 4XC2A 3OF9A 3SC3A 3DDCB 3PXGA 1N60A 2TSSA 2VHSA 5FKAC 4KKIA 2XF3A 2PNSA 4US9A 1IXRC 2ZTCA 3ENEA 2R9MA 1QVRA 2V1UA 2NPTB 1AW7A 3GLGE 1L6VA 4YYVA 2G4SA 3K1JA 5I4DA 4I81A 2QSFX 1V6EA 2MW5A 2PEAA 4BBNF 1OFIA 2C9CA 4DR4M 1JWBD 1KSFX 1OGWA 3BVGA 4G50A 2OPFA 1IN5A 1NY6A 1EWMA 2EO2A 2OJRA 3RZWC 2P86A 2HWKA 2QIEB 3L26A 4JGHB 1MHWA 1POPA 2RPVA 4HDOA 1VEJA 1PM5A 3SFZA 3U6MA 2AX5A 4FHKA 2APLA 1L0VB 4QAYA 3B7ZA 2FOIC 1GMYA 1TU6A 4AXLA 2KWVB 1HJPA 1EF1A 3U7ZA 4FK5A 3OJ4B 1CJLA 4NJ7A 4D8BA 1QDQA 1YUBA 3S2AA 5LXIB 2XU4A 3QYEA 2DZOB 4MGHA 4N79A 1CV8A 1GPXA 4M0WA 3EFUA 1GLOA 3ZQJA 2JF5A 2ZPNA 3KUDB 1VJKA 4XE0A 3Q8BA 3USVA 2WU2B 2YQZA 5EXXA 1V5OA 1V1PA 3SHFA 1PYWD 1ZDXA 2VIIA 3JAMS 5GMVA 1QLBB 1KFVA 2KXEA 2AQ2B 1Y08A 1QOBA 5EXTA 2JWSA 4RGOS 4LJOB 3I3TA 4A5UA 2O6VD 1EFUB 4FLHA 1IN6A 3MTNB 5GKNA 2FRAA 3U6LA 1ZXHA 1SB3C 2GQFA 3QK0A 2KNBA 3AE2B 3KW6A 3A4SC 4BOQA 2UXBM 1XXHB 1F4IA 2Q2EB 4M8MA 1E8YA 3C9EA 1C4CA 5FTMA 4WP2A 1STEA 3AL0C 3FUUA 2A4ZA 1P1AA 2H5XA 3HJ8A 3SYKA 2G6DA 4DHJD 1N6ZA 4RH6A 2DC8A 1BUIC 1HQCA 2KTFA 3RNCC 3N30A 2R6NA 1BGOA 1HXYD 1L2CA 2JY6A 4M8NA 3IOQA 3HU3A 4HEA1 1IBXB 3L27A 1Z6TA 1C3TA 4WW0A 1LO5D 1T43A 1GUAB 1UFZA 1WMHA 2RPQA 4WJNA 2N35A 4AZFA 1NYQA 8CATA 3KW5B 3MTVA 4QNRA 3TQSA 2G3QA 3H7PA 3OLMD 3Q3OC 4QBBA 1XF5L 4M0DA 4A3VB 2W54A 1I4WA 3NOBA 4PYZA 5D6JB 4JI6M 2GFOA 3I06A 1QT9A 2NS5A 2KQ4X 4MACA 3SAVA 4LF9M 1B1ZA 1V86A 3W9CB 1IUEA 2WDQB 1PPPA 4JI5M 2RGHA 2MP2A 4G54A 2EKFA 2DAMA 2K8CA 1X9YA 1QZMA 1GLNA 1T3QA 4XWWA 2RSUA 1EE8A 4LJAA 2J7QA 1WH3A 3M95A 1UGJA 3ZJUA 4ZPXA 3CF6E 3CF0A 3GB1A 3W31A 1OTRB 2N9LA 4PYUA 2HHNA 4LGMA 4I6NB 4PT5A 2BT6A 1N62A 2X49A 2V9HA 3A9KA 1U9WA 4BOUA 6PADA 2M60A 3MK6A 2CFOA 3N3GA 3H7SA 1Q3BA 2INNE 3AE1B 3PHXA 3TWLA 1VG5A 3Q3JA 3DBHB 3UF8A 2IGGA 1TT5B 5EGWA 1I4GA 1U5IA 5EP4A 4ZHPA 3B21A 2DI0A 3MHVC 4MDKE 1WHCA 1N5XA 3FRIA 2ZJDA 3GLIE 3DOAA 4MGZE 3CF2A 1FIQA 1HZ6A 2K6QA 1YIWA 1R2ZA 2E6XA 1OQRA 3N1XC 4HXDA 2AGAA 4W5CA 1XMOM 1WRIA 1IY2A 1X1MA 1GC7A 5BYQA 2AHMA 4D81A 1Q5WB 3WXEA 2GOWA 3C58A 3URYA 5HFYA 3IT6B 3GRVA 5C2TB 2KVRA 1E8ZA 4RF1A 3LCUA 3U5ZB 4IBIA 4K7SA 3AOEC 3K9OA 2L83A 3MHHA 3BBZA 1SBBB 2L7HA 1XLOA 4M01A 3MORA 2LEKA 3U61A 1VZ7A 3W68A 3SHGB 1UUPA 2GBMA 2R62A 2I7NA 2DZIA 4DV2M 1IY0A 2L6OA 2N7JA 4JL9A 3APCA 5HI1A 4DHJB 1PRBA 2NMQA 2QZ4A 3X23A 2H7JA 3D8BA 2H1RA 3A9JA 2YR0A 3QAUA 3ZUNA 4DMXA 2BPSA 2V0GA 2I7PA 1T0YA 2OEDA 4F8CB 3DBRB 4F2LA 2CP8A 3HU2A 1IXSA 5C23A 2KDIA 2MP2B 3GLHE 4YY3M 1FEHA 5G5HA 4XDCA 4YYRA 2PVOD 3I04M 1SIJA 1NV9A 2QHOB 3LW5F 5CHVC 2YFQA 3FUXA 4JI4M 3KYDD 4PP1A 4W9CA 1ME4A 1WJNA 2JVCA 1FXTB 2WXNA 2LTUA 3KSEA 4DBGA 3KS8A 2BYFA 4URKA 1AUAA 3RVXA 4LCBA 2R9OA 2INCC 2VZKB 1DGBA 2DAEA 3EIHA 3AV8A 3RZFA 4RCOA 5JZEB 1G6JA 2UUBM 2KDFB 4MM3A 4YSYB 1S4VA 4IP3A 3VDPA 3PHUA 4I04A 5FSWA 3KKUA 2LGSA 3AN1A 4YYQA 4K0KM 2OULA 2DNFA 3SR6A 2KQSA 2ZEQA 3KQ4A 2M8SA 1KHQA 4AXMA 1CSBB 1PIPA 1VZ8A 1UNSA 2LMCA 1YQ4B 5G5GA 4R7GA 4BKTA 2LVPC 1YALA 3TL4X 2C5RA 2BYEA 1E90A 3ZTCA 4ARIA 1QYRA 1YMHE 1NSFA 4GSWA 2WU5B 3PHWB 2K8BA 5EP2A 2RDBC 1ZMUA 4AJWA 4WQMA 1S3SG 2K6BA 2BB5A 2ZTDA 2CJNA 3HHYA 2RGOA 3K8ZA 1Y8RC 1PJJA 1TIFA 3HWNA 3BK1A 5EJCA 1HZ5A 1ME3A 4OVZB 4YVAA 4N59A 1XXHE 2G1EA 4K7WA 4PCZA 2E03A 2QQ8A 1TS5A 1WR6E 2BS3B 3I5JC 1ET6A 1DGHA 1MG4A 1PGBA 2LGDA 4X6HA 3GOEA 4FULA 2DNAA 4DUZM 3DHIC 3DVNU 4BBAA 3FKYA 2GNOA 3NG0A 3PV1A 2MROB 1YSYA 2LRWA 3VXWA 4DXGA 3KX1A 2MWSB 3ZXVA 4WJPA 1WR1A 4LDTD 4K1RB 2AWTA 3HVDA 5KPZA 4OELA 4KHPM 2Z7JA 2Y5BA 3B79A 1ZMWA 2LGXA 3AE3B 3C0RB 3VRAB 5EZQA 1DOXA 3SYLA 4WJOA 1ACCA 2JYTA 3KVWA 5AZHA 3RULA 5FTLA 4LFAM 3UINB 3T1HM 3B9PA 1E5WA 5JI3E 2ZM6M 5F3WA 3A42A 2J5YA 1TGZB 3AE4B 3MFGA 4HLQA 5EXPA 4HROA 1QQRA 3IHPC 1NDDA 1NJGA 1YNTE 2G9HD 4HXDB 4DBGB 3DVNV 3RNVA 1GO5A 1KJTA 2H89B 9PAPA 1VR9A 2LHEA 3CH2X 2C0YA 4II2B 4LF4M 4GDKB 4I6LB 2YJBA 1ET9A 4IUMB 3LMMA 1WGYA 4HWYA 1ITOA 3PBHA 3UZUA 2CB5A 4I07A 3NZ3A 3L4PA 2BGFA 1CVZA 2MBOA 3RT3B 4EZJA 3I63C 4W9JA 3CSFA 1QAOA 3NRZA 3N4CA 4HCPB 2MHJA 2B3TA 3EA6A 1QUTA 1FH0A 2EKEC 3LXSA 1PXVA 1V33A 2R46A 2D7GA 2O01F 2UU9M 3L08A 4FJCA 3FYDA 2K0PA 4RM9A 4M9ZA 1KLVA 4HCNB 1TDHA 3THGA 2KDEB 1SXJE 4CQNA 4QRVA 5ITTA 1PPDA 4IOIE 3M7GA 3PRMB 3RNAC 3SFEB 3HK0A 1YVBA 2N9XA 1AARA 1TH3A 1WGLA 2DHZA 4MT5A 4G11A 2UUAM 2KK8A 4WAAA 1XCQL 3ALBA 3AEGB 4D8EA 3U61B 3TE6A 1D5XC 2GRIA 1WXSA 4C56C 3A9JB 4IM0A 3OVXA 2A5YB 2JY5A 3C19A 1CB5A 1OQYA 2YEPB 1BQIA 5C18A 3TEXA 2JZZA 3W5UB 2KVZA 3AE5B 1RRBA 3PREA 3W30A 2ASQA 2NR2A 2WHIA 3M99A 1NO1A 2K3UA 4C80A 1L0XB 4FCVA 4LJ9A 1YN4A 4JYAM 2OP3A 1UZXB 3JR5A 3PHXB 1IBKM 2GB1A 2JX5A 3AE7B 2QHOA 3EC8A 3PRPB 4GOCA 2CHWA 1TBEA 4B08A 1UF0A 3V6EB 1M6DA 2JZ3B 1ROEA 2WXJA 1IQPA 2OOAA 3NS8A 4YYSA 2WXFA 2Z8YM 2LVPA 4DDID 1CTEA 4FIPA 2LH0A 2KXJA 3H4JA 4GB9A 1IWDA 3H7DA 4GC9A 3K9OB 5IT9S 4HRSA 4IBKA 3WCQA 4A90A 4F7ZA 2GMIC 3BOWA 2KJRA 2ZNVC 1IPGA 1NY5A 2J0JA 2UYZB 2MJDA 5G55A 1OAOC 1ZMVA 2V4IB 4FD2A 1IBLM 4LNNA 3CBKA 5J17A 1K50A 2O25A 4Y28F 1LFDA 5TSSA 4BOSA 1XXGA 3DOWA 3L28A 2IGHA 5FR6A 2CHXA 5D7GA 2WXHA 3Q14C 2G8EA 2JRIA 4D80A 2FE8A 2JA2A 1YX6B 2ZVOA 2FCSA 4W9DA 5L95C 3L54A 1XWIA 1Z5SB 3PW3A 2O6VB 2ZANA 2V3PA 1IM2A 1EU4A 1TTNA 3SFDB 1ORYB 2WZJA 4IBBA 2ERCA 1V34A 1LGRA 3MJWA 1L4ZB 3C3EA 1EU3A 2NBUA 2LVQA 3QT4A 3U6PA 3AEFB 4YTMB 1PGYA 2WXGA 3EECA 1E8XA 2GHUA 5BMHA 3QQ8B 1BVSA 1KM7A 1L4DB 5MPOA 1J7AA 1G71A 3QJ3A 1DGJA 4KIKA 2E00A 2BB6A 2MRPA 4AG6A 4N6EB 4Q2JA 1WR1B 2PKOA 3R7RA 5EZSA 3W0LB 1WGHA 3A4RA 3VFDA 5H92C 2PIAA 1D4BA 3IBEA 3C0RA 2L7IA 4YWGG 4B3MM 4EOYA 3T38A 4X64M 1N75A 2F4VM 4I8OA 2F7DA 4X62M 4PP2E 2DZKA 2UUCM 1F2BA 1PJTA 4W9KA 3GLIA 1OQQA 1V92A 2KX3A 3H6NA 1DGFA 4GRIA 3SARA 2KWDA 2YEPF 2HD5B 3A1QB 2AL6A 3LXFA 2DC9A 1CPJA 3PS6A 3RNGC 4NXMM 3V05A 1GB4A 1WY8A 4REZA 3DBLB 4LZJA 2FBWB 4LNFA 2BYVE 4NAWB 4HKQA 1KF6B 3NVZA 2NQDB 3GLGA 2KAJA 1KYIA 3QYBA 2B76B 2D07B 2WNMA 3R8BA 3D8LA 2XZFA 2R4EA 2NCNA 2JU6X 3LYYA 1Y4HA 2Y21A 1OIPA 1JQJC 3H8HA 2KDLA 3PT2A 1E8WA 2ZZPB 2GLSA 3UIPB 3QJZA 4GU2A 1R5LA 2JQRB 4UDUC 3V3XA 2E3TA 1M94A 4IKGA 1JROA 1Y56A 4N4ZA 4JI2M 4LJPB 2UWQA 2W82A 2J52A 2PE9A 4QNMA 4A8XC 2P5TA 2KZSA 2J7OA 2Z3XA 3VUWA 1K82A 2XZUA 1QMYA 2VF7A 2BQQA 2CWBA 3VRBB 1NI2A 1MVKA 1Z5AA 1DV0A 1CK1A 3VTVA 2KHHA 2UU7A 1GVNA 3ZJTA 4M0WB 2C96A 2BTWB 4G4QA 3GLFB 3W1SC 2J7QC 2M0AA 4OZCA 3BOSA 3FILA 1GG3A 4WH4A 3NBIA 4NAMA 3KOYE 1W5TA 1PADA 2ZBKB 4DV0M 1TGUA 2X8AA 1OFFA 2R0IA 4NJCA 1NI3A 2WLBA 1STFE 1SXJC 3KSJA 1U9VA 4BS5A 3LB8C 3PO0A 2JQFR 3IAS1 2KLCA 2LJIA 2VHFA 2CEAA 4DMYA 2WGSA 4JI7M 3JSVB 1XC8A 2J7QB 4B7HA 2F5SA 2PLPA 1E7VA 2YJCA 2L4EA 3U60B 4KZ0A 4LZZA 3AEDB 3N20C 1JWAD 1SE9A 3KWVA 4N8WA 1N33M 1L2NA 1SE2A 4D8IA 4LFBM 2QILA 4A20A 3NZUA 3M3JA 1UM8A 1A6RA 4F1IA 1QDRA 4W9HA 2DENB 2W3RA 4RF0A 5IO9A 4IBJA 4BOZB 2DWMA 1VLBA 3GZNB 2JWUA 4GDKA 2IO3B 2LXEA 3Q3MC 1Z59A 3U4EG 3C3DA 1SGHA 4CDFB 4JQWC 5IN7A 1J09A 2BKFA 4LF5M 4TQ0A 3RFZB 4ASWC 3U6EA 4XWTA 1WZ0A 3KP1E 3V62A 2VQFM 2QC8A 3EFCA 3DA1A 4M00A 1IP9A 2XH9A 3AV0A 3LVWA 1XQQA 4W4UA 2FUDA 2N9KA 2G4DB 2FTDA 3AEAB 4NSRA 1GJTA 4PDIA 2PTLA 4D82A 2L0TA 4KDIC 3PT2B 3B89A 1F29A 4EIWA 4YTNB 3FYCA 4FADA 2F5OA 2XNAC 3B2GA 4LJ4A 2WXOA 4LJ7A 4QOSA 2QMTA 3PPAA 3KSXA 1JWUD 2JXXA 1WJ4A 1L0YB 2MBQA 4FWDA 3HU1A 3HKPA 1GJSA 3SMSA 4GIPA 1JRUA 3AU5A 4IBFA 3VKGA 2J0MA 1C4PA 3CTWB 3TIXA 1ENFA 4EUTA 2NQIA 4ITQA 2DAFA 2CIOA 1ZIVA 4CZWA 3BIID 3WAMA 1PGXA 2E01A 4OVUA 3U6SA 4Z8XA 4YHHM 1NENB 4W9IA 3OWEB 2XU1A 3HHIA 4JE3B 3UQBA 2KWUB 4E3CA 3LQRA 1D5MC 1EWCA 3V6EA 2LVAA 1PJIA 3KW9A 1L8QA 2KFJA 1GNUA 4L23A 4WJQA 5EE0A 1UD7A 5CHTA 1EWLA 5IREB 1PFDA 4JN6A 5LMNM 3R2TA 1IYFA 1AECA 2XSZA 3H6SA 5CVNB 1V9JA 2FUHB 2MX2A 2WWZA 3HJQA 4DV1M 3H8CA 4W5BA 3H89A 1DF0A 1JWMD 4OHJA 2R9FA 4IDIA 2C5LC 2XFSA 1IFYA 1NVID 5JH5C 1QZEA 1IXSB 3VK8A 1EO6A 1VDVA 1A5RA 2N9EB 2JY6B 2C7MB 4FWHA 3IMAA 4L4UA 1C76A 1YJ1A 4B3TM 4XZXA 3AI8A 1S3SA 1P98A 3U8ZA 4B7GA 4OU7A 1DGGA 1V1OA 2HE7A 5K16A 4CDEB 4GXBA 2HL7A 3ML9A 1WMHB 2AQ1B 3B2FA 2FRQA 4ZRQA 4ZRKA 3VQIA 4GMQA 1JR3D 4N9F4 1MDWA 2K6DB 3Q8CA 3VAWA 5IA7A 4K81A 4QRGA 4BAXA 1JB0F 4LTUA 1K3XA 2KJ6A 4NRVA 2EELA 5D2MB 2YVCA 1OJLA 2KMMA 2RKOA 3ILKA 2PPHA 3TEYA 5EP3A 3HX3A 1QAQA 2D3AA 3L17A 1R6BX 1R7SA 1T6BX 3CH3X 1QKZA 5KQDA 1J7BA 2QP9X 2WYQA 3IVFA 2J4XA 2J0KA 4W9FA 4AJYB 5KHOA 1OEYA 3QWZB 4BQVA 3APFA 2LGYA 2RDHA 3B9JA 2RDGA 3N1YC 3T9LA 1HEZE 3ZQ4A 1GB1A 1DYQA 4FN2A 1F2RC 4QHSA 2KNVA 4LNOA 1OTRA 1GECE 3BVZA 3MC9A 1MX0A 1RFKA 5EP1A 3BINA 3NVWA 4KSKC 4FCTA 3GLHA 2DHYA 1BT0A 1QDTA 3K8UA 2M4NA 4NAWA 2KDMA 1QXPA 2DJFB 2WXLA 1G3IA 3JSVA 4IWOA 2V6ZM 3L29A 4TQ1A 2DYOA 4YT0B 3B7QA 3FTFA 4S17A 1J8CA 2AQ3B 2F5QA 1PPNA 3DHGC 1E0ZA 2HD5A 5JA7A 2LHGA 5FPWA 4G4RA 1QILA 1MHXA 1MJGM 3T1YM 2K5PA 7PCKA 4E71A 2K9DA 3Q6BA 3ABVB 4RGTA 3HHAA 4L1BA 1NBFC 1HNXM 4LY6A 4RNAA 3HRDD 3P42A 4AS1A 2MSED 4LDTB 4C4VA 3SDLC 4D2KA 2R45A 2EKKA 2QSDA 4QOZC 1R4NI 2QCUA 1R7RA 5IOIA 1C7YA 4GIVA 3NBXX 3K9MA 2BKRB 2Z0EB 4B0EA 4KGSA 2ATOA 2EUCA 2PMVA 2R44A 1P7EA 3N1ZC 3PLVA 4JPSA 2DAGA 3DF0A 4BPVA 4KO8A 4HKZE 3WA0A 4R3DA 3R66C 5C3JB 3ZNHB 2HWJA 3OF8A 2EMTA 2Y5PA 1Q0WB 3Q2AC 1AYFA 4L8RC 4F1SA 3RD2A 4HL4A 4P16A 2LXCA 3VH3B 3P4PB 4MGYE 5ITUA 4CYEA 2NVUI 1CZPA 1AIPC 3MJ5A 1QF6A 5PADA 4IUMA 1VDLA 2YNMD 1OIZA 2WXQA 2R2OA 4TUUA 2JT4B 2UXCM 2W3SA 2ZCCA 2FNJB 3HM6X 4FVMA 2BJVA 1N78A 4M9SA 4QHTA 2CU1A 3OG5A 2WDVB 1DKIA 1G59A 1F2CA 2KMAA 2JUJA 1FD6A 4K7CA 1E6EB 2IBIB 4GLSC 1IGCA 2NQ8C 2M19A 2G8JA 1Q6KA 4WWPA 4W9EA 2VRRB 1YJIA 2AUXA 3F75A 5BMIA 3ONSA 5DCNA 3U60A 1FRRA 3GE3C 1UGMA 3E56A 3TPZA 2OO9A 2V1YA 3RNFC 2MBHA 2KOXA 2KJHB 1J19A 2KNAA 2ZW0A 3WHKA 3K9PA 1T0RC 1I4QA 1N63A 4LCDE 1K3BB 2R9NA 4EE2A 3PSEB 5E6OA 3TEWA 4LJ8A 1TY2A 4MSQB 4Z6YA 1PBHA 4XYCA 3KP0E 2ZW1A 3UGJA 3U7DA 3V61A 3V76A 3HHMA 1P9DU 1R4MB 1TS4A 5CHWA 3NUHB 3CIRB 1L6UA 4P7IA 3KWBX 4HLEA 3RI7C 2L4FA 1XKGA 2D3CA 2F5NA 3ECIA 5E6NA 5G2NA 3KOWE 5E6JA 1TH2A 2KN4A 5E6PA 2IGDA 1HQRD 4OVZA 1Z2MA 1GCBA 2KRKA 2XGNA 3Q8AA 3ZDMC 3J2PB 1IXZA 1KH0A 1FNWA 3PRZA 1EWPA 2VF8A 2REXA 3DBHI 2JQGR 1LQBA 1YD8U 1ZOYB 2BVCA 2DCCA 1TR8A 4OZAA 5CVOB 2BJWA 5DPSA 2B3AA 3A46A 2WDTB 3BXWA 1WJUA 3FRHA 4I05A 4LF7M 3WAOA 1AYVA 2K9XA 4WAFA 2RRUA 2ICIA 3I9V1 1YT7A 2FIDA 4FWGA 2VZKD 3RGPA 4II7A 5LLIA 4DV7M 2G5GX 4J6IA 4A9AA 4HK2A 1ZDVA 2Q5WD 1QQWA 2MEKA 2W55A 3Q8XA 5A2QS 2N9PC 3AMZA 1K3WA 3OVZA 3AJIB 1GL7A 1WX7A 1N5WA 2Y6EA 2ON8A 2RR9A 2Z84A 4JI3M 3RFWA 1RLFA 2LJ5A 1UKFA 1WWTA 3ZLZA 1XLPA 4EZLA 1EWOA 4GC5A 3FTDA 2C7HA 3TEZA 3Q8FA 3MHSA 4B9KA 2OJWA 2WS3B 3NHEB 5TR5A 4BBNC 2F5PA 2IO0B 4WQOB 2YJ9A 1NL6A 4XDDA 2JSVX 1BMLC 1Y8GA 3V60A 2INDC 1P7FA 2AUZA 1F0ZA 1WX8A 2SAKA 5JHAA 2O2VB 1MIRA 5H37D 1Q3CA 2KA6B 5FK9C 2L09A 2HXZA 3AEEB 5H8YE 3ZUAA 4MGKE 2WXIA 1WSPA 2Y5CA 3LQQA 3VTWA 1N77A 2FUG1 2N1WA 1JRPA 4P6VF 1MU5A 3U30A 4KLNA 4GEWA 3TJPA 1U9QX 2RMMA 4S0RA 3P5UA 3KS4A 3KFUG 3TBLD 4DR7M 2OOBA 2EMSA 1HT2E 3TMPB 4TMAB 4FW9A 4MJSA 3EGRA 2KDBA 4B7FA 2GBKA 3P4SB 2L0FA 1WIAA 4ZRIA 1VSNA 2JRIB 2XU3A 4UN2B 2HHHM 3T3OA 4IWQA 2FYEA 1C9FA 4ANRA 3AM9A 4NY0A 3ZTDA 1AU4A 1T0QC 2AVWA 4H2AA 4AKGA 2LHDA 2P7UA 3QC8B 1NV8A 1OEYJ 3J7BA 1NEKB 2X38A 1I42A 2J42A 1I4PA 3B74A 5D94A 4MGIE 1ZAEA 2CHQA 3WHLA 1BY8A 1AN8A 2LD9A 5AUKA 4DDGD 5L83A 3PNYA 2XBBC 4PD2A 2J53A 4NQKE 1L2BA 2LWXA 2L76A 2XSZD 3A45A 3MP9A 2IO1B 4MSMB 1XT9B 2KLGA 1MN3A 3KWZA 2DWZB 2D2QA 5DYGA 3IECA 4RMAA 1HR0M 2Z8LA 1V1PB 3UI3A 1WGDA 1AYUA 2G8LA 1AIMA 3AOGA 3RVWA 4AQYM 4L78A 4KDLB 4X65M 4DR3M 3PNVA 2PVGC 3KFQA 3AE6B 3ZNZB 2BYTA 2M1MA 1C78A 1S1QB 3K9PB 3P1MA 2KMCA 2VH1A 4X6JA 2FCMA 4YV8A 2HTME 3J80S 1JWSD 4KZCA 2H88B 3VK7A 5DNYA 1AU2A 2R61A 4DHZE 3PSEA 3L0WB 1C79A 3DHHC 4FJZA 3GLFE 1MEGA 3I4VA 2AU1A 4OX9M 2LBCA 2KFKB 1WGNA 3UGBB 3BCNA 3I4YA 1IN4A 2SEBD 2KZRA 4R71A 1CS8A 2JY8A 1CUKA 3JW0X 1EIJA 4MSXA 3GRYA 2KANA 4RKXA 1E9RA 1SXJB 3NY5A 2DYBA 5ITXE 4LRTA 3T15A 3RN9C 2HKJA 1V5TA 4PS8A 4B6WA 4PS3A 5EXSA 1K8RB 5KQ8A 1T5XD 3TRKA 1T3TA 1F52A 1TH4A 4PK1A 2MA9B 5IKCM 4EFOA 4LRSA 1TKYA 4MZOA 4US8A
chains in the Genus database with same CATH topology
4DUYM 2DBYA 4GKJM 1IN7A 2NTTA 3EUB2 4JI8M 3U2SC 3PRPA 2D5GA 1YE9A 5EE1A 3U52E 1NNUC 1PDXA 1B9RA 3AFHA 1QOGA 3OQCA 1W5SA 1TS2A 3ZH9B 1EM7A 1WYGA 2O5RA 1K51A 1QANA 3FTEA 1XCTL 1D6EC 3IT4B 4GUAA 4AW4A 3GO8A 4DV6M 3FUTA 4DXFA 2ZAMA 1G8PA 2K47A 5IWAM 4AQ7A 1R2YA 1N34M 2LNHC 3U6QA 1IGDA 4JWUC 2DZNB 1J5EM 1M4VA 3ETRA 4DR1M 1J7CA 3AEBB 1KFYB 4GHLA 3OTOM 2ACZB 2WXPA 4TSSA 1XLQA 3GS2A 2K22A 4AKHA 2FFJA 4LFCM 3BK2A 1TS3A 3SAWA 4W5WA 1I4HA 3ZC7B 4CHTB 3GP1A 4B0MA 1XNQM 2EKIA 4ZTBA 2DYMA 3ZJVA 2CU3A 1TJEA 4G4NA 2ZAOA 3MP2A 1VDDA 3HUIA 2D7EA 5KPTA 4CISA 4C7YA 1E7PB 4LJ6A 3O65A 2OHFA 1E9MA 1X37A 1XMQM 4BOPA 4CGYB 1I4XA 3SATA 2XEPA 1WXQA 3C8YA 4S12A 1YZBA 1G41A 5JZEA 3PZ7A 4AI6A 1KTKA 4NZLB 3DZDA 4LF6M 1QOAA 1XNRM 3DFZA 2E5LM 3HHXA 4C7ZA 2DVWB 4FXCA 1I94M 3L2AA 5EE9A 2I38A 5E26A 2L1AA 5C1BA 3H4MA 4PDGA 5KPRA 1I7HA 2UXDM 4I5SA 4TUWA 3PHWA 3K92A 2JXTA 1ZQ9A 3MC0B 3AE8B 1DOIA 3TWMA 1NHGC 3HWSA 4IJEA 3JR4A 4WIPA 1HNZM 1YQ3B 3A98B 1HQYE 2NTSA 1K53A 4AKIA 2M56B 4XBOA 2DWQA 1C1KA 3TWKA 1V97A 4KODA 3KXEC 2CV2A 1FFUA 3J27B 2DWLA 1FJGM 4HJGE 1SJED 2WDRB 3PVSA 3ZNHA 2CE7A 4M9XA 3BB7A 1LV7A 1CJEA 3GPYA 2Y3AA 2Z4RA 3BZDB 3FUVA 1SXJA 2C9OA 2JYEA 1E10A 3QWLA 3UK6A 4JXJA 4YSXB 2I2YA 1E32A 4GITA 2BS2B 2BU3A 4OZBA 1NVMA 5ITXA 3E9SA 1N32M 4O1NA 2LUMA 3O13A 3NWLA 4JI1M 3KWLA 4JWSC 4LF8M 4NRWA 4ZOHC 4N58A 1HA5A 1HNWM 3AKZA 4OW0A 3RE8A 4B3SM 2CV0A 1DO2A 1SJHD 3VLFB 5BR8M 5FTNA 5AUIA 1Q10A 4DV5M 3M0EA 2Z4SA 2QJLA 1ZUD2 4DV4M 1SXJD 2HDEA 2IPKD 1XXHA 3GPUA 2PW9A 2CJOA 1CQVA 3GRUA 1JMLA 3R9XB 2M5ZA 1XHBA 4AG5A 2L52A 1TDZA 1ZXIA 3BVMA 3BBAA 1GKIA 4YSZB 3Q69A 2C98A 3FKEA 1MHHE 4IBGA 4BB9A 4BLCA 5BMGA 1YN5A 2N0SB 4A55A 1F2RI 1IN8A 1VRAB 3J9CA 1GAQB 3U6DA 2HCBA 2J7NA 4LJ5A 5ITRA 4YXDB 2BNKA 3R8FA 2OQ4A 1FM0D 3HHZA 1MI0A 1L1TA 4MH0E 3VKHA 1SE3A 5IZ7D 3L25A 3P63A 3I51A 4J3OD 4NL4H 5D3IB 4RGNA 5LMUM 2QENA 3ZYYX 3U5ZA 5BYSA 3HHWA 1E94E 1SSNA 4DV3M 1N36M 5KO3A 2BBCA 2LGIA 5HG2A 2CHVA 1Z5BA 3K2LA 5ITQA 3IG8A 1NNJA 1TKGA 4G6ZA 1XO3A 1KLGD 1WGKA 1EWYC 4JI0M 2CUZA 3GLGB 3TUOA 5FTJA 1FNUA 4L15A 3GLIB 3GQ3A 2QPAA 1IBXA 4IIWA 1YJJA 4LLGM 3U6CA 4MM3B 2XLJA 1L5PA 2L32A 2KZUA 4BOZA 1NHWC 1FCCC 3M6AA 4L16A 2BS4B 2DXIA 2MJEA 1FNNA 4WWMA 1MPEA 4LK0M 1TYGB 2WXKA 4WURA 5ITYA 1JQ4A 7CATA 4RGMA 3IG5A 3DWMA 3J81S 3AB5A 4USAA 1I4RA 3HGIA 1Z5CA 1TKEA 3IFUA 1N61A 4MI7A 2UZJA 1UWMA 3GLFA 5T8IA 3FILB 2ONQA 4GH9A 1C77A 2R4JA 5D3DA 1FMAD 3U6OA 4NSOB 3PRMA 1SEBD 1IBMM 3KDSE 1SE4A 5GXGB 1XLNA 1K52A 2WP9B 2INPE 4JX1C 3W1SA 2MJ3A 1FNVA 2WQYB 5FR3A 1DO0A 3NVYA 2QBYB 3MHZA 4DR6M 2R65A 1OFHA 3SEBA 4ZHOA 2X4AA 4KGRA 3FC4A 3EIEA 1D2NA 1TZOA 4GHAA 3VR8B 1KLUD 2QEJC 1H6UA 1JALA 1QAMA 3W0FA 4LG2A 3TMPA 3AH7A 3P4QB 2CV1A 3R2IA 5BYRA 4JV5M 1NYRA 3E4RA 3AE9B 1L1ZA 2BW2A 2KW0A 4B3RM 3Q8EA 4A6QA 3CWIA 4ITKA 3GPPA 5FTKA 3HJSA 2FNAA 4IBCA 3GQ4A 2IDYA 3BYTB 3NVVA 3SASA 3VDUA 2LFIA 5JXVA 5BPVA 3P4RB 1KRHA 4GDLB 2C99A 1G4AE 4KKJA 1GOZA 2IJ0A 3PZ8A 1FXAA 3UMMA 4G4OA 1V8CA 3KLSX 3DWGC 1L2DA 4ARCA 4L2YA 2GI9A 1PGAA 3GRRA 3I57A 2WXMA 5DYIA 1TY0A 4GKKM 2DLBA 2CHGA 3RGSA 4KX6B 4XGIA 5JI2E 1RWSA 2Y0QA 2JTCA 2V3NA 2WXRA 4DR5M 4NXNM 5EE3A 1NJFA 4DR2M 2V1CA 3BYYB 4X66M 1FO4A 5LNK1 3LVVA 2D7HA 1ZP0B 2DHRA 2JZPA 5HHDG 1Q39A 3AOEA 4IBDA 1BXTA 1DGHB 1GL6A 1FRDA 1D5ZC 4IJFA 2R18A 2KACA 3FUWA 3W5VB 3GLHB 3N9YC 4YTPB 3VR9B 1SF0A 1C4AA 3RPFC 1A70A 3FAHA 3GPXA 3W2DA 1ZE3D 4ZYSA 1DOYA 1YN3A 1IY1A 1J7KA 2EA0A 3FTCA 3T3NA 1ESFA 3SMPA 1AWDA 1RM6C 2XN9C 3IAM1 1FCLA 2BTEA 1FFVA 2KEBA 4NOOB 1PUTA 2VQEM 1JCKB 2KRUA 2DOSA 2XFTA 3PFIA 3IXSA 1QOFA 1SXTA 1XEEA 3BY4A 1E9SA 4RFBA 4MH8A 1ZPSA 1VZ6A 3ZGZA 1FXIA 1UWXA 3SBJA 4DQOC 3GP7A 3SAUA 1F77A 4IBEA 2MH7A 2DWNA 5FLXS 2Y20A 1JR3A 3GQ5A 1RYJA 2BTWA 4I4LA 3ZCBB 4MB7A 4KGTA 3AECB 2QBYA 3FD9A 3KOZE 4FCWA 5EQTA 3BWUD 3J7AS 1PVJA 1JW9D 3KOXE 4ZRPA 4LGYA 1HT1E 2Y0TA 3TSSA 3NS1A 3UJNA 3HVZA 3SC3A 3PXGA 1N60A 2TSSA 5FKAC 4KKIA 2XF3A 4US9A 1IXRC 1QVRA 2V1UA 1AW7A 1L6VA 3K1JA 5I4DA 4I81A 1OFIA 2C9CA 4DR4M 1JWBD 1KSFX 3BVGA 2OPFA 1IN5A 1NY6A 2EO2A 2HWKA 2QIEB 3L26A 2RPVA 1PM5A 3SFZA 3U6MA 2AX5A 1L0VB 2FOIC 3U7ZA 4D8BA 1YUBA 4MGHA 2DZOB 1GPXA 4M0WA 4XE0A 1VJKA 3Q8BA 2WU2B 2YQZA 5EXXA 1V1PA 3SHFA 1PYWD 1ZDXA 2VIIA 3JAMS 1QLBB 1KFVA 2KXEA 2AQ2B 1QOBA 5EXTA 4RGOS 4A5UA 1IN6A 5GKNA 3U6LA 1ZXHA 1SB3C 3AE2B 3KW6A 4BOQA 2UXBM 1XXHB 2Q2EB 1C4CA 5FTMA 1STEA 3AL0C 3FUUA 3SYKA 3HJ8A 4RH6A 1BUIC 1HQCA 1HXYD 1L2CA 3HU3A 4HEA1 1IBXB 3L27A 1Z6TA 4WW0A 1LO5D 4AZFA 1NYQA 3MTVA 8CATA 4QNRA 3TQSA 1XF5L 4M0DA 4A3VB 2W54A 1I4WA 4JI6M 1QT9A 2KQ4X 4MACA 3SAVA 4LF9M 1B1ZA 3W9CB 1IUEA 2WDQB 4JI5M 2RGHA 1QZMA 1GLNA 1T3QA 4XWWA 1EE8A 4LJAA 2J7QA 3ZJUA 1UGJA 4ZPXA 3CF6E 3CF0A 3GB1A 3W31A 2N9LA 4LGMA 4PT5A 2BT6A 1N62A 2X49A 4BOUA 2M60A 3MK6A 2CFOA 1Q3BA 2INNE 3AE1B 3PHXA 3TWLA 2IGGA 1I4GA 3B21A 5EP4A 4ZHPA 3MHVC 1N5XA 3DOAA 4MGZE 3CF2A 1FIQA 1HZ6A 1R2ZA 2E6XA 1OQRA 2AGAA 1XMOM 1WRIA 1IY2A 5BYQA 2AHMA 4D81A 3C58A 3URYA 5HFYA 3IT6B 3GRVA 5C2TB 4RF1A 3U5ZB 4IBIA 3AOEC 2L83A 1SBBB 2L7HA 1XLOA 2LEKA 3U61A 1UUPA 3SHGB 1VZ7A 2R62A 2I7NA 4DV2M 1IY0A 2L6OA 2N7JA 5HI1A 2NMQA 2QZ4A 3D8BA 2H1RA 2YR0A 3QAUA 2V0GA 2I7PA 2OEDA 3HU2A 4YY3M 1FEHA 5G5HA 4XDCA 2PVOD 1SIJA 2YFQA 3FUXA 4JI4M 2WXNA 3KS8A 4LCBA 2VZKB 1DGBA 3EIHA 3AV8A 4RCOA 2UUBM 4YSYB 4IP3A 3VDPA 3PHUA 5FSWA 3AN1A 4K0KM 3SR6A 3KQ4A 1VZ8A 1UNSA 2LMCA 1YQ4B 5G5GA 4R7GA 3TL4X 2C5RA 4ARIA 1QYRA 1YMHE 1NSFA 2WU5B 5EP2A 4WQMA 2BB5A 2CJNA 3HHYA 2RGOA 3K8ZA 1PJJA 3BK1A 5EJCA 1HZ5A 4OVZB 4N59A 2G1EA 4PCZA 1TS5A 2BS3B 1ET6A 1DGHA 1PGBA 4DUZM 4BBAA 1YSYA 4DXGA 3HVDA 5KPZA 4KHPM 2Z7JA 3AE3B 5EZQA 3VRAB 1DOXA 3SYLA 1ACCA 2JYTA 3KVWA 5FTLA 4LFAM 3T1HM 3B9PA 5JI3E 2ZM6M 5F3WA 3A42A 4HROA 3AE4B 3MFGA 4HLQA 5EXPA 1QQRA 1NJGA 1YNTE 2G9HD 4HXDB 3RNVA 2H89B 1VR9A 2LHEA 4LF4M 4GDKB 1ET9A 3LMMA 3UZUA 3NZ3A 3L4PA 3NRZA 1QAOA 3EA6A 2R46A 2D7GA 2UU9M 3FYDA 2K0PA 4M9ZA 1TDHA 3THGA 4CQNA 1SXJE 5ITTA 4IOIE 3M7GA 3SFEB 1TH3A 4MT5A 2UUAM 1XCQL 3AEGB 4D8EA 3U61B 3TE6A 1D5XC 2GRIA 4C56C 2A5YB 2YEPB 5C18A 3TEXA 3W5UB 3AE5B 3W30A 2K3UA 4C80A 1L0XB 4FCVA 4LJ9A 1YN4A 4JYAM 3JR5A 1IBKM 2GB1A 2JX5A 3AE7B 4B08A 1ROEA 2WXJA 1IQPA 2WXFA 2LH0A 4GC9A 5IT9S 4HRSA 4IBKA 3WCQA 4A90A 1NY5A 2MJDA 2V4IB 4FD2A 1IBLM 1K50A 5TSSA 4BOSA 1XXGA 3L28A 2IGHA 5D7GA 2WXHA 2JRIA 4D80A 2FE8A 2JA2A 1XWIA 2ZANA 2V3PA 1IM2A 1EU4A 3SFDB 1ORYB 4IBBA 2ERCA 1L4ZB 1EU3A 3U6PA 3AEFB 4YTMB 2WXGA 5BMHA 1L4DB 5MPOA 1J7AA 1DGJA 2BB6A 4AG6A 4N6EB 4Q2JA 2PKOA 5EZSA 3W0LB 3VFDA 5H92C 2PIAA 1D4BA 3C0RA 2L7IA 4YWGG 4B3MM 3T38A 4X64M 1N75A 2F4VM 4I8OA 4X62M 2UUCM 3GLIA 1OQQA 1DGFA 4GRIA 3SARA 2KWDA 2YEPF 3LXFA 4NXMM 3V05A 1GB4A 4REZA 4LZJA 2FBWB 4NAWB 4HKQA 1KF6B 3NVZA 3GLGA 2KAJA 1KYIA 2B76B 2WNMA 3R8BA 3D8LA 2XZFA 2R4EA 3LYYA 2JU6X 2Y21A 3H8HA 1JQJC 3PT2A 4UDUC 2JQRB 3V3XA 2E3TA 4IKGA 1JROA 1Y56A 4JI2M 2W82A 2J52A 4QNMA 4A8XC 2P5TA 2KZSA 2J7OA 2Z3XA 1K82A 2XZUA 3VRBB 1MVKA 1Z5AA 1CK1A 3ZJTA 1GVNA 2C96A 2BTWB 4G4QA 3GLFB 2J7QC 2M0AA 4OZCA 3BOSA 3FILA 4WH4A 4NAMA 3NBIA 3KOYE 1W5TA 2ZBKB 4DV0M 1TGUA 2X8AA 1OFFA 4NJCA 1NI3A 2WLBA 1SXJC 3KSJA 3LB8C 3PO0A 3IAS1 2LJIA 2CEAA 4JI7M 1XC8A 4B7HA 2F5SA 2PLPA 3U60B 4LZZA 3AEDB 1JWAD 4D8IA 3KWVA 1N33M 1SE2A 4LFBM 2QILA 1UM8A 2W3RA 4RF0A 4IBJA 2DWMA 1VLBA 2JWUA 2LXEA 3U4EG 1Z59A 1J09A 4LF5M 4TQ0A 3RFZB 3U6EA 4XWTA 3KP1E 2VQFM 3DA1A 2XH9A 3AV0A 3LVWA 2N9KA 3AEAB 4NSRA 4PDIA 2PTLA 4D82A 4EIWA 4YTNB 3FYCA 2F5OA 2XNAC 3B2GA 4LJ4A 2WXOA 4LJ7A 4QOSA 2QMTA 3KSXA 1JWUD 1L0YB 4FWDA 3HU1A 3HKPA 3SMSA 4GIPA 4IBFA 3VKGA 1C4PA 3CTWB 1ENFA 4ITQA 3BIID 1PGXA 3U6SA 4Z8XA 4YHHM 1NENB 3OWEB 4JE3B 3LQRA 1D5MC 1EWCA 1PJIA 1L8QA 4L23A 5EE0A 5IREB 1PFDA 4JN6A 5LMNM 3R2TA 2XSZA 3HJQA 4DV1M 1JWMD 4OHJA 4IDIA 2XFSA 1NVID 3VK8A 1IXSB 1VDVA 4FWHA 4L4UA 1C76A 4XZXA 4B3TM 1S3SA 4B7GA 4OU7A 1DGGA 1V1OA 2HL7A 2AQ1B 3B2FA 4ZRQA 3VQIA 4GMQA 1JR3D 3Q8CA 4LTUA 1K3XA 4NRVA 2EELA 1OJLA 2KMMA 2RKOA 3ILKA 3TEYA 5EP3A 1QAQA 1R6BX 1R7SA 1T6BX 1QKZA 5KQDA 1J7BA 2QP9X 2J4XA 2RDHA 3B9JA 2RDGA 1HEZE 3ZQ4A 1GB1A 1DYQA 1F2RC 4QHSA 3BVZA 1MX0A 1RFKA 5EP1A 3NVWA 4FCTA 3GLHA 2KDMA 2WXLA 1G3IA 2V6ZM 3L29A 4TQ1A 2DYOA 4YT0B 3FTFA 2AQ3B 2F5QA 1E0ZA 4G4RA 1QILA 1MHXA 3T1YM 2K5PA 3ABVB 4RGTA 4L1BA 1HNXM 4LY6A 4RNAA 3HRDD 3P42A 4AS1A 4D2KA 2R45A 2QSDA 4QOZC 2QCUA 1R7RA 4B0EA 4KGSA 2EUCA 2PMVA 1P7EA 4JPSA 4KO8A 4HKZE 4R3DA 5C3JB 2Y5PA 1AYFA 4L8RC 4HL4A 4P16A 3P4PB 4MGYE 5ITUA 1CZPA 3MJ5A 1QF6A 4IUMA 2YNMD 2WXQA 2UXCM 2W3SA 4FVMA 2BJVA 1N78A 4M9SA 4QHTA 2WDVB 1DKIA 1G59A 1FD6A 1E6EB 4GLSC 1IGCA 2NQ8C 2M19A 1YJIA 5BMIA 3U60A 1FRRA 3E56A 3TPZA 2ZW0A 3WHKA 1I4QA 1N63A 4EE2A 3TEWA 4LJ8A 1TY2A 4Z6YA 3KP0E 2ZW1A 3UGJA 1TS4A 3NUHB 3CIRB 1L6UA 2F5NA 3KOWE 5E6JA 1TH2A 2KN4A 2IGDA 1HQRD 4OVZA 2KRKA 2XGNA 3Q8AA 3J2PB 1IXZA 1KH0A 1FNWA 1ZOYB 4OZAA 2BJWA 3A46A 4LF7M 2K9XA 4WAFA 2ICIA 3I9V1 4FWGA 2VZKD 3RGPA 4II7A 4DV7M 2G5GX 4A9AA 1ZDVA 2Q5WD 1QQWA 2MEKA 2W55A 3Q8XA 5A2QS 3AMZA 1K3WA 3AJIB 1GL7A 1N5WA 2ON8A 2Z84A 4JI3M 3RFWA 1UKFA 1WWTA 1XLPA 4GC5A 3FTDA 3TEZA 3Q8FA 2WS3B 2F5PA 4XDDA 2JSVX 1BMLC 1P7FA 1F0ZA 2SAKA 5H37D 1Q3CA 2KA6B 5FK9C 2L09A 3AEEB 5H8YE 4MGKE 2WXIA 1WSPA 2Y5CA 3LQQA 1N77A 2FUG1 1JRPA 4P6VF 1MU5A 4KLNA 2RMMA 3KS4A 3KFUG 4DR7M 1HT2E 4TMAB 4FW9A 3EGRA 4B7FA 3P4SB 2HHHM 3T3OA 1C9FA 3AM9A 4H2AA 4AKGA 2LHDA 3J7BA 1NEKB 2X38A 2J42A 1I4PA 4MGIE 1ZAEA 2CHQA 3WHLA 1AN8A 5AUKA 3PNYA 4PD2A 2J53A 1L2BA 2LWXA 2XSZD 3A45A 3MP9A 2DWZB 5DYGA 1HR0M 2Z8LA 1V1PB 3UI3A 2G8LA 3AOGA 4AQYM 4L78A 4X65M 4DR3M 3PNVA 2PVGC 3AE6B 2BYTA 1C78A 3P1MA 2HTME 3J80S 1JWSD 2H88B 3VK7A 5DNYA 2R61A 3PSEA 1C79A 3I4VA 4OX9M 3I4YA 1IN4A 2SEBD 3GRYA 4RKXA 1E9RA 1SXJB 5ITXE 4LRTA 3T15A 2HKJA 5EXSA 5KQ8A 1T5XD 3TRKA 1T3TA 1TH4A 4LRSA 1TKYA 4US8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KO3 A;  3MJ5 A;  4MM3 B;  4R3D A;  4OW0 A;  4M0W A;  4OVZ A;  4RF1 A;  4PT5 A;  4RF0 A;  4REZ A;  5E6J A;  4P16 A;  2FE8 A;  4OVZ B;  3MP2 A;  3E9S A;  4WUR A;  4RNA A; 
#chains in the Genus database with same CATH topology
 1TF0 B;  4RM8 A;  4DUY M;  1UEL A;  2DBY A;  1VCB A;  4WWO A;  4GKJ M;  1AU0 A;  1IN7 A;  2NTT A;  3EUB 2;  4JI8 M;  3U2S C;  3PRP A;  2D5G A;  1YE9 A;  5EE1 A;  2JP7 A;  4KSL C;  4BOS C;  3IEJ A;  1T6O A;  3T8M A;  1E7U A;  4G3X B;  3U52 E;  1NNU C;  1PDX A;  3L13 A;  1B9R A;  4BVU C;  3AFH A;  1QOG A;  3OQC A;  4PS7 A;  1W5S A;  1TS2 A;  3ZH9 B;  1EM7 A;  1WYG A;  3TCA A;  2O5R A;  1K51 A;  3PGE A;  5BO4 B;  1QAN A;  3FTE A;  1XCT L;  2PE6 B;  4BZA A;  1D6E C;  3IT4 B;  2CRU A;  4GUA A;  4AW4 A;  3GO8 A;  4DV6 M;  2KC1 A;  3FUT A;  4Q7J A;  3DCG A;  4TV3 A;  3IHP A;  4IM2 A;  4DXF A;  2ZAM A;  2V4L A;  1G8P A;  2JZ1 A;  2K47 A;  5IWA M;  4EZK A;  3VTU A;  3T6P A;  4AQ7 A;  1R2Y A;  1N34 M;  2LNH C;  3U6Q A;  1IGD A;  2C7N B;  4P1C C;  4JWU C;  2DZN B;  1AU3 A;  2MJ5 B;  1J5E M;  3LDZ E;  1SIF A;  1M4V A;  3ETR A;  4DR1 M;  3SU8 X;  1J7C A;  2K8H A;  3AEB B;  4FA6 A;  2N4F A;  2I1K A;  1KFY B;  4HVB A;  4IC7 B;  4GHL A;  2DAK A;  2AEH A;  2NBW B;  3VUY A;  4WA6 A;  3OTO M;  2HJ8 A;  3RMK C;  3VFK A;  2ACZ B;  2JXN A;  2WXP A;  2MR9 A;  4TSS A;  2O6V A;  1XLQ A;  3GS2 A;  2K22 A;  4AKH A;  1YOV B;  5LXH A;  2FFJ A;  4LFC M;  3BK2 A;  1TS3 A;  3Q3N C;  3SAW A;  3NJT A;  3APD A;  4W5W A;  1I4H A;  1D0K A;  3ZDT A;  1Q02 A;  3R7Q A;  3ZC7 B;  3JVZ X;  2ZPY A;  4G0N B;  4CHT B;  2GBJ A;  1AYW A;  3GP1 A;  4B0M A;  1XNQ M;  2EKI A;  1O0E A;  4ZTB A;  2DYM A;  1Q1O A;  2MQJ A;  3ZJV A;  2CU3 A;  4W9L A;  4IWP A;  1TJE A;  2KKC A;  4G4N A;  3V6C A;  1J0G A;  2ZAO A;  3MP2 A;  1VDD A;  3HUI A;  2D7E A;  2DCB A;  5KPT A;  4CIS A;  4C7Y A;  2RGF A;  3NZS A;  4BKS D;  3A1Q A;  3SHQ A;  1E7P B;  4LJ6 A;  3ZNG C;  1EUV B;  4JIO U;  2LVN C;  3O65 A;  2XK5 A;  2OHF A;  1E9M A;  3WAL A;  1YLA A;  1X37 A;  1XMQ M;  4BOP A;  1MS6 A;  4CGY B;  4OVV A;  2KHW B;  1I4X A;  1VQ1 A;  3SAT A;  2XEP A;  1WXQ A;  3ZVV A;  3C8Y A;  1YK8 A;  3DBR I;  4BKG A;  4S12 A;  1YZB A;  3P5X A;  1G41 A;  5JZE A;  3PZ7 A;  4AI6 A;  1KTK A;  4NZL B;  1XB2 B;  1D0L A;  2BWE S;  3DZD A;  2ZCB A;  4LF6 M;  1QOA A;  2N7E A;  1XNR M;  1ZV1 A;  4P1B C;  4Q8H A;  3DFZ A;  2E5L M;  2HH5 A;  3R3M A;  3HHX A;  4HPM B;  3RNB C;  4C7Z A;  5DFL A;  4MEM A;  2DVW B;  4FXC A;  3KUC B;  1I94 M;  3L2A A;  3BY4 B;  3B0A A;  5EE9 A;  2OZ2 A;  1UBI A;  2I38 A;  4PI3 A;  2QNJ A;  3HIZ A;  5E26 A;  2L1A A;  2N1V A;  4ZYN A;  5C1B A;  3IFW B;  3H4M A;  4PDG A;  5KPR A;  1I7H A;  3F92 A;  5AZG A;  2UXD M;  1NLJ A;  1WZ3 A;  4I5S A;  4TUW A;  3PHW A;  3QAQ A;  2JNH A;  2AYO A;  2LI5 A;  3O1G A;  3K92 A;  1WXA A;  1SP4 B;  4P6E A;  2JXT A;  1ZQ9 A;  5DPR A;  3MC0 B;  3AE8 B;  3DVG Y;  3X0W A;  1DOI A;  3ZKJ C;  3TWM A;  4CDC B;  4KT0 F;  1NHG C;  3MHS D;  4KVG B;  3HWS A;  3GE8 C;  4IJE A;  3JR4 A;  4WIP A;  4CDD B;  1HNZ M;  3QA8 A;  2AS8 A;  1YQ3 B;  3A98 B;  1HQY E;  2VH2 A;  2D10 A;  2NTS A;  1K53 A;  3DBS A;  3S3Q A;  2WSF F;  4AKI A;  1XD3 B;  1WE7 A;  2M56 B;  4XBO A;  2DWQ A;  3DPD A;  1C1K A;  3TWK A;  2K39 A;  1V97 A;  4KOD A;  2D11 A;  3KXE C;  2CV2 A;  3H8B A;  1FFU A;  3DBL I;  3J27 B;  2DWL A;  3PDF A;  1FJG M;  4K7U A;  4YYU A;  1V49 A;  4P17 A;  4K3C A;  4HJG E;  1SJE D;  3SD5 A;  2NQA A;  2MGW A;  4ANU A;  2WDR B;  3HY5 A;  3PVS A;  3ZNH A;  2CE7 A;  4IW0 A;  4M9X A;  3BB7 A;  4E74 A;  1LV7 A;  1SNK A;  1OAI A;  2M0X A;  1PJS A;  1CJE A;  3GPY A;  2Y3A A;  2Z4R A;  3BZD B;  3FUV A;  1SXJ A;  2KN5 A;  4WWN A;  2GBR A;  2WBF X;  1HE8 A;  2YJ2 A;  2C9O A;  3RVV A;  2JYE A;  1E10 A;  2LVQ D;  3QWL A;  3UK6 A;  4JXJ A;  3Q8G A;  3ZNI D;  3RUI B;  1WXV A;  4HJK A;  4YSX B;  2I2Y A;  4EKU A;  1E32 A;  3B1L X;  1QUS A;  4OEM A;  4GIT A;  2BS2 B;  3KUZ A;  4BKS A;  2BU3 A;  2R2Q A;  4OZB A;  1NVM A;  5ITX A;  3E9S A;  2JY7 A;  2WX1 A;  1N32 M;  4O1N A;  2LUM A;  1DEU A;  2KTR B;  3H9D A;  1V80 A;  3NWL A;  3O13 A;  2BDZ A;  3DQV A;  2DJG B;  4JI1 M;  4CJ6 A;  1PCI A;  3KWL A;  4JWS C;  1D0M A;  4LF8 M;  4NRW A;  1ZCM A;  1HUC B;  4IM3 A;  4P6G A;  4ZOH C;  4N58 A;  4X6I A;  1HA5 A;  2G3Q B;  3H7P B;  1HNW M;  5F02 A;  2AL3 A;  2IY1 B;  3V6C B;  3AKZ A;  4ICU A;  1WI0 A;  4OW0 A;  3CGW A;  1A5T A;  3RE8 A;  2L3Z A;  4B3S M;  2CV0 A;  1NQC A;  3E1Z B;  1KFU L;  1DO2 A;  1SJH D;  3VLF B;  3ERV A;  4ANW A;  5J2R A;  5BR8 M;  1EF7 A;  2FO5 A;  2XU5 A;  4DWF A;  4KLB A;  5FTN A;  4AOF A;  2PJH A;  5AUI A;  1Q10 A;  2EJS A;  3UQA A;  1JQP A;  4DV5 M;  3M0E A;  3UIO B;  4BSQ A;  2Z4S A;  1MG8 A;  2QJL A;  1ZUD 2;  2FCQ A;  2MBB B;  4DV4 M;  4XX5 A;  1SXJ D;  3HM3 A;  1F9J A;  2HAK A;  2HDE A;  2IPK D;  1XXH A;  2IYD B;  1VJV A;  5HKH A;  1R4N B;  2X8X X;  3A9K B;  3GPU A;  4C4V B;  4W9G A;  5IAA C;  3TNX A;  3I3T B;  2PW9 A;  2L7R A;  1CMX B;  2Z59 B;  2CJO A;  2F1G A;  2IZV B;  2N7D A;  2FH0 A;  1CQV A;  3GRU A;  1JML A;  3R9X B;  3W67 A;  1TL9 A;  3PLU A;  2O6X A;  2CHZ A;  2M5Z A;  1THE A;  1XHB A;  4AG5 A;  3ZRC A;  2L52 A;  1TDZ A;  2LVO C;  1ZXI A;  4HDQ A;  5DPT A;  5JH3 A;  3BVM A;  1WFY A;  1KXR A;  1GKI A;  3BBA A;  1PE6 A;  4YSZ B;  3Q69 A;  2C98 A;  4XGA B;  3FKE A;  1MHH E;  4IBG A;  4K3B A;  4BB9 A;  4BLC A;  4TKN A;  1YN5 A;  2N0S B;  5BMG A;  2DZM A;  3N3K A;  4DK5 A;  4A55 A;  1RFA A;  1F2R I;  1IN8 A;  3IG3 A;  1VRA B;  2BWF A;  3J9C A;  3VUX A;  3W1Y A;  1TLO A;  3WXG A;  1GAQ B;  3U6D A;  2JZ0 A;  2HCB A;  2FS1 A;  2MCN B;  3D6S A;  2J7N A;  4LJ5 A;  1U4A A;  5ITR A;  1WM3 A;  3P2B A;  4YXD B;  2BNK A;  2KO3 A;  3R8F A;  2OQ4 A;  4M02 A;  1P3Q Q;  1FM0 D;  2K0B X;  3HHZ A;  1MI0 A;  1L1T A;  2BF8 B;  3CMM B;  3OJ3 A;  4GMV A;  4MH0 E;  1NB3 A;  4G3O A;  3VKH A;  1KFX L;  4YL8 A;  3N32 A;  1F2A A;  1SE3 A;  1LXD A;  5IZ7 D;  3MMP A;  4MJS B;  3L25 A;  2Z0D B;  3P63 A;  3IV2 A;  3I51 A;  3H1U A;  1ZW7 A;  4J3O D;  4NL4 H;  4QRX A;  5D3I B;  4RGN A;  2LHC A;  2QEN A;  5LMU M;  3ZYY X;  3PVL A;  3U5Z A;  2W9N A;  2B1M A;  3LJ3 A;  5BYS A;  3HHW A;  3KH0 A;  1E94 E;  1PQS A;  1SSN A;  4DV3 M;  1N36 M;  5KO3 A;  2MLB A;  4X57 B;  2MBE A;  2BBC A;  3GCB A;  2LGI A;  4NNJ B;  5HG2 A;  2CHV A;  4MZS A;  1WGG A;  2FAZ A;  4BFR A;  2ZVN A;  4FJY A;  2DC7 A;  1Z5B A;  3K2L A;  5ITQ A;  3IG8 A;  1VD2 A;  4RKU F;  1NNJ A;  1TKG A;  4G6Z A;  1WRD B;  4GDL A;  1XO3 A;  2FQ9 A;  1KLG D;  1WGK A;  2B1N A;  1EWY C;  3P5V A;  4JI0 M;  5AZF A;  2DEN A;  3D32 A;  2AIM A;  2CUZ A;  3GLG B;  3TUO A;  5FTJ A;  2HTH A;  1FNU A;  1WX9 A;  1RU3 A;  4L15 A;  4NPN A;  2FCN A;  3GLI B;  2AYN A;  3GQ3 A;  2QPA A;  1IBX A;  1CQD A;  4IIW A;  1YJJ A;  4LLG M;  2R6F A;  3U6C A;  4MM3 B;  1P3Q U;  2G45 B;  2XLJ A;  1L5P A;  2L32 A;  2LVO A;  2KZU A;  3TL5 A;  1UH6 A;  1NHW C;  5CHF A;  4BOZ A;  2XEW A;  1FCC C;  3S3R A;  3M6A A;  3RNE C;  4L16 A;  2KFK A;  2BS4 B;  3U8E A;  2WSC F;  1ZKH A;  2DXI A;  1QOL A;  2D3G A;  2LZ6 A;  1HTQ A;  3N3K B;  3PNR A;  2ARY A;  2MJE A;  4A3P A;  1FNN A;  4WWM A;  1MPE A;  4LK0 M;  1TYG B;  2WXK A;  3WAN A;  3A33 B;  3AU4 A;  3B08 A;  4WUR A;  3ZXR A;  5ITY A;  1JQ4 A;  1ICF A;  7CAT A;  1ATK A;  4RGM A;  3IG5 A;  2JUO A;  2L00 B;  3HZJ A;  2BWB A;  3DWM A;  3B7N A;  4C00 A;  3NHE A;  3J81 S;  2NQG A;  3AB5 A;  1GAB A;  4USA A;  1I4R A;  3HGI A;  1Z5C A;  1TKE A;  3IFU A;  4L6V 6;  4II3 B;  1N61 A;  2JPH A;  4MI7 A;  1PPO A;  2UZJ A;  1UWM A;  3GLF A;  2KNZ A;  5T8I A;  3FIL B;  2ONQ A;  4GH9 A;  1C77 A;  1WF9 A;  2R4J A;  5D3D A;  1GJZ A;  1FMA D;  3U6O A;  5CVM A;  2FIF A;  2O2V A;  4NSO B;  3KYC D;  1SEB D;  1KHP A;  1IBM M;  2DCD A;  3PRM A;  3ZW3 A;  3KDS E;  1SE4 A;  4AP4 C;  3L16 A;  5GXG B;  3ZRF A;  1NPZ A;  1XLN A;  1WGR A;  2DX5 B;  4FBJ B;  1K52 A;  2WP9 B;  3QIJ A;  4CO7 A;  2JRH A;  3VDZ A;  2INP E;  2KYW A;  4JX1 C;  3W1S A;  2MJ3 A;  2OOB B;  1FNV A;  3Q3F A;  2WQY B;  5FR3 A;  1DO0 A;  2L8J A;  3NVY A;  3KVF B;  3WIM A;  3P5W A;  2QBY B;  2RD0 A;  3MHZ A;  4DR6 M;  2R65 A;  1OFH A;  3SEB A;  4ZHO A;  2KC2 A;  2X4A A;  5DPW A;  1GC6 A;  5CTR C;  3AUL A;  1LTM A;  4KV2 A;  4KGR A;  4A3O A;  1HTO A;  3FC4 A;  8PCH A;  2I1J A;  3EIE A;  1D2N A;  1TZO A;  5J94 A;  3VH4 B;  4GHA A;  4ZUX U;  3VR8 B;  1KLU D;  2QEJ C;  1H6U A;  1JAL A;  1QAM A;  3W0F A;  4LG2 A;  1TZ1 A;  2KT7 A;  1BP4 A;  3TMP A;  3RYT A;  3AH7 A;  1WE6 A;  5CX3 A;  3P4Q B;  2CV1 A;  3R2I A;  5AEK B;  5BYR A;  4JV5 M;  2KWC A;  3MC8 A;  1NYR A;  2K25 A;  3E4R A;  2BWE A;  1V2Y A;  2DZY A;  3E46 A;  3AE9 B;  2L2D A;  1L1Z A;  1T0S C;  2BW2 A;  4JLC A;  2KW0 A;  3E21 A;  3FE3 A;  2KD0 A;  4B3R M;  3Q8E A;  4B95 A;  4RY2 A;  4A6Q A;  3CWI A;  4ITK A;  2KQ7 A;  2QDF A;  1SG9 A;  4ANV A;  3GPP A;  3WXF A;  5FTK A;  3HJS A;  5EDS A;  2FNA A;  4IBC A;  3GQ4 A;  2IDY A;  3BYT B;  2IPP B;  2HJ1 A;  1YQB A;  3NVV A;  3SAS A;  3VDU A;  2A5U A;  2LFI A;  5JXV A;  1H8C A;  3BC3 A;  5BPV A;  3P4R B;  1KRH A;  4GDL B;  2C99 A;  1G4A E;  4KKJ A;  4AUQ C;  5CHV A;  1GOZ A;  4CHK A;  2WX0 A;  2IJ0 A;  3PZ8 A;  5L8R F;  1FXA A;  3AI5 A;  2KX0 A;  3ZIM A;  3UMM A;  2NPT A;  4G4O A;  1V8C A;  3OAW A;  4HEO A;  1VEK A;  1FPY A;  1C1Y B;  4I6P A;  3KLS X;  3DWG C;  1ZGU B;  4ZDV A;  1L2D A;  4DXA B;  4ARC A;  4EEW A;  4L2Y A;  2GI9 A;  3PZD A;  3PTF C;  3IUT A;  1UBQ A;  2G7Y A;  1PGA A;  2DZZ A;  3GRR A;  3I57 A;  5IP4 D;  3CBJ A;  2WXM A;  4FHJ A;  5DYI A;  1TY0 A;  4PAD A;  1MFW A;  1R4M I;  4GKK M;  2DLB A;  2CHG A;  3RGS A;  4KX6 B;  5KHQ A;  4XGI A;  3QHT A;  5JI2 E;  4GN1 A;  2PBH A;  2PRE A;  1RWS A;  2Y0Q A;  4ZRJ A;  2JTC A;  1PJQ A;  2V3N A;  2WXR A;  2NBV B;  4DR5 M;  1P0R A;  4NXN M;  5EE3 A;  1NJF A;  3ML8 A;  4DR2 M;  2V1C A;  3BYY B;  4X66 M;  2E02 A;  1FO4 A;  5LNK 1;  3LVV A;  2YJ8 A;  2D7H A;  1LM8 B;  4HPP A;  1ZP0 B;  2DHR A;  2JZP A;  5HHD G;  1MJD A;  1Q39 A;  3AOE A;  1YX5 B;  2LRU A;  4IBD A;  2Y5B B;  4CIZ A;  1BXT A;  1DGH B;  2V3S A;  1GL6 A;  1FRD A;  1D5Z C;  1WXM A;  3WAP A;  4IJF A;  3BWK A;  4QH6 A;  2R18 A;  1JR3 E;  2KAC A;  3FUW A;  3W5V B;  3JYU A;  3GLH B;  3N9Y C;  4IG7 B;  4NC6 A;  2LAS A;  3OIS A;  5EF4 A;  4YTP B;  3VR9 B;  2VDB B;  1RAX A;  1SF0 A;  1C4A A;  3VVW B;  3RPF C;  3O65 B;  4FJV B;  1WJ6 A;  1A70 A;  3FAH A;  1EF5 A;  3GPX A;  4XK8 F;  4KIK B;  3QCA A;  1TTE A;  3W2D A;  3BPF A;  1ZE3 D;  4ZYS A;  1R4G A;  1DOY A;  4XZ4 A;  1YN3 A;  1WIV A;  3CST A;  1MEM A;  1IY1 A;  2LUE A;  2DZL A;  3MTN A;  3M63 B;  1F1H A;  4NJ6 A;  1J7K A;  2R9C A;  1NB5 A;  4HWI B;  2EA0 A;  3HD3 A;  3QSD A;  3FTC A;  3T3N A;  1ESF A;  2DAJ A;  3LCV B;  3SMP A;  1D3Z A;  1AWD A;  1RM6 C;  5J18 A;  2XN9 C;  1V81 A;  3IAM 1;  1FCL A;  1H4R A;  2BTE A;  5A24 A;  2JWZ A;  3O0U A;  3QX1 A;  1FFV A;  3DVG X;  3RCZ A;  2KEB A;  4NOO B;  1PUT A;  2M17 A;  2WSE F;  2VQE M;  3AXC A;  4LNK A;  5C1Z A;  3LFY A;  1JCK B;  5JHB A;  4MEL A;  2KRU A;  3ZO5 B;  2DOS A;  2AYO B;  2D3B A;  2GBN A;  2XFT A;  1WJ7 A;  3PFI A;  2QCZ A;  3IXS A;  3L10 B;  1QOF A;  2C60 A;  4LNI A;  3I01 M;  1SXT A;  1XEE A;  3EHV A;  3BY4 A;  3QAR A;  1E9S A;  1L7Y A;  2ZNV B;  4RFB A;  2DCA A;  2CS4 A;  4MH8 A;  2LXA A;  4DHZ B;  1ZPS A;  2BDL A;  1VZ6 A;  3ZGZ A;  1FXI A;  1UWX A;  3SBJ A;  2DKL A;  2KTR A;  3C9P A;  3BPM A;  2XK5 B;  2CKH B;  4DQO C;  1U9X A;  3GP7 A;  2IY0 B;  3K24 A;  3SAU A;  1F77 A;  4IBE A;  4ICV A;  2MH7 A;  4XR7 A;  2MH8 A;  4YYW A;  2DWN A;  1OKS A;  2IBI A;  2FT2 A;  5FLX S;  2Y20 A;  1JR3 A;  3GQ5 A;  2L05 A;  2DC6 A;  1RYJ A;  4BS6 A;  2BTW A;  4I4L A;  3ZCB B;  1ISN A;  4MB7 A;  4KGT A;  2IO2 B;  3M62 B;  1VEG A;  3AEC B;  2ACT A;  4XUI A;  2QBY A;  2DAI A;  3FD9 A;  2K1F A;  1KOT A;  2YLM A;  3KOZ E;  4NQL B;  3GZN I;  4FCW A;  2DZJ A;  4HPL B;  2PAD A;  3F5V A;  5EQT A;  2LWP A;  3J7A S;  3BWU D;  3VHT C;  1I35 A;  4GGQ A;  1PVJ A;  2P0R A;  1JW9 D;  3KOX E;  4ZRP A;  1WM2 A;  1YK7 A;  4LGY A;  4ANX A;  4Q8G A;  2CR5 A;  4ACF A;  4AWJ A;  1WYW B;  1HT1 E;  2Y0T A;  3TSS A;  3NS1 A;  2C9W B;  3UJN A;  3HVZ A;  4XC2 A;  3OF9 A;  3SC3 A;  3DDC B;  3PXG A;  1N60 A;  2TSS A;  2VHS A;  5FKA C;  4KKI A;  2XF3 A;  2PNS A;  4US9 A;  1IXR C;  2ZTC A;  3ENE A;  2R9M A;  1QVR A;  2V1U A;  2NPT B;  1AW7 A;  3GLG E;  1L6V A;  4YYV A;  2G4S A;  3K1J A;  5I4D A;  4I81 A;  2QSF X;  1V6E A;  2MW5 A;  2PEA A;  4BBN F;  1OFI A;  2C9C A;  4DR4 M;  1JWB D;  1KSF X;  1OGW A;  3BVG A;  4G50 A;  2OPF A;  1IN5 A;  1NY6 A;  1EWM A;  2EO2 A;  2OJR A;  3RZW C;  2P86 A;  2HWK A;  2QIE B;  3L26 A;  4JGH B;  1MHW A;  1POP A;  2RPV A;  4HDO A;  1VEJ A;  1PM5 A;  3SFZ A;  3U6M A;  2AX5 A;  4FHK A;  2APL A;  1L0V B;  4QAY A;  3B7Z A;  2FOI C;  1GMY A;  1TU6 A;  4AXL A;  2KWV B;  1HJP A;  1EF1 A;  3U7Z A;  4FK5 A;  3OJ4 B;  1CJL A;  4NJ7 A;  4D8B A;  1QDQ A;  1YUB A;  3S2A A;  5LXI B;  2XU4 A;  3QYE A;  2DZO B;  4MGH A;  4N79 A;  1CV8 A;  1GPX A;  4M0W A;  3EFU A;  1GLO A;  3ZQJ A;  2JF5 A;  2ZPN A;  3KUD B;  1VJK A;  4XE0 A;  3Q8B A;  3USV A;  2WU2 B;  2YQZ A;  5EXX A;  1V5O A;  1V1P A;  3SHF A;  1PYW D;  1ZDX A;  2VII A;  3JAM S;  5GMV A;  1QLB B;  1KFV A;  2KXE A;  2AQ2 B;  1Y08 A;  1QOB A;  5EXT A;  2JWS A;  4RGO S;  4LJO B;  3I3T A;  4A5U A;  2O6V D;  1EFU B;  4FLH A;  1IN6 A;  3MTN B;  5GKN A;  2FRA A;  3U6L A;  1ZXH A;  1SB3 C;  2GQF A;  3QK0 A;  2KNB A;  3AE2 B;  3KW6 A;  3A4S C;  4BOQ A;  2UXB M;  1XXH B;  1F4I A;  2Q2E B;  4M8M A;  1E8Y A;  3C9E A;  1C4C A;  5FTM A;  4WP2 A;  1STE A;  3AL0 C;  3FUU A;  2A4Z A;  1P1A A;  2H5X A;  3HJ8 A;  3SYK A;  2G6D A;  4DHJ D;  1N6Z A;  4RH6 A;  2DC8 A;  1BUI C;  1HQC A;  2KTF A;  3RNC C;  3N30 A;  2R6N A;  1BGO A;  1HXY D;  1L2C A;  2JY6 A;  4M8N A;  3IOQ A;  3HU3 A;  4HEA 1;  1IBX B;  3L27 A;  1Z6T A;  1C3T A;  4WW0 A;  1LO5 D;  1T43 A;  1GUA B;  1UFZ A;  1WMH A;  2RPQ A;  4WJN A;  2N35 A;  4AZF A;  1NYQ A;  8CAT A;  3KW5 B;  3MTV A;  4QNR A;  3TQS A;  2G3Q A;  3H7P A;  3OLM D;  3Q3O C;  4QBB A;  1XF5 L;  4M0D A;  4A3V B;  2W54 A;  1I4W A;  3NOB A;  4PYZ A;  5D6J B;  4JI6 M;  2GFO A;  3I06 A;  1QT9 A;  2NS5 A;  2KQ4 X;  4MAC A;  3SAV A;  4LF9 M;  1B1Z A;  1V86 A;  3W9C B;  1IUE A;  2WDQ B;  1PPP A;  4JI5 M;  2RGH A;  2MP2 A;  4G54 A;  2EKF A;  2DAM A;  2K8C A;  1X9Y A;  1QZM A;  1GLN A;  1T3Q A;  4XWW A;  2RSU A;  1EE8 A;  4LJA A;  2J7Q A;  1WH3 A;  3M95 A;  1UGJ A;  3ZJU A;  4ZPX A;  3CF6 E;  3CF0 A;  3GB1 A;  3W31 A;  1OTR B;  2N9L A;  4PYU A;  2HHN A;  4LGM A;  4I6N B;  4PT5 A;  2BT6 A;  1N62 A;  2X49 A;  2V9H A;  3A9K A;  1U9W A;  4BOU A;  6PAD A;  2M60 A;  3MK6 A;  2CFO A;  3N3G A;  3H7S A;  1Q3B A;  2INN E;  3AE1 B;  3PHX A;  3TWL A;  1VG5 A;  3Q3J A;  3DBH B;  3UF8 A;  2IGG A;  1TT5 B;  5EGW A;  1I4G A;  1U5I A;  5EP4 A;  4ZHP A;  3B21 A;  2DI0 A;  3MHV C;  4MDK E;  1WHC A;  1N5X A;  3FRI A;  2ZJD A;  3GLI E;  3DOA A;  4MGZ E;  3CF2 A;  1FIQ A;  1HZ6 A;  2K6Q A;  1YIW A;  1R2Z A;  2E6X A;  1OQR A;  3N1X C;  4HXD A;  2AGA A;  4W5C A;  1XMO M;  1WRI A;  1IY2 A;  1X1M A;  1GC7 A;  5BYQ A;  2AHM A;  4D81 A;  1Q5W B;  3WXE A;  2GOW A;  3C58 A;  3URY A;  5HFY A;  3IT6 B;  3GRV A;  5C2T B;  2KVR A;  1E8Z A;  4RF1 A;  3LCU A;  3U5Z B;  4IBI A;  4K7S A;  3AOE C;  3K9O A;  2L83 A;  3MHH A;  3BBZ A;  1SBB B;  2L7H A;  1XLO A;  4M01 A;  3MOR A;  2LEK A;  3U61 A;  1VZ7 A;  3W68 A;  3SHG B;  1UUP A;  2GBM A;  2R62 A;  2I7N A;  2DZI A;  4DV2 M;  1IY0 A;  2L6O A;  2N7J A;  4JL9 A;  3APC A;  5HI1 A;  4DHJ B;  1PRB A;  2NMQ A;  2QZ4 A;  3X23 A;  2H7J A;  3D8B A;  2H1R A;  3A9J A;  2YR0 A;  3QAU A;  3ZUN A;  4DMX A;  2BPS A;  2V0G A;  2I7P A;  1T0Y A;  2OED A;  4F8C B;  3DBR B;  4F2L A;  2CP8 A;  3HU2 A;  1IXS A;  5C23 A;  2KDI A;  2MP2 B;  3GLH E;  4YY3 M;  1FEH A;  5G5H A;  4XDC A;  4YYR A;  2PVO D;  3I04 M;  1SIJ A;  1NV9 A;  2QHO B;  3LW5 F;  5CHV C;  2YFQ A;  3FUX A;  4JI4 M;  3KYD D;  4PP1 A;  4W9C A;  1ME4 A;  1WJN A;  2JVC A;  1FXT B;  2WXN A;  2LTU A;  3KSE A;  4DBG A;  3KS8 A;  2BYF A;  4URK A;  1AUA A;  3RVX A;  4LCB A;  2R9O A;  2INC C;  2VZK B;  1DGB A;  2DAE A;  3EIH A;  3AV8 A;  3RZF A;  4RCO A;  5JZE B;  1G6J A;  2UUB M;  2KDF B;  4MM3 A;  4YSY B;  1S4V A;  4IP3 A;  3VDP A;  3PHU A;  4I04 A;  5FSW A;  3KKU A;  2LGS A;  3AN1 A;  4YYQ A;  4K0K M;  2OUL A;  2DNF A;  3SR6 A;  2KQS A;  2ZEQ A;  3KQ4 A;  2M8S A;  1KHQ A;  4AXM A;  1CSB B;  1PIP A;  1VZ8 A;  1UNS A;  2LMC A;  1YQ4 B;  5G5G A;  4R7G A;  4BKT A;  2LVP C;  1YAL A;  3TL4 X;  2C5R A;  2BYE A;  1E90 A;  3ZTC A;  4ARI A;  1QYR A;  1YMH E;  1NSF A;  4GSW A;  2WU5 B;  3PHW B;  2K8B A;  5EP2 A;  2RDB C;  1ZMU A;  4AJW A;  4WQM A;  1S3S G;  2K6B A;  2BB5 A;  2ZTD A;  2CJN A;  3HHY A;  2RGO A;  3K8Z A;  1Y8R C;  1PJJ A;  1TIF A;  3HWN A;  3BK1 A;  5EJC A;  1HZ5 A;  1ME3 A;  4OVZ B;  4YVA A;  4N59 A;  1XXH E;  2G1E A;  4K7W A;  4PCZ A;  2E03 A;  2QQ8 A;  1TS5 A;  1WR6 E;  2BS3 B;  3I5J C;  1ET6 A;  1DGH A;  1MG4 A;  1PGB A;  2LGD A;  4X6H A;  3GOE A;  4FUL A;  2DNA A;  4DUZ M;  3DHI C;  3DVN U;  4BBA A;  3FKY A;  2GNO A;  3NG0 A;  3PV1 A;  2MRO B;  1YSY A;  2LRW A;  3VXW A;  4DXG A;  3KX1 A;  2MWS B;  3ZXV A;  4WJP A;  1WR1 A;  4LDT D;  4K1R B;  2AWT A;  3HVD A;  5KPZ A;  4OEL A;  4KHP M;  2Z7J A;  2Y5B A;  3B79 A;  1ZMW A;  2LGX A;  3AE3 B;  3C0R B;  3VRA B;  5EZQ A;  1DOX A;  3SYL A;  4WJO A;  1ACC A;  2JYT A;  3KVW A;  5AZH A;  3RUL A;  5FTL A;  4LFA M;  3UIN B;  3T1H M;  3B9P A;  1E5W A;  5JI3 E;  2ZM6 M;  5F3W A;  3A42 A;  2J5Y A;  1TGZ B;  3AE4 B;  3MFG A;  4HLQ A;  5EXP A;  4HRO A;  1QQR A;  3IHP C;  1NDD A;  1NJG A;  1YNT E;  2G9H D;  4HXD B;  4DBG B;  3DVN V;  3RNV A;  1GO5 A;  1KJT A;  2H89 B;  9PAP A;  1VR9 A;  2LHE A;  3CH2 X;  2C0Y A;  4II2 B;  4LF4 M;  4GDK B;  4I6L B;  2YJB A;  1ET9 A;  4IUM B;  3LMM A;  1WGY A;  4HWY A;  1ITO A;  3PBH A;  3UZU A;  2CB5 A;  4I07 A;  3NZ3 A;  3L4P A;  2BGF A;  1CVZ A;  2MBO A;  3RT3 B;  4EZJ A;  3I63 C;  4W9J A;  3CSF A;  1QAO A;  3NRZ A;  3N4C A;  4HCP B;  2MHJ A;  2B3T A;  3EA6 A;  1QUT A;  1FH0 A;  2EKE C;  3LXS A;  1PXV A;  1V33 A;  2R46 A;  2D7G A;  2O01 F;  2UU9 M;  3L08 A;  4FJC A;  3FYD A;  2K0P A;  4RM9 A;  4M9Z A;  1KLV A;  4HCN B;  1TDH A;  3THG A;  2KDE B;  1SXJ E;  4CQN A;  4QRV A;  5ITT A;  1PPD A;  4IOI E;  3M7G A;  3PRM B;  3RNA C;  3SFE B;  3HK0 A;  1YVB A;  2N9X A;  1AAR A;  1TH3 A;  1WGL A;  2DHZ A;  4MT5 A;  4G11 A;  2UUA M;  2KK8 A;  4WAA A;  1XCQ L;  3ALB A;  3AEG B;  4D8E A;  3U61 B;  3TE6 A;  1D5X C;  2GRI A;  1WXS A;  4C56 C;  3A9J B;  4IM0 A;  3OVX A;  2A5Y B;  2JY5 A;  3C19 A;  1CB5 A;  1OQY A;  2YEP B;  1BQI A;  5C18 A;  3TEX A;  2JZZ A;  3W5U B;  2KVZ A;  3AE5 B;  1RRB A;  3PRE A;  3W30 A;  2ASQ A;  2NR2 A;  2WHI A;  3M99 A;  1NO1 A;  2K3U A;  4C80 A;  1L0X B;  4FCV A;  4LJ9 A;  1YN4 A;  4JYA M;  2OP3 A;  1UZX B;  3JR5 A;  3PHX B;  1IBK M;  2GB1 A;  2JX5 A;  3AE7 B;  2QHO A;  3EC8 A;  3PRP B;  4GOC A;  2CHW A;  1TBE A;  4B08 A;  1UF0 A;  3V6E B;  1M6D A;  2JZ3 B;  1ROE A;  2WXJ A;  1IQP A;  2OOA A;  3NS8 A;  4YYS A;  2WXF A;  2Z8Y M;  2LVP A;  4DDI D;  1CTE A;  4FIP A;  2LH0 A;  2KXJ A;  3H4J A;  4GB9 A;  1IWD A;  3H7D A;  4GC9 A;  3K9O B;  5IT9 S;  4HRS A;  4IBK A;  3WCQ A;  4A90 A;  4F7Z A;  2GMI C;  3BOW A;  2KJR A;  2ZNV C;  1IPG A;  1NY5 A;  2J0J A;  2UYZ B;  2MJD A;  5G55 A;  1OAO C;  1ZMV A;  2V4I B;  4FD2 A;  1IBL M;  4LNN A;  3CBK A;  5J17 A;  1K50 A;  2O25 A;  4Y28 F;  1LFD A;  5TSS A;  4BOS A;  1XXG A;  3DOW A;  3L28 A;  2IGH A;  5FR6 A;  2CHX A;  5D7G A;  2WXH A;  3Q14 C;  2G8E A;  2JRI A;  4D80 A;  2FE8 A;  2JA2 A;  1YX6 B;  2ZVO A;  2FCS A;  4W9D A;  5L95 C;  3L54 A;  1XWI A;  1Z5S B;  3PW3 A;  2O6V B;  2ZAN A;  2V3P A;  1IM2 A;  1EU4 A;  1TTN A;  3SFD B;  1ORY B;  2WZJ A;  4IBB A;  2ERC A;  1V34 A;  1LGR A;  3MJW A;  1L4Z B;  3C3E A;  1EU3 A;  2NBU A;  2LVQ A;  3QT4 A;  3U6P A;  3AEF B;  4YTM B;  1PGY A;  2WXG A;  3EEC A;  1E8X A;  2GHU A;  5BMH A;  3QQ8 B;  1BVS A;  1KM7 A;  1L4D B;  5MPO A;  1J7A A;  1G71 A;  3QJ3 A;  1DGJ A;  4KIK A;  2E00 A;  2BB6 A;  2MRP A;  4AG6 A;  4N6E B;  4Q2J A;  1WR1 B;  2PKO A;  3R7R A;  5EZS A;  3W0L B;  1WGH A;  3A4R A;  3VFD A;  5H92 C;  2PIA A;  1D4B A;  3IBE A;  3C0R A;  2L7I A;  4YWG G;  4B3M M;  4EOY A;  3T38 A;  4X64 M;  1N75 A;  2F4V M;  4I8O A;  2F7D A;  4X62 M;  4PP2 E;  2DZK A;  2UUC M;  1F2B A;  1PJT A;  4W9K A;  3GLI A;  1OQQ A;  1V92 A;  2KX3 A;  3H6N A;  1DGF A;  4GRI A;  3SAR A;  2KWD A;  2YEP F;  2HD5 B;  3A1Q B;  2AL6 A;  3LXF A;  2DC9 A;  1CPJ A;  3PS6 A;  3RNG C;  4NXM M;  3V05 A;  1GB4 A;  1WY8 A;  4REZ A;  3DBL B;  4LZJ A;  2FBW B;  4LNF A;  2BYV E;  4NAW B;  4HKQ A;  1KF6 B;  3NVZ A;  2NQD B;  3GLG A;  2KAJ A;  1KYI A;  3QYB A;  2B76 B;  2D07 B;  2WNM A;  3R8B A;  3D8L A;  2XZF A;  2R4E A;  2NCN A;  2JU6 X;  3LYY A;  1Y4H A;  2Y21 A;  1OIP A;  1JQJ C;  3H8H A;  2KDL A;  3PT2 A;  1E8W A;  2ZZP B;  2GLS A;  3UIP B;  3QJZ A;  4GU2 A;  1R5L A;  2JQR B;  4UDU C;  3V3X A;  2E3T A;  1M94 A;  4IKG A;  1JRO A;  1Y56 A;  4N4Z A;  4JI2 M;  4LJP B;  2UWQ A;  2W82 A;  2J52 A;  2PE9 A;  4QNM A;  4A8X C;  2P5T A;  2KZS A;  2J7O A;  2Z3X A;  3VUW A;  1K82 A;  2XZU A;  1QMY A;  2VF7 A;  2BQQ A;  2CWB A;  3VRB B;  1NI2 A;  1MVK A;  1Z5A A;  1DV0 A;  1CK1 A;  3VTV A;  2KHH A;  2UU7 A;  1GVN A;  3ZJT A;  4M0W B;  2C96 A;  2BTW B;  4G4Q A;  3GLF B;  3W1S C;  2J7Q C;  2M0A A;  4OZC A;  3BOS A;  3FIL A;  1GG3 A;  4WH4 A;  3NBI A;  4NAM A;  3KOY E;  1W5T A;  1PAD A;  2ZBK B;  4DV0 M;  1TGU A;  2X8A A;  1OFF A;  2R0I A;  4NJC A;  1NI3 A;  2WLB A;  1STF E;  1SXJ C;  3KSJ A;  1U9V A;  4BS5 A;  3LB8 C;  3PO0 A;  2JQF R;  3IAS 1;  2KLC A;  2LJI A;  2VHF A;  2CEA A;  4DMY A;  2WGS A;  4JI7 M;  3JSV B;  1XC8 A;  2J7Q B;  4B7H A;  2F5S A;  2PLP A;  1E7V A;  2YJC A;  2L4E A;  3U60 B;  4KZ0 A;  4LZZ A;  3AED B;  3N20 C;  1JWA D;  1SE9 A;  3KWV A;  4N8W A;  1N33 M;  1L2N A;  1SE2 A;  4D8I A;  4LFB M;  2QIL A;  4A20 A;  3NZU A;  3M3J A;  1UM8 A;  1A6R A;  4F1I A;  1QDR A;  4W9H A;  2DEN B;  2W3R A;  4RF0 A;  5IO9 A;  4IBJ A;  4BOZ B;  2DWM A;  1VLB A;  3GZN B;  2JWU A;  4GDK A;  2IO3 B;  2LXE A;  3Q3M C;  1Z59 A;  3U4E G;  3C3D A;  1SGH A;  4CDF B;  4JQW C;  5IN7 A;  1J09 A;  2BKF A;  4LF5 M;  4TQ0 A;  3RFZ B;  4ASW C;  3U6E A;  4XWT A;  1WZ0 A;  3KP1 E;  3V62 A;  2VQF M;  2QC8 A;  3EFC A;  3DA1 A;  4M00 A;  1IP9 A;  2XH9 A;  3AV0 A;  3LVW A;  1XQQ A;  4W4U A;  2FUD A;  2N9K A;  2G4D B;  2FTD A;  3AEA B;  4NSR A;  1GJT A;  4PDI A;  2PTL A;  4D82 A;  2L0T A;  4KDI C;  3PT2 B;  3B89 A;  1F29 A;  4EIW A;  4YTN B;  3FYC A;  4FAD A;  2F5O A;  2XNA C;  3B2G A;  4LJ4 A;  2WXO A;  4LJ7 A;  4QOS A;  2QMT A;  3PPA A;  3KSX A;  1JWU D;  2JXX A;  1WJ4 A;  1L0Y B;  2MBQ A;  4FWD A;  3HU1 A;  3HKP A;  1GJS A;  3SMS A;  4GIP A;  1JRU A;  3AU5 A;  4IBF A;  3VKG A;  2J0M A;  1C4P A;  3CTW B;  3TIX A;  1ENF A;  4EUT A;  2NQI A;  4ITQ A;  2DAF A;  2CIO A;  1ZIV A;  4CZW A;  3BII D;  3WAM A;  1PGX A;  2E01 A;  4OVU A;  3U6S A;  4Z8X A;  4YHH M;  1NEN B;  4W9I A;  3OWE B;  2XU1 A;  3HHI A;  4JE3 B;  3UQB A;  2KWU B;  4E3C A;  3LQR A;  1D5M C;  1EWC A;  3V6E A;  2LVA A;  1PJI A;  3KW9 A;  1L8Q A;  2KFJ A;  1GNU A;  4L23 A;  4WJQ A;  5EE0 A;  1UD7 A;  5CHT A;  1EWL A;  5IRE B;  1PFD A;  4JN6 A;  5LMN M;  3R2T A;  1IYF A;  1AEC A;  2XSZ A;  3H6S A;  5CVN B;  1V9J A;  2FUH B;  2MX2 A;  2WWZ A;  3HJQ A;  4DV1 M;  3H8C A;  4W5B A;  3H89 A;  1DF0 A;  1JWM D;  4OHJ A;  2R9F A;  4IDI A;  2C5L C;  2XFS A;  1IFY A;  1NVI D;  5JH5 C;  1QZE A;  1IXS B;  3VK8 A;  1EO6 A;  1VDV A;  1A5R A;  2N9E B;  2JY6 B;  2C7M B;  4FWH A;  3IMA A;  4L4U A;  1C76 A;  1YJ1 A;  4B3T M;  4XZX A;  3AI8 A;  1S3S A;  1P98 A;  3U8Z A;  4B7G A;  4OU7 A;  1DGG A;  1V1O A;  2HE7 A;  5K16 A;  4CDE B;  4GXB A;  2HL7 A;  3ML9 A;  1WMH B;  2AQ1 B;  3B2F A;  2FRQ A;  4ZRQ A;  4ZRK A;  3VQI A;  4GMQ A;  1JR3 D;  4N9F 4;  1MDW A;  2K6D B;  3Q8C A;  3VAW A;  5IA7 A;  4K81 A;  4QRG A;  4BAX A;  1JB0 F;  4LTU A;  1K3X A;  2KJ6 A;  4NRV A;  2EEL A;  5D2M B;  2YVC A;  1OJL A;  2KMM A;  2RKO A;  3ILK A;  2PPH A;  3TEY A;  5EP3 A;  3HX3 A;  1QAQ A;  2D3A A;  3L17 A;  1R6B X;  1R7S A;  1T6B X;  3CH3 X;  1QKZ A;  5KQD A;  1J7B A;  2QP9 X;  2WYQ A;  3IVF A;  2J4X A;  2J0K A;  4W9F A;  4AJY B;  5KHO A;  1OEY A;  3QWZ B;  4BQV A;  3APF A;  2LGY A;  2RDH A;  3B9J A;  2RDG A;  3N1Y C;  3T9L A;  1HEZ E;  3ZQ4 A;  1GB1 A;  1DYQ A;  4FN2 A;  1F2R C;  4QHS A;  2KNV A;  4LNO A;  1OTR A;  1GEC E;  3BVZ A;  3MC9 A;  1MX0 A;  1RFK A;  5EP1 A;  3BIN A;  3NVW A;  4KSK C;  4FCT A;  3GLH A;  2DHY A;  1BT0 A;  1QDT A;  3K8U A;  2M4N A;  4NAW A;  2KDM A;  1QXP A;  2DJF B;  2WXL A;  1G3I A;  3JSV A;  4IWO A;  2V6Z M;  3L29 A;  4TQ1 A;  2DYO A;  4YT0 B;  3B7Q A;  3FTF A;  4S17 A;  1J8C A;  2AQ3 B;  2F5Q A;  1PPN A;  3DHG C;  1E0Z A;  2HD5 A;  5JA7 A;  2LHG A;  5FPW A;  4G4R A;  1QIL A;  1MHX A;  1MJG M;  3T1Y M;  2K5P A;  7PCK A;  4E71 A;  2K9D A;  3Q6B A;  3ABV B;  4RGT A;  3HHA A;  4L1B A;  1NBF C;  1HNX M;  4LY6 A;  4RNA A;  3HRD D;  3P42 A;  4AS1 A;  2MSE D;  4LDT B;  4C4V A;  3SDL C;  4D2K A;  2R45 A;  2EKK A;  2QSD A;  4QOZ C;  1R4N I;  2QCU A;  1R7R A;  5IOI A;  1C7Y A;  4GIV A;  3NBX X;  3K9M A;  2BKR B;  2Z0E B;  4B0E A;  4KGS A;  2ATO A;  2EUC A;  2PMV A;  2R44 A;  1P7E A;  3N1Z C;  3PLV A;  4JPS A;  2DAG A;  3DF0 A;  4BPV A;  4KO8 A;  4HKZ E;  3WA0 A;  4R3D A;  3R66 C;  5C3J B;  3ZNH B;  2HWJ A;  3OF8 A;  2EMT A;  2Y5P A;  1Q0W B;  3Q2A C;  1AYF A;  4L8R C;  4F1S A;  3RD2 A;  4HL4 A;  4P16 A;  2LXC A;  3VH3 B;  3P4P B;  4MGY E;  5ITU A;  4CYE A;  2NVU I;  1CZP A;  1AIP C;  3MJ5 A;  1QF6 A;  5PAD A;  4IUM A;  1VDL A;  2YNM D;  1OIZ A;  2WXQ A;  2R2O A;  4TUU A;  2JT4 B;  2UXC M;  2W3S A;  2ZCC A;  2FNJ B;  3HM6 X;  4FVM A;  2BJV A;  1N78 A;  4M9S A;  4QHT A;  2CU1 A;  3OG5 A;  2WDV B;  1DKI A;  1G59 A;  1F2C A;  2KMA A;  2JUJ A;  1FD6 A;  4K7C A;  1E6E B;  2IBI B;  4GLS C;  1IGC A;  2NQ8 C;  2M19 A;  2G8J A;  1Q6K A;  4WWP A;  4W9E A;  2VRR B;  1YJI A;  2AUX A;  3F75 A;  5BMI A;  3ONS A;  5DCN A;  3U60 A;  1FRR A;  3GE3 C;  1UGM A;  3E56 A;  3TPZ A;  2OO9 A;  2V1Y A;  3RNF C;  2MBH A;  2KOX A;  2KJH B;  1J19 A;  2KNA A;  2ZW0 A;  3WHK A;  3K9P A;  1T0R C;  1I4Q A;  1N63 A;  4LCD E;  1K3B B;  2R9N A;  4EE2 A;  3PSE B;  5E6O A;  3TEW A;  4LJ8 A;  1TY2 A;  4MSQ B;  4Z6Y A;  1PBH A;  4XYC A;  3KP0 E;  2ZW1 A;  3UGJ A;  3U7D A;  3V61 A;  3V76 A;  3HHM A;  1P9D U;  1R4M B;  1TS4 A;  5CHW A;  3NUH B;  3CIR B;  1L6U A;  4P7I A;  3KWB X;  4HLE A;  3RI7 C;  2L4F A;  1XKG A;  2D3C A;  2F5N A;  3ECI A;  5E6N A;  5G2N A;  3KOW E;  5E6J A;  1TH2 A;  2KN4 A;  5E6P A;  2IGD A;  1HQR D;  4OVZ A;  1Z2M A;  1GCB A;  2KRK A;  2XGN A;  3Q8A A;  3ZDM C;  3J2P B;  1IXZ A;  1KH0 A;  1FNW A;  3PRZ A;  1EWP A;  2VF8 A;  2REX A;  3DBH I;  2JQG R;  1LQB A;  1YD8 U;  1ZOY B;  2BVC A;  2DCC A;  1TR8 A;  4OZA A;  5CVO B;  2BJW A;  5DPS A;  2B3A A;  3A46 A;  2WDT B;  3BXW A;  1WJU A;  3FRH A;  4I05 A;  4LF7 M;  3WAO A;  1AYV A;  2K9X A;  4WAF A;  2RRU A;  2ICI A;  3I9V 1;  1YT7 A;  2FID A;  4FWG A;  2VZK D;  3RGP A;  4II7 A;  5LLI A;  4DV7 M;  2G5G X;  4J6I A;  4A9A A;  4HK2 A;  1ZDV A;  2Q5W D;  1QQW A;  2MEK A;  2W55 A;  3Q8X A;  5A2Q S;  2N9P C;  3AMZ A;  1K3W A;  3OVZ A;  3AJI B;  1GL7 A;  1WX7 A;  1N5W A;  2Y6E A;  2ON8 A;  2RR9 A;  2Z84 A;  4JI3 M;  3RFW A;  1RLF A;  2LJ5 A;  1UKF A;  1WWT A;  3ZLZ A;  1XLP A;  4EZL A;  1EWO A;  4GC5 A;  3FTD A;  2C7H A;  3TEZ A;  3Q8F A;  3MHS A;  4B9K A;  2OJW A;  2WS3 B;  3NHE B;  5TR5 A;  4BBN C;  2F5P A;  2IO0 B;  4WQO B;  2YJ9 A;  1NL6 A;  4XDD A;  2JSV X;  1BML C;  1Y8G A;  3V60 A;  2IND C;  1P7F A;  2AUZ A;  1F0Z A;  1WX8 A;  2SAK A;  5JHA A;  2O2V B;  1MIR A;  5H37 D;  1Q3C A;  2KA6 B;  5FK9 C;  2L09 A;  2HXZ A;  3AEE B;  5H8Y E;  3ZUA A;  4MGK E;  2WXI A;  1WSP A;  2Y5C A;  3LQQ A;  3VTW A;  1N77 A;  2FUG 1;  2N1W A;  1JRP A;  4P6V F;  1MU5 A;  3U30 A;  4KLN A;  4GEW A;  3TJP A;  1U9Q X;  2RMM A;  4S0R A;  3P5U A;  3KS4 A;  3KFU G;  3TBL D;  4DR7 M;  2OOB A;  2EMS A;  1HT2 E;  3TMP B;  4TMA B;  4FW9 A;  4MJS A;  3EGR A;  2KDB A;  4B7F A;  2GBK A;  3P4S B;  2L0F A;  1WIA A;  4ZRI A;  1VSN A;  2JRI B;  2XU3 A;  4UN2 B;  2HHH M;  3T3O A;  4IWQ A;  2FYE A;  1C9F A;  4ANR A;  3AM9 A;  4NY0 A;  3ZTD A;  1AU4 A;  1T0Q C;  2AVW A;  4H2A A;  4AKG A;  2LHD A;  2P7U A;  3QC8 B;  1NV8 A;  1OEY J;  3J7B A;  1NEK B;  2X38 A;  1I42 A;  2J42 A;  1I4P A;  3B74 A;  5D94 A;  4MGI E;  1ZAE A;  2CHQ A;  3WHL A;  1BY8 A;  1AN8 A;  2LD9 A;  5AUK A;  4DDG D;  5L83 A;  3PNY A;  2XBB C;  4PD2 A;  2J53 A;  4NQK E;  1L2B A;  2LWX A;  2L76 A;  2XSZ D;  3A45 A;  3MP9 A;  2IO1 B;  4MSM B;  1XT9 B;  2KLG A;  1MN3 A;  3KWZ A;  2DWZ B;  2D2Q A;  5DYG A;  3IEC A;  4RMA A;  1HR0 M;  2Z8L A;  1V1P B;  3UI3 A;  1WGD A;  1AYU A;  2G8L A;  1AIM A;  3AOG A;  3RVW A;  4AQY M;  4L78 A;  4KDL B;  4X65 M;  4DR3 M;  3PNV A;  2PVG C;  3KFQ A;  3AE6 B;  3ZNZ B;  2BYT A;  2M1M A;  1C78 A;  1S1Q B;  3K9P B;  3P1M A;  2KMC A;  2VH1 A;  4X6J A;  2FCM A;  4YV8 A;  2HTM E;  3J80 S;  1JWS D;  4KZC A;  2H88 B;  3VK7 A;  5DNY A;  1AU2 A;  2R61 A;  4DHZ E;  3PSE A;  3L0W B;  1C79 A;  3DHH C;  4FJZ A;  3GLF E;  1MEG A;  3I4V A;  2AU1 A;  4OX9 M;  2LBC A;  2KFK B;  1WGN A;  3UGB B;  3BCN A;  3I4Y A;  1IN4 A;  2SEB D;  2KZR A;  4R71 A;  1CS8 A;  2JY8 A;  1CUK A;  3JW0 X;  1EIJ A;  4MSX A;  3GRY A;  2KAN A;  4RKX A;  1E9R A;  1SXJ B;  3NY5 A;  2DYB A;  5ITX E;  4LRT A;  3T15 A;  3RN9 C;  2HKJ A;  1V5T A;  4PS8 A;  4B6W A;  4PS3 A;  5EXS A;  1K8R B;  5KQ8 A;  1T5X D;  3TRK A;  1T3T A;  1F52 A;  1TH4 A;  4PK1 A;  2MA9 B;  5IKC M;  4EFO A;  4LRS A;  1TKY A;  4MZO A;  4US8 A; 
#chains in the Genus database with same CATH homology
 4DUY M;  2DBY A;  4GKJ M;  1IN7 A;  2NTT A;  3EUB 2;  4JI8 M;  3U2S C;  3PRP A;  2D5G A;  1YE9 A;  5EE1 A;  3U52 E;  1NNU C;  1PDX A;  1B9R A;  3AFH A;  1QOG A;  3OQC A;  1W5S A;  1TS2 A;  3ZH9 B;  1EM7 A;  1WYG A;  2O5R A;  1K51 A;  1QAN A;  3FTE A;  1XCT L;  1D6E C;  3IT4 B;  4GUA A;  4AW4 A;  3GO8 A;  4DV6 M;  3FUT A;  4DXF A;  2ZAM A;  1G8P A;  2K47 A;  5IWA M;  4AQ7 A;  1R2Y A;  1N34 M;  2LNH C;  3U6Q A;  1IGD A;  4JWU C;  2DZN B;  1J5E M;  1M4V A;  3ETR A;  4DR1 M;  1J7C A;  3AEB B;  1KFY B;  4GHL A;  3OTO M;  2ACZ B;  2WXP A;  4TSS A;  1XLQ A;  3GS2 A;  2K22 A;  4AKH A;  2FFJ A;  4LFC M;  3BK2 A;  1TS3 A;  3SAW A;  4W5W A;  1I4H A;  3ZC7 B;  4CHT B;  3GP1 A;  4B0M A;  1XNQ M;  2EKI A;  4ZTB A;  2DYM A;  3ZJV A;  2CU3 A;  1TJE A;  4G4N A;  2ZAO A;  3MP2 A;  1VDD A;  3HUI A;  2D7E A;  5KPT A;  4CIS A;  4C7Y A;  1E7P B;  4LJ6 A;  3O65 A;  2OHF A;  1E9M A;  1X37 A;  1XMQ M;  4BOP A;  4CGY B;  1I4X A;  3SAT A;  2XEP A;  1WXQ A;  3C8Y A;  4S12 A;  1YZB A;  1G41 A;  5JZE A;  3PZ7 A;  4AI6 A;  1KTK A;  4NZL B;  3DZD A;  4LF6 M;  1QOA A;  1XNR M;  3DFZ A;  2E5L M;  3HHX A;  4C7Z A;  2DVW B;  4FXC A;  1I94 M;  3L2A A;  5EE9 A;  2I38 A;  5E26 A;  2L1A A;  5C1B A;  3H4M A;  4PDG A;  5KPR A;  1I7H A;  2UXD M;  4I5S A;  4TUW A;  3PHW A;  3K92 A;  2JXT A;  1ZQ9 A;  3MC0 B;  3AE8 B;  1DOI A;  3TWM A;  1NHG C;  3HWS A;  4IJE A;  3JR4 A;  4WIP A;  1HNZ M;  1YQ3 B;  3A98 B;  1HQY E;  2NTS A;  1K53 A;  4AKI A;  2M56 B;  4XBO A;  2DWQ A;  1C1K A;  3TWK A;  1V97 A;  4KOD A;  3KXE C;  2CV2 A;  1FFU A;  3J27 B;  2DWL A;  1FJG M;  4HJG E;  1SJE D;  2WDR B;  3PVS A;  3ZNH A;  2CE7 A;  4M9X A;  3BB7 A;  1LV7 A;  1CJE A;  3GPY A;  2Y3A A;  2Z4R A;  3BZD B;  3FUV A;  1SXJ A;  2C9O A;  2JYE A;  1E10 A;  3QWL A;  3UK6 A;  4JXJ A;  4YSX B;  2I2Y A;  1E32 A;  4GIT A;  2BS2 B;  2BU3 A;  4OZB A;  1NVM A;  5ITX A;  3E9S A;  1N32 M;  4O1N A;  2LUM A;  3O13 A;  3NWL A;  4JI1 M;  3KWL A;  4JWS C;  4LF8 M;  4NRW A;  4ZOH C;  4N58 A;  1HA5 A;  1HNW M;  3AKZ A;  4OW0 A;  3RE8 A;  4B3S M;  2CV0 A;  1DO2 A;  1SJH D;  3VLF B;  5BR8 M;  5FTN A;  5AUI A;  1Q10 A;  4DV5 M;  3M0E A;  2Z4S A;  2QJL A;  1ZUD 2;  4DV4 M;  1SXJ D;  2HDE A;  2IPK D;  1XXH A;  3GPU A;  2PW9 A;  2CJO A;  1CQV A;  3GRU A;  1JML A;  3R9X B;  2M5Z A;  1XHB A;  4AG5 A;  2L52 A;  1TDZ A;  1ZXI A;  3BVM A;  3BBA A;  1GKI A;  4YSZ B;  3Q69 A;  2C98 A;  3FKE A;  1MHH E;  4IBG A;  4BB9 A;  4BLC A;  5BMG A;  1YN5 A;  2N0S B;  4A55 A;  1F2R I;  1IN8 A;  1VRA B;  3J9C A;  1GAQ B;  3U6D A;  2HCB A;  2J7N A;  4LJ5 A;  5ITR A;  4YXD B;  2BNK A;  3R8F A;  2OQ4 A;  1FM0 D;  3HHZ A;  1MI0 A;  1L1T A;  4MH0 E;  3VKH A;  1SE3 A;  5IZ7 D;  3L25 A;  3P63 A;  3I51 A;  4J3O D;  4NL4 H;  5D3I B;  4RGN A;  5LMU M;  2QEN A;  3ZYY X;  3U5Z A;  5BYS A;  3HHW A;  1E94 E;  1SSN A;  4DV3 M;  1N36 M;  5KO3 A;  2BBC A;  2LGI A;  5HG2 A;  2CHV A;  1Z5B A;  3K2L A;  5ITQ A;  3IG8 A;  1NNJ A;  1TKG A;  4G6Z A;  1XO3 A;  1KLG D;  1WGK A;  1EWY C;  4JI0 M;  2CUZ A;  3GLG B;  3TUO A;  5FTJ A;  1FNU A;  4L15 A;  3GLI B;  3GQ3 A;  2QPA A;  1IBX A;  4IIW A;  1YJJ A;  4LLG M;  3U6C A;  4MM3 B;  2XLJ A;  1L5P A;  2L32 A;  2KZU A;  4BOZ A;  1NHW C;  1FCC C;  3M6A A;  4L16 A;  2BS4 B;  2DXI A;  2MJE A;  1FNN A;  4WWM A;  1MPE A;  4LK0 M;  1TYG B;  2WXK A;  4WUR A;  5ITY A;  1JQ4 A;  7CAT A;  4RGM A;  3IG5 A;  3DWM A;  3J81 S;  3AB5 A;  4USA A;  1I4R A;  3HGI A;  1Z5C A;  1TKE A;  3IFU A;  1N61 A;  4MI7 A;  2UZJ A;  1UWM A;  3GLF A;  5T8I A;  3FIL B;  2ONQ A;  4GH9 A;  1C77 A;  2R4J A;  5D3D A;  1FMA D;  3U6O A;  4NSO B;  3PRM A;  1SEB D;  1IBM M;  3KDS E;  1SE4 A;  5GXG B;  1XLN A;  1K52 A;  2WP9 B;  2INP E;  4JX1 C;  3W1S A;  2MJ3 A;  1FNV A;  2WQY B;  5FR3 A;  1DO0 A;  3NVY A;  2QBY B;  3MHZ A;  4DR6 M;  2R65 A;  1OFH A;  3SEB A;  4ZHO A;  2X4A A;  4KGR A;  3FC4 A;  3EIE A;  1D2N A;  1TZO A;  4GHA A;  3VR8 B;  1KLU D;  2QEJ C;  1H6U A;  1JAL A;  1QAM A;  3W0F A;  4LG2 A;  3TMP A;  3AH7 A;  3P4Q B;  2CV1 A;  3R2I A;  5BYR A;  4JV5 M;  1NYR A;  3E4R A;  3AE9 B;  1L1Z A;  2BW2 A;  2KW0 A;  4B3R M;  3Q8E A;  4A6Q A;  3CWI A;  4ITK A;  3GPP A;  5FTK A;  3HJS A;  2FNA A;  4IBC A;  3GQ4 A;  2IDY A;  3BYT B;  3NVV A;  3SAS A;  3VDU A;  2LFI A;  5JXV A;  5BPV A;  3P4R B;  1KRH A;  4GDL B;  2C99 A;  1G4A E;  4KKJ A;  1GOZ A;  2IJ0 A;  3PZ8 A;  1FXA A;  3UMM A;  4G4O A;  1V8C A;  3KLS X;  3DWG C;  1L2D A;  4ARC A;  4L2Y A;  2GI9 A;  1PGA A;  3GRR A;  3I57 A;  2WXM A;  5DYI A;  1TY0 A;  4GKK M;  2DLB A;  2CHG A;  3RGS A;  4KX6 B;  4XGI A;  5JI2 E;  1RWS A;  2Y0Q A;  2JTC A;  2V3N A;  2WXR A;  4DR5 M;  4NXN M;  5EE3 A;  1NJF A;  4DR2 M;  2V1C A;  3BYY B;  4X66 M;  1FO4 A;  5LNK 1;  3LVV A;  2D7H A;  1ZP0 B;  2DHR A;  2JZP A;  5HHD G;  1Q39 A;  3AOE A;  4IBD A;  1BXT A;  1DGH B;  1GL6 A;  1FRD A;  1D5Z C;  4IJF A;  2R18 A;  2KAC A;  3FUW A;  3W5V B;  3GLH B;  3N9Y C;  4YTP B;  3VR9 B;  1SF0 A;  1C4A A;  3RPF C;  1A70 A;  3FAH A;  3GPX A;  3W2D A;  1ZE3 D;  4ZYS A;  1DOY A;  1YN3 A;  1IY1 A;  1J7K A;  2EA0 A;  3FTC A;  3T3N A;  1ESF A;  3SMP A;  1AWD A;  1RM6 C;  2XN9 C;  3IAM 1;  1FCL A;  2BTE A;  1FFV A;  2KEB A;  4NOO B;  1PUT A;  2VQE M;  1JCK B;  2KRU A;  2DOS A;  2XFT A;  3PFI A;  3IXS A;  1QOF A;  1SXT A;  1XEE A;  3BY4 A;  1E9S A;  4RFB A;  4MH8 A;  1ZPS A;  1VZ6 A;  3ZGZ A;  1FXI A;  1UWX A;  3SBJ A;  4DQO C;  3GP7 A;  3SAU A;  1F77 A;  4IBE A;  2MH7 A;  2DWN A;  5FLX S;  2Y20 A;  1JR3 A;  3GQ5 A;  1RYJ A;  2BTW A;  4I4L A;  3ZCB B;  4MB7 A;  4KGT A;  3AEC B;  2QBY A;  3FD9 A;  3KOZ E;  4FCW A;  5EQT A;  3BWU D;  3J7A S;  1PVJ A;  1JW9 D;  3KOX E;  4ZRP A;  4LGY A;  1HT1 E;  2Y0T A;  3TSS A;  3NS1 A;  3UJN A;  3HVZ A;  3SC3 A;  3PXG A;  1N60 A;  2TSS A;  5FKA C;  4KKI A;  2XF3 A;  4US9 A;  1IXR C;  1QVR A;  2V1U A;  1AW7 A;  1L6V A;  3K1J A;  5I4D A;  4I81 A;  1OFI A;  2C9C A;  4DR4 M;  1JWB D;  1KSF X;  3BVG A;  2OPF A;  1IN5 A;  1NY6 A;  2EO2 A;  2HWK A;  2QIE B;  3L26 A;  2RPV A;  1PM5 A;  3SFZ A;  3U6M A;  2AX5 A;  1L0V B;  2FOI C;  3U7Z A;  4D8B A;  1YUB A;  4MGH A;  2DZO B;  1GPX A;  4M0W A;  4XE0 A;  1VJK A;  3Q8B A;  2WU2 B;  2YQZ A;  5EXX A;  1V1P A;  3SHF A;  1PYW D;  1ZDX A;  2VII A;  3JAM S;  1QLB B;  1KFV A;  2KXE A;  2AQ2 B;  1QOB A;  5EXT A;  4RGO S;  4A5U A;  1IN6 A;  5GKN A;  3U6L A;  1ZXH A;  1SB3 C;  3AE2 B;  3KW6 A;  4BOQ A;  2UXB M;  1XXH B;  2Q2E B;  1C4C A;  5FTM A;  1STE A;  3AL0 C;  3FUU A;  3SYK A;  3HJ8 A;  4RH6 A;  1BUI C;  1HQC A;  1HXY D;  1L2C A;  3HU3 A;  4HEA 1;  1IBX B;  3L27 A;  1Z6T A;  4WW0 A;  1LO5 D;  4AZF A;  1NYQ A;  3MTV A;  8CAT A;  4QNR A;  3TQS A;  1XF5 L;  4M0D A;  4A3V B;  2W54 A;  1I4W A;  4JI6 M;  1QT9 A;  2KQ4 X;  4MAC A;  3SAV A;  4LF9 M;  1B1Z A;  3W9C B;  1IUE A;  2WDQ B;  4JI5 M;  2RGH A;  1QZM A;  1GLN A;  1T3Q A;  4XWW A;  1EE8 A;  4LJA A;  2J7Q A;  3ZJU A;  1UGJ A;  4ZPX A;  3CF6 E;  3CF0 A;  3GB1 A;  3W31 A;  2N9L A;  4LGM A;  4PT5 A;  2BT6 A;  1N62 A;  2X49 A;  4BOU A;  2M60 A;  3MK6 A;  2CFO A;  1Q3B A;  2INN E;  3AE1 B;  3PHX A;  3TWL A;  2IGG A;  1I4G A;  3B21 A;  5EP4 A;  4ZHP A;  3MHV C;  1N5X A;  3DOA A;  4MGZ E;  3CF2 A;  1FIQ A;  1HZ6 A;  1R2Z A;  2E6X A;  1OQR A;  2AGA A;  1XMO M;  1WRI A;  1IY2 A;  5BYQ A;  2AHM A;  4D81 A;  3C58 A;  3URY A;  5HFY A;  3IT6 B;  3GRV A;  5C2T B;  4RF1 A;  3U5Z B;  4IBI A;  3AOE C;  2L83 A;  1SBB B;  2L7H A;  1XLO A;  2LEK A;  3U61 A;  1UUP A;  3SHG B;  1VZ7 A;  2R62 A;  2I7N A;  4DV2 M;  1IY0 A;  2L6O A;  2N7J A;  5HI1 A;  2NMQ A;  2QZ4 A;  3D8B A;  2H1R A;  2YR0 A;  3QAU A;  2V0G A;  2I7P A;  2OED A;  3HU2 A;  4YY3 M;  1FEH A;  5G5H A;  4XDC A;  2PVO D;  1SIJ A;  2YFQ A;  3FUX A;  4JI4 M;  2WXN A;  3KS8 A;  4LCB A;  2VZK B;  1DGB A;  3EIH A;  3AV8 A;  4RCO A;  2UUB M;  4YSY B;  4IP3 A;  3VDP A;  3PHU A;  5FSW A;  3AN1 A;  4K0K M;  3SR6 A;  3KQ4 A;  1VZ8 A;  1UNS A;  2LMC A;  1YQ4 B;  5G5G A;  4R7G A;  3TL4 X;  2C5R A;  4ARI A;  1QYR A;  1YMH E;  1NSF A;  2WU5 B;  5EP2 A;  4WQM A;  2BB5 A;  2CJN A;  3HHY A;  2RGO A;  3K8Z A;  1PJJ A;  3BK1 A;  5EJC A;  1HZ5 A;  4OVZ B;  4N59 A;  2G1E A;  4PCZ A;  1TS5 A;  2BS3 B;  1ET6 A;  1DGH A;  1PGB A;  4DUZ M;  4BBA A;  1YSY A;  4DXG A;  3HVD A;  5KPZ A;  4KHP M;  2Z7J A;  3AE3 B;  5EZQ A;  3VRA B;  1DOX A;  3SYL A;  1ACC A;  2JYT A;  3KVW A;  5FTL A;  4LFA M;  3T1H M;  3B9P A;  5JI3 E;  2ZM6 M;  5F3W A;  3A42 A;  4HRO A;  3AE4 B;  3MFG A;  4HLQ A;  5EXP A;  1QQR A;  1NJG A;  1YNT E;  2G9H D;  4HXD B;  3RNV A;  2H89 B;  1VR9 A;  2LHE A;  4LF4 M;  4GDK B;  1ET9 A;  3LMM A;  3UZU A;  3NZ3 A;  3L4P A;  3NRZ A;  1QAO A;  3EA6 A;  2R46 A;  2D7G A;  2UU9 M;  3FYD A;  2K0P A;  4M9Z A;  1TDH A;  3THG A;  4CQN A;  1SXJ E;  5ITT A;  4IOI E;  3M7G A;  3SFE B;  1TH3 A;  4MT5 A;  2UUA M;  1XCQ L;  3AEG B;  4D8E A;  3U61 B;  3TE6 A;  1D5X C;  2GRI A;  4C56 C;  2A5Y B;  2YEP B;  5C18 A;  3TEX A;  3W5U B;  3AE5 B;  3W30 A;  2K3U A;  4C80 A;  1L0X B;  4FCV A;  4LJ9 A;  1YN4 A;  4JYA M;  3JR5 A;  1IBK M;  2GB1 A;  2JX5 A;  3AE7 B;  4B08 A;  1ROE A;  2WXJ A;  1IQP A;  2WXF A;  2LH0 A;  4GC9 A;  5IT9 S;  4HRS A;  4IBK A;  3WCQ A;  4A90 A;  1NY5 A;  2MJD A;  2V4I B;  4FD2 A;  1IBL M;  1K50 A;  5TSS A;  4BOS A;  1XXG A;  3L28 A;  2IGH A;  5D7G A;  2WXH A;  2JRI A;  4D80 A;  2FE8 A;  2JA2 A;  1XWI A;  2ZAN A;  2V3P A;  1IM2 A;  1EU4 A;  3SFD B;  1ORY B;  4IBB A;  2ERC A;  1L4Z B;  1EU3 A;  3U6P A;  3AEF B;  4YTM B;  2WXG A;  5BMH A;  1L4D B;  5MPO A;  1J7A A;  1DGJ A;  2BB6 A;  4AG6 A;  4N6E B;  4Q2J A;  2PKO A;  5EZS A;  3W0L B;  3VFD A;  5H92 C;  2PIA A;  1D4B A;  3C0R A;  2L7I A;  4YWG G;  4B3M M;  3T38 A;  4X64 M;  1N75 A;  2F4V M;  4I8O A;  4X62 M;  2UUC M;  3GLI A;  1OQQ A;  1DGF A;  4GRI A;  3SAR A;  2KWD A;  2YEP F;  3LXF A;  4NXM M;  3V05 A;  1GB4 A;  4REZ A;  4LZJ A;  2FBW B;  4NAW B;  4HKQ A;  1KF6 B;  3NVZ A;  3GLG A;  2KAJ A;  1KYI A;  2B76 B;  2WNM A;  3R8B A;  3D8L A;  2XZF A;  2R4E A;  3LYY A;  2JU6 X;  2Y21 A;  3H8H A;  1JQJ C;  3PT2 A;  4UDU C;  2JQR B;  3V3X A;  2E3T A;  4IKG A;  1JRO A;  1Y56 A;  4JI2 M;  2W82 A;  2J52 A;  4QNM A;  4A8X C;  2P5T A;  2KZS A;  2J7O A;  2Z3X A;  1K82 A;  2XZU A;  3VRB B;  1MVK A;  1Z5A A;  1CK1 A;  3ZJT A;  1GVN A;  2C96 A;  2BTW B;  4G4Q A;  3GLF B;  2J7Q C;  2M0A A;  4OZC A;  3BOS A;  3FIL A;  4WH4 A;  4NAM A;  3NBI A;  3KOY E;  1W5T A;  2ZBK B;  4DV0 M;  1TGU A;  2X8A A;  1OFF A;  4NJC A;  1NI3 A;  2WLB A;  1SXJ C;  3KSJ A;  3LB8 C;  3PO0 A;  3IAS 1;  2LJI A;  2CEA A;  4JI7 M;  1XC8 A;  4B7H A;  2F5S A;  2PLP A;  3U60 B;  4LZZ A;  3AED B;  1JWA D;  4D8I A;  3KWV A;  1N33 M;  1SE2 A;  4LFB M;  2QIL A;  1UM8 A;  2W3R A;  4RF0 A;  4IBJ A;  2DWM A;  1VLB A;  2JWU A;  2LXE A;  3U4E G;  1Z59 A;  1J09 A;  4LF5 M;  4TQ0 A;  3RFZ B;  3U6E A;  4XWT A;  3KP1 E;  2VQF M;  3DA1 A;  2XH9 A;  3AV0 A;  3LVW A;  2N9K A;  3AEA B;  4NSR A;  4PDI A;  2PTL A;  4D82 A;  4EIW A;  4YTN B;  3FYC A;  2F5O A;  2XNA C;  3B2G A;  4LJ4 A;  2WXO A;  4LJ7 A;  4QOS A;  2QMT A;  3KSX A;  1JWU D;  1L0Y B;  4FWD A;  3HU1 A;  3HKP A;  3SMS A;  4GIP A;  4IBF A;  3VKG A;  1C4P A;  3CTW B;  1ENF A;  4ITQ A;  3BII D;  1PGX A;  3U6S A;  4Z8X A;  4YHH M;  1NEN B;  3OWE B;  4JE3 B;  3LQR A;  1D5M C;  1EWC A;  1PJI A;  1L8Q A;  4L23 A;  5EE0 A;  5IRE B;  1PFD A;  4JN6 A;  5LMN M;  3R2T A;  2XSZ A;  3HJQ A;  4DV1 M;  1JWM D;  4OHJ A;  4IDI A;  2XFS A;  1NVI D;  3VK8 A;  1IXS B;  1VDV A;  4FWH A;  4L4U A;  1C76 A;  4XZX A;  4B3T M;  1S3S A;  4B7G A;  4OU7 A;  1DGG A;  1V1O A;  2HL7 A;  2AQ1 B;  3B2F A;  4ZRQ A;  3VQI A;  4GMQ A;  1JR3 D;  3Q8C A;  4LTU A;  1K3X A;  4NRV A;  2EEL A;  1OJL A;  2KMM A;  2RKO A;  3ILK A;  3TEY A;  5EP3 A;  1QAQ A;  1R6B X;  1R7S A;  1T6B X;  1QKZ A;  5KQD A;  1J7B A;  2QP9 X;  2J4X A;  2RDH A;  3B9J A;  2RDG A;  1HEZ E;  3ZQ4 A;  1GB1 A;  1DYQ A;  1F2R C;  4QHS A;  3BVZ A;  1MX0 A;  1RFK A;  5EP1 A;  3NVW A;  4FCT A;  3GLH A;  2KDM A;  2WXL A;  1G3I A;  2V6Z M;  3L29 A;  4TQ1 A;  2DYO A;  4YT0 B;  3FTF A;  2AQ3 B;  2F5Q A;  1E0Z A;  4G4R A;  1QIL A;  1MHX A;  3T1Y M;  2K5P A;  3ABV B;  4RGT A;  4L1B A;  1HNX M;  4LY6 A;  4RNA A;  3HRD D;  3P42 A;  4AS1 A;  4D2K A;  2R45 A;  2QSD A;  4QOZ C;  2QCU A;  1R7R A;  4B0E A;  4KGS A;  2EUC A;  2PMV A;  1P7E A;  4JPS A;  4KO8 A;  4HKZ E;  4R3D A;  5C3J B;  2Y5P A;  1AYF A;  4L8R C;  4HL4 A;  4P16 A;  3P4P B;  4MGY E;  5ITU A;  1CZP A;  3MJ5 A;  1QF6 A;  4IUM A;  2YNM D;  2WXQ A;  2UXC M;  2W3S A;  4FVM A;  2BJV A;  1N78 A;  4M9S A;  4QHT A;  2WDV B;  1DKI A;  1G59 A;  1FD6 A;  1E6E B;  4GLS C;  1IGC A;  2NQ8 C;  2M19 A;  1YJI A;  5BMI A;  3U60 A;  1FRR A;  3E56 A;  3TPZ A;  2ZW0 A;  3WHK A;  1I4Q A;  1N63 A;  4EE2 A;  3TEW A;  4LJ8 A;  1TY2 A;  4Z6Y A;  3KP0 E;  2ZW1 A;  3UGJ A;  1TS4 A;  3NUH B;  3CIR B;  1L6U A;  2F5N A;  3KOW E;  5E6J A;  1TH2 A;  2KN4 A;  2IGD A;  1HQR D;  4OVZ A;  2KRK A;  2XGN A;  3Q8A A;  3J2P B;  1IXZ A;  1KH0 A;  1FNW A;  1ZOY B;  4OZA A;  2BJW A;  3A46 A;  4LF7 M;  2K9X A;  4WAF A;  2ICI A;  3I9V 1;  4FWG A;  2VZK D;  3RGP A;  4II7 A;  4DV7 M;  2G5G X;  4A9A A;  1ZDV A;  2Q5W D;  1QQW A;  2MEK A;  2W55 A;  3Q8X A;  5A2Q S;  3AMZ A;  1K3W A;  3AJI B;  1GL7 A;  1N5W A;  2ON8 A;  2Z84 A;  4JI3 M;  3RFW A;  1UKF A;  1WWT A;  1XLP A;  4GC5 A;  3FTD A;  3TEZ A;  3Q8F A;  2WS3 B;  2F5P A;  4XDD A;  2JSV X;  1BML C;  1P7F A;  1F0Z A;  2SAK A;  5H37 D;  1Q3C A;  2KA6 B;  5FK9 C;  2L09 A;  3AEE B;  5H8Y E;  4MGK E;  2WXI A;  1WSP A;  2Y5C A;  3LQQ A;  1N77 A;  2FUG 1;  1JRP A;  4P6V F;  1MU5 A;  4KLN A;  2RMM A;  3KS4 A;  3KFU G;  4DR7 M;  1HT2 E;  4TMA B;  4FW9 A;  3EGR A;  4B7F A;  3P4S B;  2HHH M;  3T3O A;  1C9F A;  3AM9 A;  4H2A A;  4AKG A;  2LHD A;  3J7B A;  1NEK B;  2X38 A;  2J42 A;  1I4P A;  4MGI E;  1ZAE A;  2CHQ A;  3WHL A;  1AN8 A;  5AUK A;  3PNY A;  4PD2 A;  2J53 A;  1L2B A;  2LWX A;  2XSZ D;  3A45 A;  3MP9 A;  2DWZ B;  5DYG A;  1HR0 M;  2Z8L A;  1V1P B;  3UI3 A;  2G8L A;  3AOG A;  4AQY M;  4L78 A;  4X65 M;  4DR3 M;  3PNV A;  2PVG C;  3AE6 B;  2BYT A;  1C78 A;  3P1M A;  2HTM E;  3J80 S;  1JWS D;  2H88 B;  3VK7 A;  5DNY A;  2R61 A;  3PSE A;  1C79 A;  3I4V A;  4OX9 M;  3I4Y A;  1IN4 A;  2SEB D;  3GRY A;  4RKX A;  1E9R A;  1SXJ B;  5ITX E;  4LRT A;  3T15 A;  2HKJ A;  5EXS A;  5KQ8 A;  1T5X D;  3TRK A;  1T3T A;  1TH4 A;  4LRS A;  1TKY A;  4US8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...