4RNAA

Crystal structure of plpro from middle east respiratory syndrome (mers) coronavirus
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
321
structure length
319
Chain Sequence
LTIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVDKVRSLKLSDNNYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSDCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords papain-like protease
publication title Inhibitor Recognition Specificity of MERS-CoV Papain-like Protease May Differ from That of SARS-CoV.
pubmed doi rcsb
source organism Human betacoronavirus 2c emc/2012
molecule tags Hydrolase
total genus 92
structure length 319
sequence length 321
ec nomenclature ec 3.4.22.-:
pdb deposition date 2014-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4rnaA02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rnaA01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4rnaA03
5KO3A 4OVZB 4MM3B 5E6JA 4REZA 4OW0A 4M0WA 3MP2A 2FE8A 4PT5A 4RF1A 4OVZA 4RNAA 3MJ5A 3E9SA 4R3DA 4RF0A 4P16A 4WURA
chains in the Genus database with same CATH superfamily
1YN5A 5KO3A 2JNHA 2LHCA 1UD7A 2YNMD 4ZRKA 3I4YA 4G11A 3L28A 2ZZPB 2FTDA 4YYVA 1QAMA 1TDZA 1N34M 3QAQA 3SFDB 1D5XC 2KNAA 4YL8A 4IBIA 3L26A 1PJQA 1T6BX 2JUOA 2INPE 4JL9A 2OP3A 4LJ4A 2AX5A 5FTLA 1E90A 4JGHB 3FTEA 3LMMA 3KFUG 2NQDB 3H6NA 4BOZA 5ITRA 2PREA 2EMTA 1U9QX 3GQ5A 3ERVA 1WXSA 5D3IB 1P98A 1WXQA 4JIOU 4G0NB 4OVZB 3U7ZA 4YYQA 1QOLA 4D8BA 2QBYA 5JZEA 2LXEA 1F0ZA 3GRRA 1OAIA 2CHVA 3APFA 4II2B 1AECA 4Y28F 2DCBA 2QDFA 2MRPA 3Q69A 3KVFB 2MJ5B 2NBUA 2F7DA 2CJNA 1NYRA 3A9KB 1N63A 4RNAA 2J7QC 2QQ8A 3E4RA 4DR1M 4FWHA 1JQPA 2VRRB 1YJIA 2K3UA 3RCZA 4C00A 3V05A 4AWJA 5KHQA 1IBKM 4D81A 3PHUA 4B7FA 2VIIA 4ACFA 5LLIA 3R3MA 1UGMA 3Q3NC 4MI7A 3DF0A 2CV0A 3PRMA 4BBNC 2FE8A 1YOVB 3R8FA 2X8XX 5FLXS 3IXSA 4HEOA 1FRDA 2BBCA 1JB0F 2LXAA 3UI3A 4I81A 4WW0A 4LF6M 3NOBA 3AEGB 3MHVC 3CBKA 1WGYA 2IGDA 2CV1A 1IN8A 3DPDA 3BBAA 2IO3B 3AOGA 2WSFF 4Q8GA 3PRPA 3ZYYX 3SASA 2LHDA 3OTOM 2CHZA 3GQ4A 3PRZA 4L1BA 3O13A 2UXDM 3HVZA 2KTRB 4PD2A 3A98B 1V1OA 2UWQA 3T8MA 3MP2A 3FUWA 3RNCC 1WGRA 3OVZA 3KOYE 1F77A 2FH0A 1KFXL 3RMKC 1NVID 4N9F4 3DOWA 2PVOD 1PIPA 3K2LA 1PJIA 2ZTDA 3GE3C 2IO0B 3DBSA 3P42A 4GC9A 4MGHA 1SP4B 3V6CA 4LDTD 3AU5A 4GSWA 1NV8A 5IOIA 4A6QA 2ZNVC 3ZJVA 3VUYA 3CSFA 4C4VA 2HL7A 2J52A 4W4UA 2XSZD 5EZQA 1G6JA 2JY6B 2BPSA 3HHZA 1XQQA 5G2NA 2FUDA 4GITA 3RNVA 1VCBA 2GLSA 1Y08A 4ZRIA 4Q2JA 2QP9X 4NSRA 1PUTA 2E6XA 5GXGB 2BS2B 5AZHA 2BYTA 1SXJA 4GHAA 3B9JA 1STFE 3OQCA 3HIZA 3JSVB 2DC8A 1C77A 2QC8A 3W1SC 1EFUB 5IO9A 2WXFA 4BKSA 2D7GA 3JVZX 3C0RA 3TEXA 2V1YA 2DAJA 2MBQA 3H7PB 1NPZA 3GZNB 4L4UA 3FYCA 4MH0E 5LMUM 3ZTDA 3IFUA 3ZVVA 2EKIA 2C99A 4ITQA 1D6EC 2AUZA 3SHGB 1E32A 2YLMA 2K9XA 4HPMB 1T0SC 1H4RA 2RDHA 4W9FA 1U9XA 1QXPA 4XGIA 2N1VA 4NAWB 3AE7B 1NI3A 2MW5A 4OW0A 1J09A 4DHZB 4RGNA 4IKGA 2JYTA 1OJLA 1XHBA 4S12A 3GE8C 4DR5M 5GMVA 3HHWA 3KOXE 4HLQA 4HVBA 2MGWA 1HNZM 2DWNA 1WF9A 1NJFA 4HJGE 4PK1A 4FXCA 4Z6YA 2H1RA 1PM5A 3RGSA 4JE3B 1T5XD 3GRYA 3CBJA 2RDGA 1SE2A 4QHTA 3EA6A 2E5LM 2AUXA 1YVBA 2OOBB 3ZDMC 3BK2A 2WXKA 5C3JB 2RRUA 4FULA 1L1ZA 2CHQA 1TTEA 1YE9A 4MDKE 2QSDA 3L27A 1VDLA 4WA6A 1SG9A 4MM3B 3VLFB 2DXIA 3EIEA 4LJ7A 1QOFA 2L09A 3L0WB 1LM8B 3ZH9B 2LGYA 1TZ1A 3VTWA 1UFZA 4O1NA 3WAMA 4P6EA 2P86A 5D7GA 2XZUA 1I7HA 1L2CA 3TNXA 2OULA 3SMPA 2CRUA 2UU7A 2ZJDA 2R9FA 1VQ1A 5BO4B 2IJ0A 2KFKA 1WE6A 2OPFA 1WGDA 1WR1B 2PMVA 3UZUA 1K3XA 4AG6A 5EJCA 1GJTA 3GLGB 4YYWA 2L83A 3VKGA 2RGHA 1C4AA 3PNVA 2J0KA 3ZC7B 5CHVA 3KSXA 2UUAM 3CF6E 1FCCC 1G4AE 4KKJA 4X6IA 5JH3A 3SAWA 1ZUD2 3LCUA 1F1HA 3S3QA 3ZKJC 3O65B 4RMAA 1YN4A 1TF0B 3W0FA 2RSUA 4K7UA 4FD2A 3PT2B 3ZO5B 3U30A 5FTJA 1V1PA 5C23A 3F5VA 1Q02A 1DKIA 3PV1A 1YK8A 2WXRA 1UUPA 3L17A 2K8CA 1JWBD 2LJIA 4B08A 3GLHE 1UNSA 4GEWA 5HFYA 3D32A 1ME3A 2JX5A 2DHZA 2DZOB 3OWEB 2KJ6A 2R2OA 2C5LC 3I4VA 2G4DB 3KS8A 1WRDB 3H8BA 5HKHA 4GOCA 1T0QC 3FUUA 2P5TA 1E8YA 4PDIA 5KPZA 3JAMS 4CIZA 3L10B 2G8JA 2BT6A 4B0MA 1ET9A 3U5ZA 1GOZA 1XXHA 3T38A 4B7HA 1IY2A 1QLBB 2BJVA 4PCZA 3T9LA 4BOQA 2Z3XA 4MGZE 2ASQA 2F5OA 3DBRI 3SAUA 2R0IA 2KVZA 4A20A 2NQ8C 4LJPB 5L95C 1NY6A 2OO9A 5IP4D 1SSNA 3BC3A 3WA0A 1N36M 1GUAB 4LF7M 3GP7A 3R2IA 1CVZA 4RKXA 2WXPA 1V5TA 2PPHA 5CTRC 2JU6X 1EWYC 2KN5A 4EZJA 4E3CA 1VZ8A 3DQVA 1RU3A 1ZMWA 2O01F 2CU3A 1DOYA 2Y5BA 2V3PA 1QZMA 4N4ZA 2RDBC 1NJGA 3FYDA 2BF8B 4QOSA 3KUZA 3I63C 1KLUD 2I7PA 2UZJA 3AE9B 3K9PA 1UF0A 1DEUA 3RN9C 1HZ6A 3KSEA 1WZ3A 2D10A 4TQ0A 4M0WA 2C7HA 2BTEA 2IYDB 4KODA 1F2CA 1L8QA 1GL6A 2L32A 4NRWA 2KAJA 2MCNB 3WXGA 3NY5A 1YZBA 3MFGA 1KFVA 4GDLB 3TCAA 3VUWA 1AIMA 4WJPA 2K39A 4AUQC 4K81A 1PPNA 2FCNA 4GH9A 3ALBA 2G1EA 2PKOA 1IPGA 4K1RB 4BOPA 3KOZE 2QJLA 2WSCF 4DXAB 1TS2A 5EXTA 1M4VA 3RFZB 3Q3JA 2XSZA 4ZOHC 1E8WA 4DV0M 3P1MA 4LLGM 1HUCB 3PNRA 4R71A 1DV0A 4LFBM 2BNKA 1F9JA 4DV4M 2C7MB 3ZJUA 3OVXA 3IECA 3DHIC 3RNFC 3O0UA 3TQSA 2DHYA 2XU1A 2KANA 4DMYA 4OX9M 4C7ZA 3PXGA 3ZRFA 4W9GA 4W9LA 2B3AA 3NVYA 4XDCA 4P16A 2BKFA 2GI9A 3EECA 4JV5M 1Q5WB 2JZZA 3PVLA 1AU3A 5HI1A 5IZ7D 2LWPA 2VH1A 2XBBC 2EKEC 1ZCMA 2KYWA 2FS1A 1YT7A 3A4RA 2L0TA 1C7YA 1MFWA 5G5HA 3Q14C 2ERCA 5LMNM 3GPUA 2ZVOA 2SEBD 1PDXA 1B9RA 3IHPC 3TSSA 4YSXB 4PT5A 4FK5A 3FD9A 4GMVA 1F4IA 4HCPB 4JYAM 1KHPA 4HK2A 2CP8A 2LXCA 3H1UA 4RY2A 2BU3A 4XC2A 1YN3A 3KSJA 2D3BA 2P0RA 4KLBA 2HWJA 2KZRA 4AOFA 1D0KA 3TRKA 3HHIA 2N4FA 1OEYA 4GMQA 1SEBD 3PSEB 1F2BA 1KHQA 1N78A 2LGSA 4KO8A 2L00B 1D4BA 3J7BA 4HXDB 2WDQB 1O0EA 2DCAA 2MBBB 2JP7A 2DZKA 4RGMA 3EUB2 2HXZA 5IT9S 2Q2EB 1A70A 2W3RA 1MN3A 2VF8A 2I7NA 1F2RI 3DDCB 1GLOA 4OVZA 2JXNA 2HH5A 2CEAA 1EWPA 4D8IA 1Y8RC 5DYIA 2Y5CA 4DR2M 4FJYA 2BW2A 1E7UA 2IBIB 2LRWA 7CATA 3CIRB 4BOSC 1IM2A 3VFDA 3TBLD 3QT4A 2R18A 3RULA 3KP1E 3Q8GA 5BMGA 5EP1A 3IG5A 3A9KA 1DGHB 1JWAD 1PE6A 2PW9A 2AYOB 4AW4A 4C80A 3GLIE 1RAXA 3HHMA 3NWLA 4TV3A 1QYRA 1GECE 5J18A 4HCNB 1YX5B 4GIVA 3EFUA 2H7JA 3GPXA 1K51A 5CHFA 2OZ2A 2G8EA 1YUBA 3APDA 4MSMB 3RZWC 1TLOA 2M17A 1F52A 1Q39A 2QHOB 3LXSA 4KGRA 2XNAC 2YJ9A 5FKAC 3GLFA 5BYQA 1Z6TA 5ITYA 1JROA 2MBOA 4PP2E 2HJ1A 3HKPA 1N32M 1WYWB 3UIPB 1Q0WB 3IV2A 1L2NA 5EDSA 2V1UA 4GC5A 2HTHA 5J17A 1E8XA 4ZYSA 1FCLA 2KQ4X 2DC9A 3WCQA 2KTFA 1I4WA 4J6IA 2GMIC 3V62A 2YJBA 2K9DA 1MJDA 1HA5A 4KIKA 1Q1OA 5H8YE 5JHAA 1BP4A 2DKLA 3LVVA 4A90A 1DO0A 3HJSA 1KTKA 3O1GA 3KYDD 1CUKA 4NJ6A 1XXHB 3W5UB 2HE7A 2KHHA 5EXSA 2KQSA 1OFFA 3CSTA 3BVMA 4XWWA 3OLMD 2DZYA 2Z84A 4W9EA 3C9PA 2LJ5A 3TWMA 3MHSD 3TUOA 3DWMA 2CR5A 4K0KM 3T1YM 1TS4A 2VQEM 3AECB 2DENB 4PS7A 2JZ1A 3D6SA 2Y5BB 1K53A 2R6NA 2GBKA 2VZKB 1MEGA 5IREB 4MZOA 2DI0A 1I4HA 2BWES 2JY6A 2EJSA 1L0XB 3I3TB 3PPAA 3QX1A 1WJ4A 4XE0A 1WXAA 4II3B 4W5BA 2IPKD 1FMAD 1V49A 2RPQA 2E02A 4IJFA 4MGYE 4WWPA 3IG3A 4YV8A 2Y21A 4CJ6A 3B7ZA 2MWSB 3IT4B 4NL4H 4WWOA 2AQ3B 1E10A 4JLCA 3VRAB 1IXSB 4BFRA 1A6RA 2KWUB 4WWMA 5LNK1 4DBGB 4KGSA 4XBOA 4BBNF 3U7DA 2LBCA 4IBJA 4I6LB 1MS6A 5A2QS 2QCZA 2JQFR 2KNVA 4A3OA 3DWGC 3U6PA 3H7PA 1CZPA 3OISA 2RGOA 1VDDA 2IY0B 3L29A 1RWSA 3JYUA 2N7DA 2FO5A 1MHHE 2J7OA 3QWLA 2WDVB 1K82A 3AULA 5FTMA 4K7WA 5JI2E 4WWNA 4IM2A 2G5GX 1NHGC 4PS8A 1P0RA 2L6OA 1LQBA 5AUKA 4NAWA 4AKIA 4QBBA 3U6OA 1XC8A 2IGHA 3V61A 4F2LA 5HG2A 2OHFA 2BDLA 3U6EA 4HWIB 1J7CA 1OTRB 1FXIA 1AYUA 1WY8A 2RKOA 1IFYA 3UJNA 3AB5A 2MH7A 2LWXA 1E6EB 5E6NA 4LF4M 2M0AA 4LNOA 5BMHA 2K5PA 3NVVA 3P4PB 2C60A 5EE3A 3PHWB 3AH7A 2OOBA 3H8HA 5H92C 3KKUA 2QIEB 4BZAA 4E71A 2LVNC 4ANXA 5IWAM 2JTCA 2KRUA 2L05A 4IBCA 1WSPA 4MM3A 2KACA 2K8HA 3FUXA 2UUCM 1J7BA 3D8LA 2O2VB 3HWNA 2BS4B 1AU0A 2Z7JA 4F7ZA 4QRVA 2XGNA 1S4VA 1AU4A 1YIWA 2N9KA 4BKTA 1JR3E 1NYQA 4BOUA 2UXBM 2C5RA 1TKGA 1XD3B 1B1ZA 1BUIC 4G50A 2DLBA 2Q5WD 4BAXA 4RCOA 1IWDA 1WR1A 4GKKM 1R4GA 4PDGA 1VJVA 3GLGA 2YJCA 2DZJA 5ITXA 3HWSA 1WM2A 2WXMA 2B3TA 3AJIB 4IBGA 4GU2A 3VDZA 3KVWA 2V3NA 3GPPA 4QAYA 2REXA 1QOGA 2WU5B 3O65A 1P3QQ 1XXGA 3SHQA 2J4XA 2J7QB 4ZPXA 2VQFM 3PT2A 1C4PA 2JF5A 2NS5A 2JVCA 4XYCA 3VHTC 5EXPA 2WBFX 4LY6A 3R8BA 1SXJE 3W30A 2MHJA 1ZOYB 2C9CA 4AKGA 5CX3A 1QDTA 3DBLI 3H4JA 2JZPA 3P5UA 1ZDVA 1IXZA 1RM6C 2YR0A 3RNBC 2KK8A 1IN6A 1QAOA 3TL4X 2UUBM 1VLBA 4X6HA 4IJEA 1ACCA 3BB7A 2BYEA 3FTCA 4FJZA 2PLPA 3Q8EA 2KDEB 4IW0A 2Z8LA 2IDYA 3KFQA 4JWUC 1QOAA 1L2BA 2JSVX 4FA6A 1X37A 2MJEA 1KFYB 3GLFB 2DYMA 1T3QA 2CHWA 3KWZA 3KS4A 2FYEA 1N5WA 4LJAA 2MP2B 2WXIA 4OZAA 2KZUA 3Q8CA 2MR9A 4M02A 2WDTB 4QRXA 2XLJA 4HKZE 3A42A 1ZAEA 2DC7A 2YEPB 2XN9C 1CMXB 3SD5A 3RT3B 1NO1A 2KNZA 2VZKD 2QMTA 2P7UA 2DVWB 2NCNA 3TEYA 2K6BA 2R62A 4KIKB 2A4ZA 4L15A 3W31A 1YK7A 4WIPA 1LV7A 1ZXHA 3VDPA 4BB9A 2K47A 4M8NA 4NAMA 2ZNVB 3HU3A 1WE7A 3BXWA 3NBIA 3RPFC 1EWOA 4FN2A 2R6FA 1V5OA 1L1TA 3NVWA 1PQSA 2N9EB 2INCC 2IY1B 4OVUA 2WXGA 2F5QA 3DBRB 4W9CA 4DHJB 2L76A 1U5IA 1V80A 4G3OA 1JRPA 3FUTA 4KZ0A 5C18A 2R9OA 1BQIA 4GDLA 2DCCA 5FTNA 1J7KA 2KDBA 3MHSA 1WGNA 4UN2B 2WWZA 3ZQJA 3B08A 2XEPA 3MK6A 4OVVA 2HAKA 3QARA 1EWLA 2JXXA 2QSFX 1IY0A 1TZOA 2LGIA 1PJJA 4IBDA 3CF0A 5JA7A 1N61A 1UELA 4KVGB 2JA2A 3HY5A 4FIPA 2GRIA 2WGSA 3H8CA 1QDQA 3OJ4B 2BDZA 2DAEA 2J5YA 2KEBA 2D7EA 2E3TA 3QHTA 4BPVA 4BS6A 5JXVA 2MA9B 3PO0A 4LZJA 4ANUA 2GNOA 5K16A 2CFOA 3I01M 1YMHE 1FXTB 3UQBA 1CQDA 2FT2A 3BVZA 2MJ3A 2WXQA 1K50A 5ITTA 1EF5A 3IFWB 1Q3BA 2Z4SA 3OF8A 1WGHA 2JZ3B 3ETRA 4S0RA 1PPDA 2Z0DB 1H6UA 2LVOC 3N3KB 4AS1A 3UIOB 2LVAA 3E9SA 2Y6EA 1IBMM 1HXYD 3QJ3A 3W2DA 1J5EM 3AMZA 4CDCB 1XMOM 2AQ1B 2LZ6A 3U4EG 1V8CA 3ZJTA 2HJ8A 4DDID 1I4PA 1E5WA 2XK5A 4JPSA 4N8WA 5E6JA 2KWDA 4W9KA 1TDHA 4I05A 3LXFA 3ML9A 3QC8B 1L4ZB 3K1JA 1WJNA 4WAFA 2KVRA 3S2AA 4X65M 1LFDA 2IZVB 3GQ3A 2R2QA 1V92A 1T0RC 3L16A 1MEMA 1MHXA 3FKYA 5IN7A 1YQBA 1W5TA 1NEKB 5DPTA 2F4VM 4LGMA 2O6VB 5BYRA 3PSEA 4DUZM 2QNJA 2LH0A 3R7RA 2SAKA 3KXEC 1IBXB 1PXVA 2FBWB 3FUVA 3MHZA 3T3OA 4HXDA 3I9V1 4BOSA 2RMMA 4NY0A 3VUXA 1WJ6A 3CH3X 3A45A 4WQOB 3VAWA 2A5YB 1Y4HA 2INDC 4GHLA 1DYQA 3B89A 3F75A 3U52E 2ONQA 5DNYA 1ZP0B 1IY1A 5TR5A 3QCAA 2IBIA 2QILA 1KYIA 1SE3A 4JI4M 2CKHB 2LVPC 3IT6B 2KLGA 5I4DA 1M6DA 3GO8A 2RPVA 3PREA 2AIMA 3WHLA 2DWZB 2V6ZM 3T15A 3KQ4A 3FILA 3N32A 1CQVA 3PZ8A 1DGHA 1FO4A 3H7DA 2AYOA 3C3DA 2M5ZA 2QENA 1HQYE 1QDRA 1X1MA 4GGQA 4FJVB 3HGIA 5CHWA 3USVA 4DV5M 3H4MA 2V4IB 2N9LA 4ZHOA 4JI0M 4YYSA 3M62B 2MH8A 4F8CB 2X49A 2QHOA 3RI7C 1CSBB 1PYWD 3U6QA 4KGTA 3AEEB 3B9PA 1V86A 4H2AA 3W5VB 1X9YA 3MJ5A 4FVMA 3AE3B 3OF9A 3S3RA 2PE9A 1GPXA 5FR3A 2AHMA 1QKZA 4DR3M 2DJFB 4LNIA 3QYEA 4KZCA 2NQAA 1KRHA 3ECIA 3C9EA 3A4SC 4M9XA 2DWLA 2GB1A 3NUHB 1K3WA 4KV2A 4NRVA 3FAHA 4ZRPA 4G3XB 3N30A 3DCGA 5DFLA 3OAWA 4JI2M 1BVSA 1T6OA 2JWUA 4AQ7A 3VXWA 1HZ5A 4OELA 1KLGD 4DXFA 5JHBA 1T43A 3CF2A 1WIAA 2DZMA 3A1QB 4NNJB 4AP4C 4ARIA 1NENB 1BY8A 1RFKA 2DHRA 1WGKA 4CDEB 2H88B 4JI3M 3P4RB 4DHJD 4IBEA 2Y20A 3P4QB 5D2MB 2GBRA 4LZZA 2JPHA 1D5ZC 4K7SA 5PADA 4LF9M 1GABA 1E8ZA 3HJQA 4NOOB 3EFCA 2VHFA 1DGGA 2DENA 4IBFA 2CHXA 5AZGA 1SE9A 4P6VF 2BWFA 3C58A 2HD5B 1KJTA 3V3XA 4CQNA 1C76A 3B2GA 1WRIA 3A33B 3I3TA 2DZLA 4D82A 1VEGA 2X38A 1CK1A 2GFOA 1J19A 4OU7A 4LJ8A 3WANA 2V9HA 1E7PB 3V6EB 3QWZB 3CGWA 3K24A 3X0WA 1PRBA 3KLSX 3ZNID 4OZCA 5EQTA 3AI8A 1PGBA 1IXSA 4YSYB 1DGFA 2KMMA 3SEBA 4GUAA 4DBGA 1GMYA 3BYYB 1SB3C 5D94A 1OKSA 1JQJC 2KKCA 3IBEA 3KW5B 1TU6A 3HD3A 2WP9B 4MB7A 2YJ2A 4P1BC 1F29A 4DV1M 3QSDA 2LEKA 2O5RA 2JT4B 2NMQA 3GPYA 4B3TM 2W55A 4RKUF 4C56C 4KKIA 4MJSA 1TIFA 3B2FA 5A24A 3HJ8A 3VVWB 3VK8A 5CVOB 3FKEA 3KDSE 2Y0TA 1XLOA 4N79A 4C7YA 3U6SA 2BYFA 1XCQL 3E46A 2WXHA 1NHWC 1V6EA 3F92A 2X4AA 1OTRA 3HX3A 3TPZA 1VZ6A 2WZJA 4GDKB 3NZUA 3LFYA 1CJLA 3WXFA 1QUTA 2O6VD 1GJSA 4LJ6A 2GBNA 3M7GA 4G54A 1MJGM 2H5XA 1QILA 4AZFA 1G41A 1IYFA 1PBHA 2FQ9A 1TBEA 2KT7A 4TUWA 2N1WA 1BMLC 4US8A 1XWIA 3SMSA 2QPAA 1D2NA 3JR5A 2AL6A 3Q3OC 1KSFX 3PHWA 2BWBA 1I4GA 3NBXX 1L0YB 2VDBB 2DYBA 3AEBB 3QYBA 3HHYA 3BPFA 4ANWA 2HHHM 2XK5B 1WJ7A 5FSWA 4AG5A 1YD8U 1ICFA 2O2VA 2BJWA 2INNE 3Q8FA 1MVKA 4IUMB 3UGBB 5LXIB 3KX1A 4G4RA 4W9IA 3AV0A 3SBJA 1G3IA 1SXJC 2L4FA 2LFIA 4LK0M 3RZFA 2XFSA 1QQRA 2Y5PA 4L2YA 3SU8X 4QH6A 3X23A 4XZ4A 2K0BX 1AUAA 5EZSA 2V3SA 4M9ZA 4TMAB 1WIVA 2YQZA 3C3EA 1ZE3D 2W3SA 1ZV1A 4MEMA 4A9AA 5DPWA 3QQ8B 4LRTA 2D11A 3AE6B 4F1IA 4EFOA 4CDFB 2HCBA 2WX1A 3I57A 1PFDA 2LUEA 4AXMA 3BY4B 3ZNHB 4YYRA 1NVMA 1WR6E 2DZIA 3BIID 2J7QA 1MG4A 2KMAA 4MACA 5CVNB 1RRBA 1L0VB 1S1QB 3ZIMA 1GO5A 4MT5A 4HROA 2K8BA 1AWDA 3FILB 4NZLB 3VK7A 3SYLA 2PEAA 2D2QA 1R6BX 5FPWA 4NPNA 1LTMA 2W9NA 3P2BA 1YNTE 5EF4A 2Y0QA 4DV3M 5AZFA 2LD9A 4FBJB 1GB1A 1HTOA 1FIQA 3NS1A 2G6DA 3ZRCA 2NQIA 1ROEA 1SJED 1JCKB 4FADA 3BWUD 2FUHB 2ZPNA 2K22A 1P1AA 4BBAA 1WM3A 3AE8B 4II7A 2K0PA 2J42A 4CHKA 1MU5A 2PIAA 2MP2A 4YTMB 1N77A 4MELA 3ZDTA 1J0GA 4DHZE 4NXNM 3CH2X 2JZ0A 1CB5A 3LDZE 1NSFA 3GP1A 3DBLB 3AL0C 2H89B 4JN6A 3KWVA 1TGUA 3WAPA 1ZXIA 3KWLA 3U61B 1TJEA 1H8CA 4A8XC 3N3GA 2D07B 3AOEC 4IP3A 5CHVC 2KRKA 3RVWA 3UMMA 4NQLB 1QAQA 4AJYB 2CUZA 4CDDB 4HJKA 4WP2A 1VDVA 3AEAB 5L8RF 1W5SA 5KHOA 2DJGB 1NNJA 3SR6A 2AWTA 4CGYB 2G3QB 4KDIC 2C98A 3NVZA 1ZMVA 3K9OB 1N5XA 3MORA 3PDFA 1PCIA 4L16A 2JRIB 3ZXRA 5IA7A 2XFTA 2L1AA 2RGFA 2HWKA 4IWOA 1JR3D 2N7JA 4P17A 4X57B 3GLGE 1HE8A 2JQRB 4FWDA 1HT2E 4Q7JA 5ITXE 1YQ3B 2MX2A 2R44A 1UZXB 2BGFA 4XX5A 3W1SA 3NHEB 1QVRA 2EKFA 1QOBA 2OEDA 4DDGD 4HLEA 4M8MA 4W5WA 1XEEA 2WXNA 3UK6A 3DVNU 5KPRA 1WX7A 4KSKC 3Q8BA 4X66M 1G8PA 2KDIA 3U60B 2WU2B 3PW3A 1P7FA 4A55A 3W0LB 1E7VA 4D2KA 3ZXVA 2L7RA 2KLCA 2NBVB 1PGXA 1Z5CA 5HHDG 2HHNA 3BPMA 3PFIA 4G4QA 3BK1A 1FPYA 5C2TB 1NY5A 1YLAA 3LVWA 4KLNA 3RNGC 1V97A 3EIHA 3N3KA 1HQRD 5DYGA 2DYOA 1F2AA 3CTWB 1LGRA 4GLSC 2L3ZA 1WHCA 4YSZB 3U6CA 4MJSB 3MHHA 3HU2A 4I5SA 3TL5A 1TTNA 1GCBA 1SIFA 1K8RB 1TS5A 6PADA 4L8RC 4RF0A 2FFJA 2EA0A 3ML8A 1C3TA 2ZANA 3PGEA 3KUCB 3U8EA 1Z59A 3M63B 4JI5M 1EO6A 1ENFA 3AI5A 4RM9A 1EF7A 3IG8A 4REZA 1XLPA 2NVUI 4WQMA 4RM8A 5D3DA 2M0XA 2ZBKB 5EE1A 1SNKA 3RVVA 1R4NI 4MZSA 2IPPB 2GBJA 2O6VA 3U6DA 3HRDD 4DQOC 2A5UA 1XF5L 2ON8A 1IBXA 1TR8A 4P6GA 2KXJA 1EWMA 4FWGA 1PPPA 4JX1C 4MGKE 4XGAB 4BVUC 3GLHB 1FD6A 1L4DB 1R2ZA 3AU4A 3E21A 5BMIA 3B7NA 2D3GA 5IKCM 1J7AA 4LJ9A 4D80A 2G4SA 1V33A 2RR9A 3WIMA 2I2YA 5IAAC 4HPPA 4Q8HA 3SC3A 1RFAA 2XU4A 4N59A 2DNAA 3OG5A 1ME4A 1U9VA 2EO2A 4DR4M 4DUYM 3GOEA 1YSYA 1QT9A 1WJUA 2M19A 4NJ7A 5AUIA 2O25A 4G4NA 2ZVNA 3PZ7A 3PZDA 1JQ4A 1KXRA 3RYTA 3NZ3A 4YWGG 2FIFA 2PE6B 1BGOA 1ET6A 1T3TA 2BS3B 3T6PA 4GB9A 4EZLA 1FH0A 3AE4B 4I4LA 1GJZA 2KC2A 2MLBA 1AARA 1DGBA 5JI3E 4ZDVA 1HTQA 3TEZA 3P5WA 1JWSD 3V76A 3TMPB 1EU3A 1TKYA 2FIDA 5CVMA 3VTUA 3LQQA 4KT0F 3HM6X 4OHJA 2KDFB 4PADA 4AQYM 1HEZE 3MTNA 4LCBA 1DOIA 1CJEA 4B3SM 2BQQA 2YFQA 4P1CC 1L6VA 4BLCA 2KQ7A 3I04M 2C0YA 4BQVA 3DVNV 3BWKA 3R2TA 5J94A 1R2YA 3B1LX 1WMHB 2PVGC 1CTEA 1E9RA 2KJHB 2ZEQA 3SFEB 2IO1B 1R5LA 3K92A 5T8IA 1D3ZA 4IBKA 4ASWC 2VHSA 1V81A 2PBHA 1HNWM 3VH4B 2JUJA 1HNXM 4RH6A 2ARYA 3P4SB 4PS3A 3MC8A 1P3QU 2Z8YM 2KFJA 4W9DA 2AVWA 1VD2A 1FFUA 1AYVA 3A1QA 2MSED 4LF5M 3SDLC 1GKIA 4CO7A 2WYQA 1TS3A 1L6UA 2L52A 3THGA 4ANRA 2M1MA 2NBWB 4NC6A 4I6PA 4IOIE 1BT0A 2FRQA 3K9MA 3C19A 4ZRQA 2UYZB 1VEJA 1ZGUB 1E0ZA 2XEWA 4N6EB 3U6LA 3CMMB 3U6MA 2L7HA 1WX8A 2O6XA 4MSXA 2D3AA 1P9DU 2MBHA 1UBQA 1NDDA 1L2DA 3DBHB 4AJWA 2ZAOA 3BYTB 1JWUD 2CE7A 5EP3A 4I8OA 1MI0A 4L78A 2Z0EB 4J3OD 2LHEA 4B0EA 1WYGA 4X62M 2KDLA 3N1YC 2HD5A 2FCMA 1XNRM 3P63A 4AI6A 3LJ3A 3J27B 2UXCM 1TYGB 2I1JA 3IVFA 1U4AA 3BINA 3ONSA 1GC6A 2LGXA 4LNNA 3PVSA 2G7YA 2V1CA 3EGRA 1C79A 4DR7M 2JY5A 4I07A 1JALA 2JY8A 5C1ZA 5H37D 1EE8A 3V6EA 3SAVA 4FCVA 2J53A 1K3BB 4WJOA 2FNJB 2GOWA 3VKHA 1ZQ9A 3PS6A 2DBYA 4GXBA 1XB2B 1IGDA 4KX6B 1QF6A 1YQ4B 1WXMA 5G55A 2DNFA 1IN5A 5C1BA 3JW0X 2JXTA 4G4OA 3SATA 4E74A 2ZW0A 3ABVB 3NZSA 5FTKA 3W1YA 1QQWA 1K52A 1TL9A 1JR3A 3VQIA 2AS8A 2R65A 4W9JA 4R7GA 5KPTA 4Z8XA 3IMAA 4PP1A 2WSEF 2E00A 1BXTA 2K25A 4NQKE 1MHWA 4YTNB 2F5PA 1JRUA 2KJRA 2NR2A 1UM8A 2NPTB 2M60A 4M00A 1Z5BA 3QIJA 4B3MM 1OAOC 3AKZA 1WFYA 4GDKA 1G71A 1CS8A 3GCBA 4TSSA 4I6NB 3MTVA 2C9OA 2LVQD 1P7EA 3IHPA 2JWZA 1C1YB 3URYA 1FJGM 1WI0A 1S3SG 4PYZA 4IWQA 4IM3A 4B6WA 2CIOA 4DV7M 2QCUA 4KHPM 1TY2A 4YYUA 4QNRA 4EZKA 4EIWA 2DAIA 5EGWA 1N75A 2PNSA 2R9MA 2BTWB 1WH3A 4YT0B 4GN1A 4IUMA 2XF3A 1XXHE 3LCVB 3GLIB 4LJ5A 3R66C 4NJCA 2J7NA 1SXTA 1VZ7A 2FRAA 4YHHM 3JR4A 4RF1A 4IM0A 3E1ZB 3T1HM 4IWPA 5AEKB 1JW9D 1FEHA 3RVXA 3SFZA 2MBEA 1WXVA 3UINB 1CPJA 4XWTA 5FK9C 3UF8A 1ZIVA 2KXEA 1FNUA 3KUDB 2GQFA 1THEA 1PGYA 2J0JA 4ZTBA 3A9JB 3N20C 1EM7A 2YVCA 4ARCA 3Q6BA 1VG5A 4A3PA 2CV2A 4FW9A 3HUIA 1WZ0A 2WHIA 3ZQ4A 5BYSA 4TQ1A 3BY4A 3ZNHA 3BBZA 2JRHA 4ZUXU 2GHUA 3DZDA 1POPA 3GRVA 1Y56A 4FJCA 2BVCA 2Z59B 2C7NB 2WQYB 1FRRA 1RLFA 1OEYJ 4FHKA 1S3SA 3BOSA 3HK0A 3Q8XA 3PHXB 2R45A 1N62A 4W5CA 4LTUA 3U8ZA 2CS4A 4JI6M 2M56B 1LXDA 2L4EA 4LFCM 2WDRB 3Q2AC 2BKRB 3B7QA 2I1KA 1XO3A 3LB8C 3L13A 4EUTA 1ITOA 3P5XA 3QAUA 4LGYA 2ZPYA 1TY0A 1TT5B 4HDQA 2WS3B 2KNBA 1N6ZA 5BR8M 1TKEA 2HDEA 3MJWA 1KFUL 4QOZC 3J7AS 4B7GA 4ITKA 4GRIA 3MTNB 1PJSA 1NLJA 4L23A 2LHGA 2D5GA 3RD2A 3K8UA 3ZTCA 2W54A 5F02A 4HL4A 1L5PA 2ZCBA 1SGHA 2VF7A 5J2RA 1ZMUA 3P5VA 3PBHA 1IN4A 4BOZB 3AOEA 2KD0A 3DBHI 3TEWA 4XZXA 1ZKHA 4IDIA 2G8LA 3SARA 1T0YA 1UGJA 4IC7B 2PJHA 4US9A 3U61A 3PLVA 2ZTCA 2QBYB 5JZEB 4YVAA 3U2SC 3RNEC 1AIPC 1IGCA 1PPOA 3AFHA 1Z2MA 2KX0A 3WXEA 2LNHC 4MH8A 2FNAA 2JQGR 4LJOB 2EMSA 4BKGA 4XR7A 4CISA 1HT1E 2W82A 1F2RC 4LNFA 3N1XC 2AL3A 2MEKA 4ZHPA 3MC0B 2N7EA 2QZ4A 2F5NA 4LFAM 1OGWA 3MP9A 4QNMA 2LTUA 2G3QA 1QANA 5D6JB 4JQWC 2E01A 1NI2A 2C9WB 4JI7M 2RD0A 4YTPB 2CB5A 3K9OA 1G59A 2JRIA 1VRAB 4HEA1 3KW6A 7PCKA 3E56A 4N58A 1C4CA 2KDMA 4P7IA 3LQRA 3PRMB 1V34A 5KQ8A 1OIZA 4FLHA 4PYUA 2N9PC 3DFZA 1UBIA 1C78A 3NHEA 2ACTA 4A3VB 2DWQA 1FXAA 1L7YA 1KF6B 1SIJA 3AV8A 1JWMD 2DX5B 2B76B 3VRBB 1DF0A 2E03A 1TH4A 1EU4A 2QEJC 3PRPB 2EUCA 2L0FA 1VEKA 3N9YC 2XH9A 2ICIA 4CYEA 1E94E 3U60A 1GC7A 2N9XA 5DPSA 3NRZA 1OQYA 1GNUA 2WLBA 4MGIE 3VH3B 1FNWA 2R4JA 4D8EA 3RFWA 1FM0D 2M4NA 3RE8A 2G9HD 4HDOA 2HKJA 2IGGA 2TSSA 3H6SA 4R3DA 2MJDA 4HPLB 4WURA 2EELA 4GIPA 4IIWA 3GB1A 2AU1A 4W9HA 4DXGA 4YY3M 2J0MA 3J9CA 2K6DB 2DCDA 3IOQA 3PLUA 3HHXA 4K3CA 2N35A 3V6CB 1QMYA 1RYJA 8CATA 3WHKA 3J80S 3GLFE 1UWXA 3MC9A 4DV2M 2R9CA 1KH0A 2ZAMA 1XCTL 3GZNI 4C4VB 1D0MA 4IG7B 3FTFA 1WGGA 2X8AA 4JXJA 3ZCBB 1ZDXA 3VDUA 4M01A 4B9KA 2R46A 3HU1A 2LUMA 4USAA 3KW9A 3KH0A 3A46A 5E26A 4TKNA 3TWKA 3FE3A 5DCNA 2BYVE 4JWSC 4B95A 3KP0E 3NJTA 4WJNA 5EP4A 2OJWA 4ICUA 2LVQA 3I5JC 3KYCD 4RGTA 5JH5C 1XKGA 1E9MA 1OQQA 1SXJB 2BWEA 3IEJA 3HVDA 3NS8A 1SBBB 3DHGC 5MPOA 1OFIA 3AEDB 2G45B 4M0DA 1MG8A 3EHVA 3KWBX 3R9XB 3GLHA 4L6V6 3C8YA 1IQPA 3C0RB 5E6PA 4AXLA 1PGAA 3VR8B 2NTTA 4QHSA 2HTME 4GKJM 2JWSA 1HQCA 4URKA 3VTVA 4ICVA 3W9CB 1WWTA 4AKHA 4LNKA 4WJQA 1MPEA 1XMQM 2I38A 3IAS1 5GKNA 3LW5F 3BCNA 1EIJA 1IXRC 1R4NB 4KDLB 1KLVA 1I42A 2XU5A 1R4MB 2WXOA 3APCA 5BPVA 4FHJA 4WAAA 4LG2A 4FCWA 4WH4A 9PAPA 1ZW7A 4BSQA 2XU3A 5TSSA 1CV8A 2KOXA 2Z4RA 3HZJA 4IBBA 3TMPA 2N0SB 1KM7A 4EKUA 4DMXA 2FOIC 2KN4A 2KWVB 2ATOA 1JMLA 4G6ZA 3R7QA 1XT9B 2WNMA 1TH3A 1EUVB 3AE2B 3QJZA 3D8BA 3QK0A 1NB3A 2NTSA 4FCTA 2AEHA 3PTFC 2DZZA 2ZM6M 2DWMA 2KW0A 3Q3MC 3I51A 4B3RM 5EE9A 1YJ1A 2F5SA 4CZWA 1TH2A 2LI5A 2CJOA 1UWMA 3M95A 1FNNA 3ENEA 2FAZA 1XNQM 1WMHA 2V4LA 4HRSA 1J8CA 2CWBA 1I4XA 4I04A 3B79A 2R4EA 1D0LA 1WGLA 2CHGA 3L2AA 2R61A 3V60A 1MDWA 5CHTA 3UGJA 2MQJA 3B21A 4LF8M 3RNAC 2NQGA 1YJJA 5DPRA 3M99A 4XUIA 2DAGA 3GS2A 3WAOA 2YJ8A 1OQRA 2KFKB 1LO5D 3H9DA 3FRHA 2K6QA 3AE5B 2PTLA 1A5RA 3DA1A 4DK5A 1NL6A 3M0EA 3ZNZB 2R9NA 2GBMA 1HR0M 1NQCA 1N60A 3BVGA 1SF0A 2OQ4A 5F3WA 1GL7A 3ZNGC 2LMCA 3W68A 5EXXA 2EKKA 3FC4A 4NXMM 4UDUC 1C9FA 2WXLA 3SYKA 2KWCA 8PCHA 1KOTA 4MSQB 4M9SA 4EE2A 1AN8A 1DGJA 4YXDB 1ZPSA 1V1PB 3DHHC 2KMCA 2AGAA 4K3BA 1C1KA 3RUIB 3TJPA 1PVJA 3I06A 4HWYA 1GG3A 2BB5A 1GLNA 2B1NA 3MMPA 4S17A 4RGOS 3GRUA 2OOAA 3ZW3A 4PI3A 2OJRA 2VH2A 2L8JA 2D7HA 3SHFA 3FTDA 1NNUC 4X6JA 3W67A 1M94A 4LCDE 3IAM1 1IBLM 5EP2A 2L7IA 2KTRA 2MROB 1PADA 2KZSA 2UU9M 4ANVA 5ITUA 1UKFA 1VSNA 1MX0A 2AQ2B 4KSLC 1AU2A 4XK8F 3FRIA 3U5ZB 1GAQB 4DWFA 2BB6A 2JYEA 1IP9A 1MIRA 4K7CA 3HHAA 1NBFC 3M3JA 3PNYA 1V9JA 3WALA 1IN7A 3QA8A 1E9SA 3T3NA 2DC6A 3TE6A 1U9WA 1R7RA 2LRUA 1WX9A 2FCSA 3L54A 2Y3AA 2PADA 1EWCA 1SE4A 1OFHA 3N4CA 1PJTA 1DO2A 2NPTA 1GB4A 2CU1A 2LVOA 5L83A 3TIXA 3M6AA 1TGZB 4NSOB 3EC8A 1NB5A 3J81S 3ZUAA 4EOYA 2ACZB 3L4PA 2FCQA 2KHWB 4HKQA 3BOWA 2ZCCA 1ATKA 3J2PB 3K8ZA 3HM3A 2DZNB 4CHTB 3Q8AA 4ZYNA 5LXHA 3ZUNA 1I35A 3K9PB 1SXJD 2AYNA 2ZW1A 2DAFA 3DVGX 4BS5A 1I94M 2D3CA 2KC1A 3IUTA 3B0AA 1Z5SB 2KX3A 2FUG1 1ESFA 4M0WB 5ITQA 1QZEA 1I4RA 3AEFB 3AM9A 4JI1M 1STEA 3ILKA 3JSVA 4BKSD 1R7SA 1SJHD 5G5GA 1AW7A 5FR6A 1AYWA 3TWLA 2BTWA 2B1MA 2DAKA 5KQDA 4LDTB 4LRSA 4DR6M 1FNVA 3GLIA 1VJKA 4TUUA 3UQAA 1N33M 1XLNA 3KOWE 2WX0A 1DOXA 4A5UA 3AN1A 2IO2B 1FFVA 4X64M 4F1SA 2M8SA 3H7SA 4EEWA 2JY7A 4JI8M 3VR9B 3L08A 4ZRJA 1R4MI 1Z5AA 2DOSA 2V0GA 3B74A 1VR9A 2KA6B 2WXJA 5EE0A 2APLA 3ZGZA 3A9JA 3Q3FA 2XZFA 1ISNA 1XLQA 2LVPA 3AE1B 3BZDB 1EF1A 5E6OA 3CWIA 4DV6M 1Y8GA 2L2DA 3DOAA 1D5MC 1A5TA 2F1GA 4QRGA 2YEPF 1I4QA 3N1ZC 2LGDA 1Q6KA 2C96A 2K1FA 3NG0A 1ORYB 1IUEA 4RFBA 1YALA 3RGPA 4XDDA 3DVGY 1AYFA 3H89A 2DAMA 1Q3CA 2LASA 3OJ3A 3L25A 4OZBA 1UH6A 3LYYA 3VFKA 1GVNA 1V2YA 1YX6B 4OEMA 3ZLZA 3PHXA 1Q10A 2KO3A 1QUSA 1OIPA 1HJPA 1NV9A 3AXCA
chains in the Genus database with same CATH topology
1YN5A 5KO3A 2YNMD 3I4YA 3L28A 1QAMA 1TDZA 1N34M 3SFDB 1D5XC 4IBIA 3L26A 1T6BX 2INPE 4LJ4A 2AX5A 5FTLA 3FTEA 3LMMA 3KFUG 4BOZA 5ITRA 3GQ5A 5D3IB 1WXQA 3U7ZA 4OVZB 4D8BA 2QBYA 5JZEA 2LXEA 1F0ZA 3GRRA 2CHVA 3Q69A 2CJNA 1NYRA 1N63A 4RNAA 2J7QC 3E4RA 4DR1M 4FWHA 1YJIA 2K3UA 3V05A 1IBKM 4D81A 3PHUA 4B7FA 2VIIA 4MI7A 2CV0A 3PRMA 2FE8A 3R8FA 5FLXS 3IXSA 1FRDA 2BBCA 3UI3A 4I81A 4WW0A 4LF6M 3AEGB 3MHVC 2IGDA 2CV1A 1IN8A 3BBAA 3AOGA 3PRPA 3ZYYX 3SASA 2LHDA 3OTOM 3GQ4A 4L1BA 3O13A 2UXDM 3HVZA 3MP2A 4PD2A 3A98B 1V1OA 3FUWA 3KOYE 1F77A 1NVID 2PVOD 3K2LA 1PJIA 3P42A 4GC9A 4MGHA 4A6QA 3ZJVA 2HL7A 2J52A 2XSZD 5EZQA 3HHZA 4GITA 3RNVA 4Q2JA 2QP9X 4NSRA 1PUTA 2E6XA 5GXGB 2BS2B 2BYTA 1SXJA 4GHAA 3B9JA 3OQCA 1C77A 2WXFA 2D7GA 3C0RA 3TEXA 4L4UA 3FYCA 4MH0E 5LMUM 3IFUA 2EKIA 2C99A 4ITQA 1D6EC 3SHGB 1E32A 2K9XA 2RDHA 4XGIA 4NAWB 3AE7B 1NI3A 4OW0A 1J09A 4RGNA 4IKGA 2JYTA 1OJLA 1XHBA 4S12A 4DR5M 3HHWA 3KOXE 4HLQA 1HNZM 2DWNA 4HJGE 1NJFA 4FXCA 4Z6YA 2H1RA 1PM5A 3RGSA 4JE3B 1T5XD 3GRYA 2RDGA 1SE2A 4QHTA 3EA6A 2E5LM 3BK2A 2WXKA 5C3JB 1L1ZA 2CHQA 1YE9A 2QSDA 3L27A 3VLFB 4MM3B 2DXIA 3EIEA 4LJ7A 1QOFA 2L09A 3ZH9B 4O1NA 5D7GA 2XZUA 1I7HA 1L2CA 3SMPA 2IJ0A 2OPFA 2PMVA 3UZUA 1K3XA 4AG6A 5EJCA 3GLGB 2L83A 3VKGA 2RGHA 1C4AA 3PNVA 3ZC7B 3KSXA 2UUAM 3CF6E 1FCCC 1G4AE 4KKJA 3SAWA 1ZUD2 1YN4A 3W0FA 4FD2A 5FTJA 1V1PA 1DKIA 2WXRA 1UUPA 1JWBD 2LJIA 4B08A 1UNSA 5HFYA 2JX5A 2DZOB 3OWEB 3I4VA 3KS8A 3FUUA 2P5TA 4PDIA 5KPZA 3JAMS 2BT6A 4B0MA 1ET9A 3U5ZA 1GOZA 1XXHA 3T38A 4B7HA 1IY2A 1QLBB 2BJVA 4PCZA 4BOQA 2Z3XA 4MGZE 2F5OA 3SAUA 2NQ8C 1NY6A 1SSNA 1N36M 4LF7M 3GP7A 3R2IA 4RKXA 2WXPA 2JU6X 1EWYC 1VZ8A 2CU3A 1DOYA 2V3PA 1QZMA 1NJGA 3FYDA 4QOSA 1KLUD 2I7PA 2UZJA 3AE9B 1HZ6A 4TQ0A 4M0WA 2BTEA 4KODA 1L8QA 1GL6A 2L32A 4NRWA 2KAJA 1YZBA 3MFGA 1KFVA 4GDLB 4GH9A 2G1EA 2PKOA 4BOPA 3KOZE 2QJLA 1TS2A 5EXTA 1M4VA 3RFZB 2XSZA 4ZOHC 4DV0M 3P1MA 4LLGM 4LFBM 2BNKA 4DV4M 3ZJUA 3TQSA 4OX9M 4C7ZA 3PXGA 3NVYA 4XDCA 4P16A 2GI9A 4JV5M 5HI1A 5IZ7D 5G5HA 2ERCA 5LMNM 3GPUA 2SEBD 1PDXA 1B9RA 3TSSA 4YSXB 4PT5A 3FD9A 4JYAM 2BU3A 1YN3A 3KSJA 3TRKA 4GMQA 1SEBD 1N78A 4KO8A 1D4BA 3J7BA 4HXDB 2WDQB 4RGMA 3EUB2 5IT9S 2Q2EB 1A70A 2W3RA 2I7NA 1F2RI 4OVZA 2CEAA 4D8IA 5DYIA 2Y5CA 4DR2M 2BW2A 7CATA 3CIRB 1IM2A 3VFDA 2R18A 3KP1E 5BMGA 5EP1A 3IG5A 1DGHB 1JWAD 2PW9A 4AW4A 4C80A 3NWLA 1QYRA 3GPXA 1K51A 1YUBA 1Q39A 4KGRA 2XNAC 5FKAC 3GLFA 5BYQA 1Z6TA 5ITYA 1JROA 3HKPA 1N32M 2V1UA 4GC5A 4ZYSA 1FCLA 2KQ4X 3WCQA 1I4WA 1HA5A 5H8YE 3LVVA 4A90A 1DO0A 3HJSA 1KTKA 1XXHB 3W5UB 5EXSA 1OFFA 3BVMA 4XWWA 2Z84A 3TWMA 3TUOA 3DWMA 4K0KM 3T1YM 1TS4A 2VQEM 3AECB 1K53A 2VZKB 5IREB 1I4HA 1L0XB 4XE0A 2IPKD 1FMAD 4IJFA 4MGYE 2Y21A 3IT4B 4NL4H 2AQ3B 1E10A 3VRAB 1IXSB 4WWMA 5LNK1 4KGSA 4XBOA 4IBJA 5A2QS 3DWGC 3U6PA 1CZPA 2RGOA 1VDDA 3L29A 1RWSA 1MHHE 2J7OA 3QWLA 2WDVB 1K82A 5FTMA 5JI2E 2G5GX 1NHGC 2L6OA 5AUKA 4AKIA 3U6OA 1XC8A 2IGHA 5HG2A 2OHFA 3U6EA 1J7CA 1FXIA 2RKOA 3UJNA 3AB5A 2MH7A 2LWXA 1E6EB 4LF4M 2M0AA 5BMHA 2K5PA 3NVVA 3P4PB 5EE3A 3AH7A 3H8HA 5H92C 2QIEB 5IWAM 2JTCA 2KRUA 4IBCA 1WSPA 2KACA 3FUXA 2UUCM 1J7BA 3D8LA 2BS4B 2Z7JA 2XGNA 2N9KA 1NYQA 4BOUA 2UXBM 2C5RA 1TKGA 1B1ZA 1BUIC 2DLBA 2Q5WD 4RCOA 4GKKM 4PDGA 3GLGA 5ITXA 3HWSA 2WXMA 3AJIB 4IBGA 3KVWA 2V3NA 3GPPA 1QOGA 2WU5B 3O65A 1XXGA 2J4XA 4ZPXA 2VQFM 3PT2A 1C4PA 5EXPA 4LY6A 3R8BA 1SXJE 3W30A 1ZOYB 2C9CA 4AKGA 2JZPA 1ZDVA 1IXZA 1RM6C 2YR0A 1IN6A 1QAOA 3TL4X 2UUBM 1VLBA 4IJEA 1ACCA 3BB7A 3FTCA 2PLPA 3Q8EA 2Z8LA 2IDYA 4JWUC 1QOAA 1L2BA 2JSVX 1X37A 2MJEA 1KFYB 3GLFB 2DYMA 1T3QA 3KS4A 1N5WA 4LJAA 2WXIA 4OZAA 2KZUA 3Q8CA 2XLJA 4HKZE 3A42A 1ZAEA 2YEPB 2XN9C 2VZKD 2QMTA 2DVWB 3TEYA 2R62A 3W31A 4L15A 4WIPA 1LV7A 1ZXHA 3VDPA 4BB9A 2K47A 4NAMA 3HU3A 3NBIA 3RPFC 1L1TA 3NVWA 2WXGA 2F5QA 1JRPA 3FUTA 5C18A 5FTNA 1J7KA 2XEPA 3MK6A 1IY0A 1TZOA 2LGIA 1PJJA 4IBDA 3CF0A 1N61A 2JA2A 2GRIA 2KEBA 2D7EA 2E3TA 5JXVA 3PO0A 4LZJA 2CFOA 1YMHE 3BVZA 2MJ3A 2WXQA 5ITTA 1K50A 1Q3BA 2Z4SA 3ETRA 1H6UA 4AS1A 3E9SA 1IBMM 1HXYD 3W2DA 1J5EM 3AMZA 1XMOM 2AQ1B 3U4EG 1V8CA 3ZJTA 1I4PA 4JPSA 5E6JA 2KWDA 1TDHA 3LXFA 1L4ZB 3K1JA 4WAFA 4X65M 3GQ3A 1MHXA 1W5TA 1NEKB 2F4VM 4LGMA 5BYRA 3PSEA 4DUZM 2LH0A 2SAKA 3KXEC 1IBXB 2FBWB 3FUVA 3MHZA 3T3OA 3I9V1 4BOSA 2RMMA 3A45A 2A5YB 4GHLA 1DYQA 3U52E 2ONQA 5DNYA 1ZP0B 1IY1A 2QILA 1KYIA 1SE3A 4JI4M 3IT6B 5I4DA 3GO8A 2RPVA 3WHLA 2DWZB 2V6ZM 3T15A 3KQ4A 3FILA 1CQVA 3PZ8A 1DGHA 1FO4A 2M5ZA 2QENA 1HQYE 3HGIA 4DV5M 3H4MA 2V4IB 2N9LA 4ZHOA 4JI0M 2X49A 1PYWD 3U6QA 4KGTA 3AEEB 3B9PA 4H2AA 3W5VB 3MJ5A 4FVMA 3AE3B 1GPXA 5FR3A 2AHMA 1QKZA 4DR3M 1KRHA 4M9XA 2DWLA 2GB1A 3NUHB 1K3WA 4NRVA 3FAHA 4ZRPA 4JI2M 2JWUA 4AQ7A 1HZ5A 1KLGD 4DXFA 3CF2A 4ARIA 1NENB 1RFKA 2DHRA 1WGKA 2H88B 4JI3M 3P4RB 4IBEA 2Y20A 3P4QB 4LZZA 1D5ZC 4LF9M 3HJQA 4NOOB 1DGGA 4IBFA 4P6VF 3C58A 3V3XA 4CQNA 1C76A 3B2GA 1WRIA 2X38A 4D82A 1CK1A 4OU7A 4LJ8A 1E7PB 3KLSX 4OZCA 5EQTA 1PGBA 4YSYB 1DGFA 2KMMA 3SEBA 4GUAA 3BYYB 1SB3C 1JQJC 2WP9B 4MB7A 4DV1M 2LEKA 2O5RA 2NMQA 3GPYA 4B3TM 2W55A 4C56C 4KKIA 3B2FA 3HJ8A 3VK8A 3FKEA 3KDSE 2Y0TA 1XLOA 4C7YA 3U6SA 1XCQL 2WXHA 1NHWC 2X4AA 3TPZA 1VZ6A 4GDKB 4LJ6A 3M7GA 1QILA 4AZFA 1G41A 4TUWA 4US8A 1BMLC 1XWIA 3SMSA 2QPAA 1D2NA 3JR5A 3PHWA 1KSFX 1I4GA 1L0YB 3AEBB 3HHYA 2HHHM 5FSWA 4AG5A 2BJWA 2INNE 3Q8FA 1MVKA 4G4RA 3AV0A 3SBJA 1G3IA 1SXJC 4LK0M 2LFIA 2XFSA 1QQRA 2Y5PA 4L2YA 5EZSA 4M9ZA 4TMAB 2YQZA 1ZE3D 2W3SA 4A9AA 4LRTA 3AE6B 2HCBA 3I57A 1PFDA 1NVMA 2J7QA 3BIID 4MACA 1L0VB 4MT5A 4HROA 1AWDA 3FILB 4NZLB 3VK7A 3SYLA 1R6BX 1YNTE 2Y0QA 4DV3M 1GB1A 1FIQA 3NS1A 1ROEA 1SJED 1JCKB 3BWUD 2K22A 3AE8B 4BBAA 4II7A 2K0PA 2J42A 1MU5A 2PIAA 4YTMB 1N77A 4NXNM 1NSFA 3GP1A 3AL0C 2H89B 4JN6A 3KWVA 1TGUA 1ZXIA 3KWLA 3U61B 1TJEA 4A8XC 3AOEC 4IP3A 2KRKA 3UMMA 1QAQA 2CUZA 1VDVA 3AEAB 1W5SA 1NNJA 3SR6A 4CGYB 2C98A 3NVZA 1N5XA 4L16A 2XFTA 2L1AA 2HWKA 1JR3D 2N7JA 2JQRB 4FWDA 1HT2E 5ITXE 1YQ3B 3W1SA 1QVRA 1QOBA 2OEDA 4W5WA 1XEEA 2WXNA 3UK6A 5KPRA 3Q8BA 4X66M 1G8PA 2WU2B 3U60B 1P7FA 4A55A 3W0LB 4D2KA 5HHDG 1PGXA 1Z5CA 3PFIA 4G4QA 3BK1A 5C2TB 1NY5A 3LVWA 4KLNA 1V97A 3EIHA 1HQRD 5DYGA 2DYOA 3CTWB 4GLSC 4YSZB 3U6CA 3HU2A 4I5SA 1TS5A 4L8RC 4RF0A 2FFJA 2EA0A 2ZANA 1Z59A 4JI5M 1ENFA 3IG8A 4REZA 1XLPA 4WQMA 5D3DA 2ZBKB 5EE1A 3HRDD 3U6DA 4DQOC 1XF5L 2ON8A 1IBXA 4FWGA 4JX1C 4MGKE 3GLHB 1FD6A 1L4DB 1R2ZA 5BMIA 1J7AA 4LJ9A 4D80A 2I2YA 3SC3A 4N59A 2EO2A 4DR4M 4DUYM 1YSYA 1QT9A 2M19A 5AUIA 4G4NA 3PZ7A 1JQ4A 3NZ3A 4YWGG 1ET6A 1T3TA 2BS3B 3AE4B 4I4LA 1DGBA 5JI3E 3TEZA 1JWSD 1EU3A 1TKYA 3LQQA 4OHJA 4AQYM 1HEZE 4LCBA 1DOIA 1CJEA 4B3SM 2YFQA 1L6VA 4BLCA 3R2TA 1R2YA 2PVGC 1E9RA 3SFEB 3K92A 5T8IA 4IBKA 1HNWM 4RH6A 1HNXM 3P4SB 1FFUA 4LF5M 1GKIA 1TS3A 1L6UA 2L52A 3THGA 4IOIE 4ZRQA 1E0ZA 4N6EB 3U6LA 3U6MA 2L7HA 1L2DA 2ZAOA 3BYTB 1JWUD 2CE7A 5EP3A 4I8OA 1MI0A 4L78A 4J3OD 2LHEA 4B0EA 1WYGA 4X62M 1XNRM 3P63A 4AI6A 3J27B 2UXCM 1TYGB 3PVSA 2V1CA 3EGRA 1C79A 4DR7M 1JALA 5H37D 1EE8A 3SAVA 4FCVA 2J53A 3VKHA 1ZQ9A 2DBYA 1IGDA 1QF6A 4KX6B 1YQ4B 1IN5A 5C1BA 2JXTA 4G4OA 3SATA 2ZW0A 3ABVB 5FTKA 1QQWA 1K52A 1JR3A 3VQIA 2R65A 4R7GA 5KPTA 4Z8XA 1BXTA 4YTNB 2F5PA 1UM8A 2M60A 1Z5BA 4B3MM 3AKZA 4TSSA 3MTVA 2C9OA 1P7EA 3URYA 1FJGM 4DV7M 1TY2A 4KHPM 2QCUA 4QNRA 4EIWA 1N75A 2BTWB 4YT0B 4IUMA 2XF3A 3GLIB 4LJ5A 4NJCA 2J7NA 1SXTA 1VZ7A 4YHHM 3JR4A 4RF1A 3T1HM 1JW9D 1FEHA 3SFZA 4XWTA 5FK9C 2KXEA 1FNUA 4ZTBA 1EM7A 4ARCA 2CV2A 4FW9A 3HUIA 3ZQ4A 5BYSA 4TQ1A 3BY4A 3ZNHA 3DZDA 3GRVA 1Y56A 2WQYB 1FRRA 1S3SA 3BOSA 3Q8XA 2R45A 1N62A 4LTUA 4JI6M 2M56B 2WDRB 4LFCM 1XO3A 3LB8C 3QAUA 4LGYA 1TY0A 2WS3B 5BR8M 1TKEA 2HDEA 4QOZC 3J7AS 4B7GA 4ITKA 4GRIA 4L23A 2D5GA 2W54A 4HL4A 1L5PA 1IN4A 3AOEA 4XZXA 3TEWA 4IDIA 2G8LA 3SARA 1UGJA 4US9A 3U61A 2QBYB 3U2SC 1IGCA 3AFHA 2LNHC 4MH8A 2FNAA 4CISA 1HT1E 2W82A 1F2RC 4ZHPA 2MEKA 3MC0B 2QZ4A 2F5NA 4LFAM 3MP9A 4QNMA 1QANA 4JI7M 4YTPB 1G59A 2JRIA 1VRAB 4HEA1 3KW6A 3E56A 4N58A 1C4CA 2KDMA 3LQRA 5KQ8A 3DFZA 1C78A 4A3VB 2DWQA 1FXAA 1SIJA 1KF6B 3AV8A 1JWMD 2B76B 3VRBB 1TH4A 1EU4A 2QEJC 2EUCA 3N9YC 2XH9A 2ICIA 1E94E 3U60A 3NRZA 2WLBA 4MGIE 1FNWA 2R4JA 4D8EA 3RFWA 1FM0D 3RE8A 2G9HD 2HKJA 2IGGA 2TSSA 4R3DA 2MJDA 4WURA 2EELA 4GIPA 4IIWA 3GB1A 4DXGA 4YY3M 3J9CA 3HHXA 1RYJA 8CATA 3WHKA 3J80S 1UWXA 4DV2M 1KH0A 2ZAMA 1XCTL 3FTFA 2X8AA 4JXJA 3ZCBB 1ZDXA 3VDUA 2R46A 3HU1A 2LUMA 4USAA 3A46A 5E26A 3TWKA 4JWSC 3KP0E 5EP4A 4RGTA 1E9MA 1OQQA 1SXJB 3HVDA 1SBBB 5MPOA 1OFIA 3AEDB 4M0DA 3R9XB 3GLHA 3C8YA 1IQPA 1PGAA 3VR8B 2NTTA 4QHSA 2HTME 4GKJM 1HQCA 3W9CB 1WWTA 4AKHA 1MPEA 1XMQM 2I38A 3IAS1 5GKNA 1IXRC 2WXOA 5BPVA 4LG2A 4FCWA 4WH4A 5TSSA 2Z4RA 4IBBA 3TMPA 2N0SB 2FOIC 2KN4A 1JMLA 4G6ZA 2WNMA 1TH3A 3AE2B 3D8BA 2NTSA 4FCTA 2ZM6M 2DWMA 2KW0A 3I51A 4B3RM 5EE9A 2F5SA 1TH2A 2CJOA 1UWMA 1FNNA 4HRSA 1XNQM 1I4XA 2R4EA 2CHGA 2R61A 3L2AA 3UGJA 3B21A 4LF8M 1YJJA 3GS2A 1OQRA 1LO5D 3AE5B 2PTLA 3DA1A 3M0EA 1HR0M 1N60A 3BVGA 1SF0A 2OQ4A 5F3WA 1GL7A 2LMCA 5EXXA 3FC4A 4NXMM 4UDUC 1C9FA 2WXLA 3SYKA 4M9SA 4EE2A 1AN8A 1DGJA 4YXDB 1ZPSA 1V1PB 2AGAA 1C1KA 1PVJA 2BB5A 1GLNA 4RGOS 3GRUA 2D7HA 3SHFA 3FTDA 1NNUC 3IAM1 1IBLM 5EP2A 2L7IA 2KZSA 2UU9M 5ITUA 1UKFA 1MX0A 2AQ2B 3U5ZB 1GAQB 2BB6A 2JYEA 3PNYA 1IN7A 1E9SA 3T3NA 3TE6A 1R7RA 2Y3AA 1EWCA 1SE4A 1OFHA 1DO2A 1GB4A 3M6AA 4NSOB 3J81S 2ACZB 3L4PA 4HKQA 3J2PB 3K8ZA 2DZNB 4CHTB 3Q8AA 1SXJD 2ZW1A 1I94M 2FUG1 1ESFA 5ITQA 1I4RA 3AEFB 3AM9A 4JI1M 1STEA 3ILKA 1R7SA 1SJHD 5G5GA 1AW7A 3TWLA 2BTWA 5KQDA 4LRSA 4DR6M 1FNVA 3GLIA 1VJKA 1N33M 1XLNA 3KOWE 1DOXA 4A5UA 3AN1A 1FFVA 4X64M 4JI8M 3VR9B 1Z5AA 2DOSA 2V0GA 5EE0A 1VR9A 2KA6B 2WXJA 3ZGZA 2XZFA 3BZDB 1XLQA 3AE1B 3CWIA 4DV6M 3DOAA 1D5MC 2YEPF 1I4QA 2C96A 1ORYB 1IUEA 4RFBA 3RGPA 4XDDA 1AYFA 1Q3CA 3L25A 4OZBA 3LYYA 1GVNA 3PHXA 1Q10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KO3 A;  4OVZ B;  4MM3 B;  5E6J A;  4REZ A;  4OW0 A;  4M0W A;  3MP2 A;  2FE8 A;  4PT5 A;  4RF1 A;  4OVZ A;  4RNA A;  3MJ5 A;  3E9S A;  4R3D A;  4RF0 A;  4P16 A;  4WUR A; 
#chains in the Genus database with same CATH topology
 1YN5 A;  5KO3 A;  2JNH A;  2LHC A;  1UD7 A;  2YNM D;  4ZRK A;  3I4Y A;  4G11 A;  3L28 A;  2ZZP B;  2FTD A;  4YYV A;  1QAM A;  1TDZ A;  1N34 M;  3QAQ A;  3SFD B;  1D5X C;  2KNA A;  4YL8 A;  4IBI A;  3L26 A;  1PJQ A;  1T6B X;  2JUO A;  2INP E;  4JL9 A;  2OP3 A;  4LJ4 A;  2AX5 A;  5FTL A;  1E90 A;  4JGH B;  3FTE A;  3LMM A;  3KFU G;  2NQD B;  3H6N A;  4BOZ A;  5ITR A;  2PRE A;  2EMT A;  1U9Q X;  3GQ5 A;  3ERV A;  1WXS A;  5D3I B;  1P98 A;  1WXQ A;  4JIO U;  4G0N B;  4OVZ B;  3U7Z A;  4YYQ A;  1QOL A;  4D8B A;  2QBY A;  5JZE A;  2LXE A;  1F0Z A;  3GRR A;  1OAI A;  2CHV A;  3APF A;  4II2 B;  1AEC A;  4Y28 F;  2DCB A;  2QDF A;  2MRP A;  3Q69 A;  3KVF B;  2MJ5 B;  2NBU A;  2F7D A;  2CJN A;  1NYR A;  3A9K B;  1N63 A;  4RNA A;  2J7Q C;  2QQ8 A;  3E4R A;  4DR1 M;  4FWH A;  1JQP A;  2VRR B;  1YJI A;  2K3U A;  3RCZ A;  4C00 A;  3V05 A;  4AWJ A;  5KHQ A;  1IBK M;  4D81 A;  3PHU A;  4B7F A;  2VII A;  4ACF A;  5LLI A;  3R3M A;  1UGM A;  3Q3N C;  4MI7 A;  3DF0 A;  2CV0 A;  3PRM A;  4BBN C;  2FE8 A;  1YOV B;  3R8F A;  2X8X X;  5FLX S;  3IXS A;  4HEO A;  1FRD A;  2BBC A;  1JB0 F;  2LXA A;  3UI3 A;  4I81 A;  4WW0 A;  4LF6 M;  3NOB A;  3AEG B;  3MHV C;  3CBK A;  1WGY A;  2IGD A;  2CV1 A;  1IN8 A;  3DPD A;  3BBA A;  2IO3 B;  3AOG A;  2WSF F;  4Q8G A;  3PRP A;  3ZYY X;  3SAS A;  2LHD A;  3OTO M;  2CHZ A;  3GQ4 A;  3PRZ A;  4L1B A;  3O13 A;  2UXD M;  3HVZ A;  2KTR B;  4PD2 A;  3A98 B;  1V1O A;  2UWQ A;  3T8M A;  3MP2 A;  3FUW A;  3RNC C;  1WGR A;  3OVZ A;  3KOY E;  1F77 A;  2FH0 A;  1KFX L;  3RMK C;  1NVI D;  4N9F 4;  3DOW A;  2PVO D;  1PIP A;  3K2L A;  1PJI A;  2ZTD A;  3GE3 C;  2IO0 B;  3DBS A;  3P42 A;  4GC9 A;  4MGH A;  1SP4 B;  3V6C A;  4LDT D;  3AU5 A;  4GSW A;  1NV8 A;  5IOI A;  4A6Q A;  2ZNV C;  3ZJV A;  3VUY A;  3CSF A;  4C4V A;  2HL7 A;  2J52 A;  4W4U A;  2XSZ D;  5EZQ A;  1G6J A;  2JY6 B;  2BPS A;  3HHZ A;  1XQQ A;  5G2N A;  2FUD A;  4GIT A;  3RNV A;  1VCB A;  2GLS A;  1Y08 A;  4ZRI A;  4Q2J A;  2QP9 X;  4NSR A;  1PUT A;  2E6X A;  5GXG B;  2BS2 B;  5AZH A;  2BYT A;  1SXJ A;  4GHA A;  3B9J A;  1STF E;  3OQC A;  3HIZ A;  3JSV B;  2DC8 A;  1C77 A;  2QC8 A;  3W1S C;  1EFU B;  5IO9 A;  2WXF A;  4BKS A;  2D7G A;  3JVZ X;  3C0R A;  3TEX A;  2V1Y A;  2DAJ A;  2MBQ A;  3H7P B;  1NPZ A;  3GZN B;  4L4U A;  3FYC A;  4MH0 E;  5LMU M;  3ZTD A;  3IFU A;  3ZVV A;  2EKI A;  2C99 A;  4ITQ A;  1D6E C;  2AUZ A;  3SHG B;  1E32 A;  2YLM A;  2K9X A;  4HPM B;  1T0S C;  1H4R A;  2RDH A;  4W9F A;  1U9X A;  1QXP A;  4XGI A;  2N1V A;  4NAW B;  3AE7 B;  1NI3 A;  2MW5 A;  4OW0 A;  1J09 A;  4DHZ B;  4RGN A;  4IKG A;  2JYT A;  1OJL A;  1XHB A;  4S12 A;  3GE8 C;  4DR5 M;  5GMV A;  3HHW A;  3KOX E;  4HLQ A;  4HVB A;  2MGW A;  1HNZ M;  2DWN A;  1WF9 A;  1NJF A;  4HJG E;  4PK1 A;  4FXC A;  4Z6Y A;  2H1R A;  1PM5 A;  3RGS A;  4JE3 B;  1T5X D;  3GRY A;  3CBJ A;  2RDG A;  1SE2 A;  4QHT A;  3EA6 A;  2E5L M;  2AUX A;  1YVB A;  2OOB B;  3ZDM C;  3BK2 A;  2WXK A;  5C3J B;  2RRU A;  4FUL A;  1L1Z A;  2CHQ A;  1TTE A;  1YE9 A;  4MDK E;  2QSD A;  3L27 A;  1VDL A;  4WA6 A;  1SG9 A;  4MM3 B;  3VLF B;  2DXI A;  3EIE A;  4LJ7 A;  1QOF A;  2L09 A;  3L0W B;  1LM8 B;  3ZH9 B;  2LGY A;  1TZ1 A;  3VTW A;  1UFZ A;  4O1N A;  3WAM A;  4P6E A;  2P86 A;  5D7G A;  2XZU A;  1I7H A;  1L2C A;  3TNX A;  2OUL A;  3SMP A;  2CRU A;  2UU7 A;  2ZJD A;  2R9F A;  1VQ1 A;  5BO4 B;  2IJ0 A;  2KFK A;  1WE6 A;  2OPF A;  1WGD A;  1WR1 B;  2PMV A;  3UZU A;  1K3X A;  4AG6 A;  5EJC A;  1GJT A;  3GLG B;  4YYW A;  2L83 A;  3VKG A;  2RGH A;  1C4A A;  3PNV A;  2J0K A;  3ZC7 B;  5CHV A;  3KSX A;  2UUA M;  3CF6 E;  1FCC C;  1G4A E;  4KKJ A;  4X6I A;  5JH3 A;  3SAW A;  1ZUD 2;  3LCU A;  1F1H A;  3S3Q A;  3ZKJ C;  3O65 B;  4RMA A;  1YN4 A;  1TF0 B;  3W0F A;  2RSU A;  4K7U A;  4FD2 A;  3PT2 B;  3ZO5 B;  3U30 A;  5FTJ A;  1V1P A;  5C23 A;  3F5V A;  1Q02 A;  1DKI A;  3PV1 A;  1YK8 A;  2WXR A;  1UUP A;  3L17 A;  2K8C A;  1JWB D;  2LJI A;  4B08 A;  3GLH E;  1UNS A;  4GEW A;  5HFY A;  3D32 A;  1ME3 A;  2JX5 A;  2DHZ A;  2DZO B;  3OWE B;  2KJ6 A;  2R2O A;  2C5L C;  3I4V A;  2G4D B;  3KS8 A;  1WRD B;  3H8B A;  5HKH A;  4GOC A;  1T0Q C;  3FUU A;  2P5T A;  1E8Y A;  4PDI A;  5KPZ A;  3JAM S;  4CIZ A;  3L10 B;  2G8J A;  2BT6 A;  4B0M A;  1ET9 A;  3U5Z A;  1GOZ A;  1XXH A;  3T38 A;  4B7H A;  1IY2 A;  1QLB B;  2BJV A;  4PCZ A;  3T9L A;  4BOQ A;  2Z3X A;  4MGZ E;  2ASQ A;  2F5O A;  3DBR I;  3SAU A;  2R0I A;  2KVZ A;  4A20 A;  2NQ8 C;  4LJP B;  5L95 C;  1NY6 A;  2OO9 A;  5IP4 D;  1SSN A;  3BC3 A;  3WA0 A;  1N36 M;  1GUA B;  4LF7 M;  3GP7 A;  3R2I A;  1CVZ A;  4RKX A;  2WXP A;  1V5T A;  2PPH A;  5CTR C;  2JU6 X;  1EWY C;  2KN5 A;  4EZJ A;  4E3C A;  1VZ8 A;  3DQV A;  1RU3 A;  1ZMW A;  2O01 F;  2CU3 A;  1DOY A;  2Y5B A;  2V3P A;  1QZM A;  4N4Z A;  2RDB C;  1NJG A;  3FYD A;  2BF8 B;  4QOS A;  3KUZ A;  3I63 C;  1KLU D;  2I7P A;  2UZJ A;  3AE9 B;  3K9P A;  1UF0 A;  1DEU A;  3RN9 C;  1HZ6 A;  3KSE A;  1WZ3 A;  2D10 A;  4TQ0 A;  4M0W A;  2C7H A;  2BTE A;  2IYD B;  4KOD A;  1F2C A;  1L8Q A;  1GL6 A;  2L32 A;  4NRW A;  2KAJ A;  2MCN B;  3WXG A;  3NY5 A;  1YZB A;  3MFG A;  1KFV A;  4GDL B;  3TCA A;  3VUW A;  1AIM A;  4WJP A;  2K39 A;  4AUQ C;  4K81 A;  1PPN A;  2FCN A;  4GH9 A;  3ALB A;  2G1E A;  2PKO A;  1IPG A;  4K1R B;  4BOP A;  3KOZ E;  2QJL A;  2WSC F;  4DXA B;  1TS2 A;  5EXT A;  1M4V A;  3RFZ B;  3Q3J A;  2XSZ A;  4ZOH C;  1E8W A;  4DV0 M;  3P1M A;  4LLG M;  1HUC B;  3PNR A;  4R71 A;  1DV0 A;  4LFB M;  2BNK A;  1F9J A;  4DV4 M;  2C7M B;  3ZJU A;  3OVX A;  3IEC A;  3DHI C;  3RNF C;  3O0U A;  3TQS A;  2DHY A;  2XU1 A;  2KAN A;  4DMY A;  4OX9 M;  4C7Z A;  3PXG A;  3ZRF A;  4W9G A;  4W9L A;  2B3A A;  3NVY A;  4XDC A;  4P16 A;  2BKF A;  2GI9 A;  3EEC A;  4JV5 M;  1Q5W B;  2JZZ A;  3PVL A;  1AU3 A;  5HI1 A;  5IZ7 D;  2LWP A;  2VH1 A;  2XBB C;  2EKE C;  1ZCM A;  2KYW A;  2FS1 A;  1YT7 A;  3A4R A;  2L0T A;  1C7Y A;  1MFW A;  5G5H A;  3Q14 C;  2ERC A;  5LMN M;  3GPU A;  2ZVO A;  2SEB D;  1PDX A;  1B9R A;  3IHP C;  3TSS A;  4YSX B;  4PT5 A;  4FK5 A;  3FD9 A;  4GMV A;  1F4I A;  4HCP B;  4JYA M;  1KHP A;  4HK2 A;  2CP8 A;  2LXC A;  3H1U A;  4RY2 A;  2BU3 A;  4XC2 A;  1YN3 A;  3KSJ A;  2D3B A;  2P0R A;  4KLB A;  2HWJ A;  2KZR A;  4AOF A;  1D0K A;  3TRK A;  3HHI A;  2N4F A;  1OEY A;  4GMQ A;  1SEB D;  3PSE B;  1F2B A;  1KHQ A;  1N78 A;  2LGS A;  4KO8 A;  2L00 B;  1D4B A;  3J7B A;  4HXD B;  2WDQ B;  1O0E A;  2DCA A;  2MBB B;  2JP7 A;  2DZK A;  4RGM A;  3EUB 2;  2HXZ A;  5IT9 S;  2Q2E B;  1A70 A;  2W3R A;  1MN3 A;  2VF8 A;  2I7N A;  1F2R I;  3DDC B;  1GLO A;  4OVZ A;  2JXN A;  2HH5 A;  2CEA A;  1EWP A;  4D8I A;  1Y8R C;  5DYI A;  2Y5C A;  4DR2 M;  4FJY A;  2BW2 A;  1E7U A;  2IBI B;  2LRW A;  7CAT A;  3CIR B;  4BOS C;  1IM2 A;  3VFD A;  3TBL D;  3QT4 A;  2R18 A;  3RUL A;  3KP1 E;  3Q8G A;  5BMG A;  5EP1 A;  3IG5 A;  3A9K A;  1DGH B;  1JWA D;  1PE6 A;  2PW9 A;  2AYO B;  4AW4 A;  4C80 A;  3GLI E;  1RAX A;  3HHM A;  3NWL A;  4TV3 A;  1QYR A;  1GEC E;  5J18 A;  4HCN B;  1YX5 B;  4GIV A;  3EFU A;  2H7J A;  3GPX A;  1K51 A;  5CHF A;  2OZ2 A;  2G8E A;  1YUB A;  3APD A;  4MSM B;  3RZW C;  1TLO A;  2M17 A;  1F52 A;  1Q39 A;  2QHO B;  3LXS A;  4KGR A;  2XNA C;  2YJ9 A;  5FKA C;  3GLF A;  5BYQ A;  1Z6T A;  5ITY A;  1JRO A;  2MBO A;  4PP2 E;  2HJ1 A;  3HKP A;  1N32 M;  1WYW B;  3UIP B;  1Q0W B;  3IV2 A;  1L2N A;  5EDS A;  2V1U A;  4GC5 A;  2HTH A;  5J17 A;  1E8X A;  4ZYS A;  1FCL A;  2KQ4 X;  2DC9 A;  3WCQ A;  2KTF A;  1I4W A;  4J6I A;  2GMI C;  3V62 A;  2YJB A;  2K9D A;  1MJD A;  1HA5 A;  4KIK A;  1Q1O A;  5H8Y E;  5JHA A;  1BP4 A;  2DKL A;  3LVV A;  4A90 A;  1DO0 A;  3HJS A;  1KTK A;  3O1G A;  3KYD D;  1CUK A;  4NJ6 A;  1XXH B;  3W5U B;  2HE7 A;  2KHH A;  5EXS A;  2KQS A;  1OFF A;  3CST A;  3BVM A;  4XWW A;  3OLM D;  2DZY A;  2Z84 A;  4W9E A;  3C9P A;  2LJ5 A;  3TWM A;  3MHS D;  3TUO A;  3DWM A;  2CR5 A;  4K0K M;  3T1Y M;  1TS4 A;  2VQE M;  3AEC B;  2DEN B;  4PS7 A;  2JZ1 A;  3D6S A;  2Y5B B;  1K53 A;  2R6N A;  2GBK A;  2VZK B;  1MEG A;  5IRE B;  4MZO A;  2DI0 A;  1I4H A;  2BWE S;  2JY6 A;  2EJS A;  1L0X B;  3I3T B;  3PPA A;  3QX1 A;  1WJ4 A;  4XE0 A;  1WXA A;  4II3 B;  4W5B A;  2IPK D;  1FMA D;  1V49 A;  2RPQ A;  2E02 A;  4IJF A;  4MGY E;  4WWP A;  3IG3 A;  4YV8 A;  2Y21 A;  4CJ6 A;  3B7Z A;  2MWS B;  3IT4 B;  4NL4 H;  4WWO A;  2AQ3 B;  1E10 A;  4JLC A;  3VRA B;  1IXS B;  4BFR A;  1A6R A;  2KWU B;  4WWM A;  5LNK 1;  4DBG B;  4KGS A;  4XBO A;  4BBN F;  3U7D A;  2LBC A;  4IBJ A;  4I6L B;  1MS6 A;  5A2Q S;  2QCZ A;  2JQF R;  2KNV A;  4A3O A;  3DWG C;  3U6P A;  3H7P A;  1CZP A;  3OIS A;  2RGO A;  1VDD A;  2IY0 B;  3L29 A;  1RWS A;  3JYU A;  2N7D A;  2FO5 A;  1MHH E;  2J7O A;  3QWL A;  2WDV B;  1K82 A;  3AUL A;  5FTM A;  4K7W A;  5JI2 E;  4WWN A;  4IM2 A;  2G5G X;  1NHG C;  4PS8 A;  1P0R A;  2L6O A;  1LQB A;  5AUK A;  4NAW A;  4AKI A;  4QBB A;  3U6O A;  1XC8 A;  2IGH A;  3V61 A;  4F2L A;  5HG2 A;  2OHF A;  2BDL A;  3U6E A;  4HWI B;  1J7C A;  1OTR B;  1FXI A;  1AYU A;  1WY8 A;  2RKO A;  1IFY A;  3UJN A;  3AB5 A;  2MH7 A;  2LWX A;  1E6E B;  5E6N A;  4LF4 M;  2M0A A;  4LNO A;  5BMH A;  2K5P A;  3NVV A;  3P4P B;  2C60 A;  5EE3 A;  3PHW B;  3AH7 A;  2OOB A;  3H8H A;  5H92 C;  3KKU A;  2QIE B;  4BZA A;  4E71 A;  2LVN C;  4ANX A;  5IWA M;  2JTC A;  2KRU A;  2L05 A;  4IBC A;  1WSP A;  4MM3 A;  2KAC A;  2K8H A;  3FUX A;  2UUC M;  1J7B A;  3D8L A;  2O2V B;  3HWN A;  2BS4 B;  1AU0 A;  2Z7J A;  4F7Z A;  4QRV A;  2XGN A;  1S4V A;  1AU4 A;  1YIW A;  2N9K A;  4BKT A;  1JR3 E;  1NYQ A;  4BOU A;  2UXB M;  2C5R A;  1TKG A;  1XD3 B;  1B1Z A;  1BUI C;  4G50 A;  2DLB A;  2Q5W D;  4BAX A;  4RCO A;  1IWD A;  1WR1 A;  4GKK M;  1R4G A;  4PDG A;  1VJV A;  3GLG A;  2YJC A;  2DZJ A;  5ITX A;  3HWS A;  1WM2 A;  2WXM A;  2B3T A;  3AJI B;  4IBG A;  4GU2 A;  3VDZ A;  3KVW A;  2V3N A;  3GPP A;  4QAY A;  2REX A;  1QOG A;  2WU5 B;  3O65 A;  1P3Q Q;  1XXG A;  3SHQ A;  2J4X A;  2J7Q B;  4ZPX A;  2VQF M;  3PT2 A;  1C4P A;  2JF5 A;  2NS5 A;  2JVC A;  4XYC A;  3VHT C;  5EXP A;  2WBF X;  4LY6 A;  3R8B A;  1SXJ E;  3W30 A;  2MHJ A;  1ZOY B;  2C9C A;  4AKG A;  5CX3 A;  1QDT A;  3DBL I;  3H4J A;  2JZP A;  3P5U A;  1ZDV A;  1IXZ A;  1RM6 C;  2YR0 A;  3RNB C;  2KK8 A;  1IN6 A;  1QAO A;  3TL4 X;  2UUB M;  1VLB A;  4X6H A;  4IJE A;  1ACC A;  3BB7 A;  2BYE A;  3FTC A;  4FJZ A;  2PLP A;  3Q8E A;  2KDE B;  4IW0 A;  2Z8L A;  2IDY A;  3KFQ A;  4JWU C;  1QOA A;  1L2B A;  2JSV X;  4FA6 A;  1X37 A;  2MJE A;  1KFY B;  3GLF B;  2DYM A;  1T3Q A;  2CHW A;  3KWZ A;  3KS4 A;  2FYE A;  1N5W A;  4LJA A;  2MP2 B;  2WXI A;  4OZA A;  2KZU A;  3Q8C A;  2MR9 A;  4M02 A;  2WDT B;  4QRX A;  2XLJ A;  4HKZ E;  3A42 A;  1ZAE A;  2DC7 A;  2YEP B;  2XN9 C;  1CMX B;  3SD5 A;  3RT3 B;  1NO1 A;  2KNZ A;  2VZK D;  2QMT A;  2P7U A;  2DVW B;  2NCN A;  3TEY A;  2K6B A;  2R62 A;  4KIK B;  2A4Z A;  4L15 A;  3W31 A;  1YK7 A;  4WIP A;  1LV7 A;  1ZXH A;  3VDP A;  4BB9 A;  2K47 A;  4M8N A;  4NAM A;  2ZNV B;  3HU3 A;  1WE7 A;  3BXW A;  3NBI A;  3RPF C;  1EWO A;  4FN2 A;  2R6F A;  1V5O A;  1L1T A;  3NVW A;  1PQS A;  2N9E B;  2INC C;  2IY1 B;  4OVU A;  2WXG A;  2F5Q A;  3DBR B;  4W9C A;  4DHJ B;  2L76 A;  1U5I A;  1V80 A;  4G3O A;  1JRP A;  3FUT A;  4KZ0 A;  5C18 A;  2R9O A;  1BQI A;  4GDL A;  2DCC A;  5FTN A;  1J7K A;  2KDB A;  3MHS A;  1WGN A;  4UN2 B;  2WWZ A;  3ZQJ A;  3B08 A;  2XEP A;  3MK6 A;  4OVV A;  2HAK A;  3QAR A;  1EWL A;  2JXX A;  2QSF X;  1IY0 A;  1TZO A;  2LGI A;  1PJJ A;  4IBD A;  3CF0 A;  5JA7 A;  1N61 A;  1UEL A;  4KVG B;  2JA2 A;  3HY5 A;  4FIP A;  2GRI A;  2WGS A;  3H8C A;  1QDQ A;  3OJ4 B;  2BDZ A;  2DAE A;  2J5Y A;  2KEB A;  2D7E A;  2E3T A;  3QHT A;  4BPV A;  4BS6 A;  5JXV A;  2MA9 B;  3PO0 A;  4LZJ A;  4ANU A;  2GNO A;  5K16 A;  2CFO A;  3I01 M;  1YMH E;  1FXT B;  3UQB A;  1CQD A;  2FT2 A;  3BVZ A;  2MJ3 A;  2WXQ A;  1K50 A;  5ITT A;  1EF5 A;  3IFW B;  1Q3B A;  2Z4S A;  3OF8 A;  1WGH A;  2JZ3 B;  3ETR A;  4S0R A;  1PPD A;  2Z0D B;  1H6U A;  2LVO C;  3N3K B;  4AS1 A;  3UIO B;  2LVA A;  3E9S A;  2Y6E A;  1IBM M;  1HXY D;  3QJ3 A;  3W2D A;  1J5E M;  3AMZ A;  4CDC B;  1XMO M;  2AQ1 B;  2LZ6 A;  3U4E G;  1V8C A;  3ZJT A;  2HJ8 A;  4DDI D;  1I4P A;  1E5W A;  2XK5 A;  4JPS A;  4N8W A;  5E6J A;  2KWD A;  4W9K A;  1TDH A;  4I05 A;  3LXF A;  3ML9 A;  3QC8 B;  1L4Z B;  3K1J A;  1WJN A;  4WAF A;  2KVR A;  3S2A A;  4X65 M;  1LFD A;  2IZV B;  3GQ3 A;  2R2Q A;  1V92 A;  1T0R C;  3L16 A;  1MEM A;  1MHX A;  3FKY A;  5IN7 A;  1YQB A;  1W5T A;  1NEK B;  5DPT A;  2F4V M;  4LGM A;  2O6V B;  5BYR A;  3PSE A;  4DUZ M;  2QNJ A;  2LH0 A;  3R7R A;  2SAK A;  3KXE C;  1IBX B;  1PXV A;  2FBW B;  3FUV A;  3MHZ A;  3T3O A;  4HXD A;  3I9V 1;  4BOS A;  2RMM A;  4NY0 A;  3VUX A;  1WJ6 A;  3CH3 X;  3A45 A;  4WQO B;  3VAW A;  2A5Y B;  1Y4H A;  2IND C;  4GHL A;  1DYQ A;  3B89 A;  3F75 A;  3U52 E;  2ONQ A;  5DNY A;  1ZP0 B;  1IY1 A;  5TR5 A;  3QCA A;  2IBI A;  2QIL A;  1KYI A;  1SE3 A;  4JI4 M;  2CKH B;  2LVP C;  3IT6 B;  2KLG A;  5I4D A;  1M6D A;  3GO8 A;  2RPV A;  3PRE A;  2AIM A;  3WHL A;  2DWZ B;  2V6Z M;  3T15 A;  3KQ4 A;  3FIL A;  3N32 A;  1CQV A;  3PZ8 A;  1DGH A;  1FO4 A;  3H7D A;  2AYO A;  3C3D A;  2M5Z A;  2QEN A;  1HQY E;  1QDR A;  1X1M A;  4GGQ A;  4FJV B;  3HGI A;  5CHW A;  3USV A;  4DV5 M;  3H4M A;  2V4I B;  2N9L A;  4ZHO A;  4JI0 M;  4YYS A;  3M62 B;  2MH8 A;  4F8C B;  2X49 A;  2QHO A;  3RI7 C;  1CSB B;  1PYW D;  3U6Q A;  4KGT A;  3AEE B;  3B9P A;  1V86 A;  4H2A A;  3W5V B;  1X9Y A;  3MJ5 A;  4FVM A;  3AE3 B;  3OF9 A;  3S3R A;  2PE9 A;  1GPX A;  5FR3 A;  2AHM A;  1QKZ A;  4DR3 M;  2DJF B;  4LNI A;  3QYE A;  4KZC A;  2NQA A;  1KRH A;  3ECI A;  3C9E A;  3A4S C;  4M9X A;  2DWL A;  2GB1 A;  3NUH B;  1K3W A;  4KV2 A;  4NRV A;  3FAH A;  4ZRP A;  4G3X B;  3N30 A;  3DCG A;  5DFL A;  3OAW A;  4JI2 M;  1BVS A;  1T6O A;  2JWU A;  4AQ7 A;  3VXW A;  1HZ5 A;  4OEL A;  1KLG D;  4DXF A;  5JHB A;  1T43 A;  3CF2 A;  1WIA A;  2DZM A;  3A1Q B;  4NNJ B;  4AP4 C;  4ARI A;  1NEN B;  1BY8 A;  1RFK A;  2DHR A;  1WGK A;  4CDE B;  2H88 B;  4JI3 M;  3P4R B;  4DHJ D;  4IBE A;  2Y20 A;  3P4Q B;  5D2M B;  2GBR A;  4LZZ A;  2JPH A;  1D5Z C;  4K7S A;  5PAD A;  4LF9 M;  1GAB A;  1E8Z A;  3HJQ A;  4NOO B;  3EFC A;  2VHF A;  1DGG A;  2DEN A;  4IBF A;  2CHX A;  5AZG A;  1SE9 A;  4P6V F;  2BWF A;  3C58 A;  2HD5 B;  1KJT A;  3V3X A;  4CQN A;  1C76 A;  3B2G A;  1WRI A;  3A33 B;  3I3T A;  2DZL A;  4D82 A;  1VEG A;  2X38 A;  1CK1 A;  2GFO A;  1J19 A;  4OU7 A;  4LJ8 A;  3WAN A;  2V9H A;  1E7P B;  3V6E B;  3QWZ B;  3CGW A;  3K24 A;  3X0W A;  1PRB A;  3KLS X;  3ZNI D;  4OZC A;  5EQT A;  3AI8 A;  1PGB A;  1IXS A;  4YSY B;  1DGF A;  2KMM A;  3SEB A;  4GUA A;  4DBG A;  1GMY A;  3BYY B;  1SB3 C;  5D94 A;  1OKS A;  1JQJ C;  2KKC A;  3IBE A;  3KW5 B;  1TU6 A;  3HD3 A;  2WP9 B;  4MB7 A;  2YJ2 A;  4P1B C;  1F29 A;  4DV1 M;  3QSD A;  2LEK A;  2O5R A;  2JT4 B;  2NMQ A;  3GPY A;  4B3T M;  2W55 A;  4RKU F;  4C56 C;  4KKI A;  4MJS A;  1TIF A;  3B2F A;  5A24 A;  3HJ8 A;  3VVW B;  3VK8 A;  5CVO B;  3FKE A;  3KDS E;  2Y0T A;  1XLO A;  4N79 A;  4C7Y A;  3U6S A;  2BYF A;  1XCQ L;  3E46 A;  2WXH A;  1NHW C;  1V6E A;  3F92 A;  2X4A A;  1OTR A;  3HX3 A;  3TPZ A;  1VZ6 A;  2WZJ A;  4GDK B;  3NZU A;  3LFY A;  1CJL A;  3WXF A;  1QUT A;  2O6V D;  1GJS A;  4LJ6 A;  2GBN A;  3M7G A;  4G54 A;  1MJG M;  2H5X A;  1QIL A;  4AZF A;  1G41 A;  1IYF A;  1PBH A;  2FQ9 A;  1TBE A;  2KT7 A;  4TUW A;  2N1W A;  1BML C;  4US8 A;  1XWI A;  3SMS A;  2QPA A;  1D2N A;  3JR5 A;  2AL6 A;  3Q3O C;  1KSF X;  3PHW A;  2BWB A;  1I4G A;  3NBX X;  1L0Y B;  2VDB B;  2DYB A;  3AEB B;  3QYB A;  3HHY A;  3BPF A;  4ANW A;  2HHH M;  2XK5 B;  1WJ7 A;  5FSW A;  4AG5 A;  1YD8 U;  1ICF A;  2O2V A;  2BJW A;  2INN E;  3Q8F A;  1MVK A;  4IUM B;  3UGB B;  5LXI B;  3KX1 A;  4G4R A;  4W9I A;  3AV0 A;  3SBJ A;  1G3I A;  1SXJ C;  2L4F A;  2LFI A;  4LK0 M;  3RZF A;  2XFS A;  1QQR A;  2Y5P A;  4L2Y A;  3SU8 X;  4QH6 A;  3X23 A;  4XZ4 A;  2K0B X;  1AUA A;  5EZS A;  2V3S A;  4M9Z A;  4TMA B;  1WIV A;  2YQZ A;  3C3E A;  1ZE3 D;  2W3S A;  1ZV1 A;  4MEM A;  4A9A A;  5DPW A;  3QQ8 B;  4LRT A;  2D11 A;  3AE6 B;  4F1I A;  4EFO A;  4CDF B;  2HCB A;  2WX1 A;  3I57 A;  1PFD A;  2LUE A;  4AXM A;  3BY4 B;  3ZNH B;  4YYR A;  1NVM A;  1WR6 E;  2DZI A;  3BII D;  2J7Q A;  1MG4 A;  2KMA A;  4MAC A;  5CVN B;  1RRB A;  1L0V B;  1S1Q B;  3ZIM A;  1GO5 A;  4MT5 A;  4HRO A;  2K8B A;  1AWD A;  3FIL B;  4NZL B;  3VK7 A;  3SYL A;  2PEA A;  2D2Q A;  1R6B X;  5FPW A;  4NPN A;  1LTM A;  2W9N A;  3P2B A;  1YNT E;  5EF4 A;  2Y0Q A;  4DV3 M;  5AZF A;  2LD9 A;  4FBJ B;  1GB1 A;  1HTO A;  1FIQ A;  3NS1 A;  2G6D A;  3ZRC A;  2NQI A;  1ROE A;  1SJE D;  1JCK B;  4FAD A;  3BWU D;  2FUH B;  2ZPN A;  2K22 A;  1P1A A;  4BBA A;  1WM3 A;  3AE8 B;  4II7 A;  2K0P A;  2J42 A;  4CHK A;  1MU5 A;  2PIA A;  2MP2 A;  4YTM B;  1N77 A;  4MEL A;  3ZDT A;  1J0G A;  4DHZ E;  4NXN M;  3CH2 X;  2JZ0 A;  1CB5 A;  3LDZ E;  1NSF A;  3GP1 A;  3DBL B;  3AL0 C;  2H89 B;  4JN6 A;  3KWV A;  1TGU A;  3WAP A;  1ZXI A;  3KWL A;  3U61 B;  1TJE A;  1H8C A;  4A8X C;  3N3G A;  2D07 B;  3AOE C;  4IP3 A;  5CHV C;  2KRK A;  3RVW A;  3UMM A;  4NQL B;  1QAQ A;  4AJY B;  2CUZ A;  4CDD B;  4HJK A;  4WP2 A;  1VDV A;  3AEA B;  5L8R F;  1W5S A;  5KHO A;  2DJG B;  1NNJ A;  3SR6 A;  2AWT A;  4CGY B;  2G3Q B;  4KDI C;  2C98 A;  3NVZ A;  1ZMV A;  3K9O B;  1N5X A;  3MOR A;  3PDF A;  1PCI A;  4L16 A;  2JRI B;  3ZXR A;  5IA7 A;  2XFT A;  2L1A A;  2RGF A;  2HWK A;  4IWO A;  1JR3 D;  2N7J A;  4P17 A;  4X57 B;  3GLG E;  1HE8 A;  2JQR B;  4FWD A;  1HT2 E;  4Q7J A;  5ITX E;  1YQ3 B;  2MX2 A;  2R44 A;  1UZX B;  2BGF A;  4XX5 A;  3W1S A;  3NHE B;  1QVR A;  2EKF A;  1QOB A;  2OED A;  4DDG D;  4HLE A;  4M8M A;  4W5W A;  1XEE A;  2WXN A;  3UK6 A;  3DVN U;  5KPR A;  1WX7 A;  4KSK C;  3Q8B A;  4X66 M;  1G8P A;  2KDI A;  3U60 B;  2WU2 B;  3PW3 A;  1P7F A;  4A55 A;  3W0L B;  1E7V A;  4D2K A;  3ZXV A;  2L7R A;  2KLC A;  2NBV B;  1PGX A;  1Z5C A;  5HHD G;  2HHN A;  3BPM A;  3PFI A;  4G4Q A;  3BK1 A;  1FPY A;  5C2T B;  1NY5 A;  1YLA A;  3LVW A;  4KLN A;  3RNG C;  1V97 A;  3EIH A;  3N3K A;  1HQR D;  5DYG A;  2DYO A;  1F2A A;  3CTW B;  1LGR A;  4GLS C;  2L3Z A;  1WHC A;  4YSZ B;  3U6C A;  4MJS B;  3MHH A;  3HU2 A;  4I5S A;  3TL5 A;  1TTN A;  1GCB A;  1SIF A;  1K8R B;  1TS5 A;  6PAD A;  4L8R C;  4RF0 A;  2FFJ A;  2EA0 A;  3ML8 A;  1C3T A;  2ZAN A;  3PGE A;  3KUC B;  3U8E A;  1Z59 A;  3M63 B;  4JI5 M;  1EO6 A;  1ENF A;  3AI5 A;  4RM9 A;  1EF7 A;  3IG8 A;  4REZ A;  1XLP A;  2NVU I;  4WQM A;  4RM8 A;  5D3D A;  2M0X A;  2ZBK B;  5EE1 A;  1SNK A;  3RVV A;  1R4N I;  4MZS A;  2IPP B;  2GBJ A;  2O6V A;  3U6D A;  3HRD D;  4DQO C;  2A5U A;  1XF5 L;  2ON8 A;  1IBX A;  1TR8 A;  4P6G A;  2KXJ A;  1EWM A;  4FWG A;  1PPP A;  4JX1 C;  4MGK E;  4XGA B;  4BVU C;  3GLH B;  1FD6 A;  1L4D B;  1R2Z A;  3AU4 A;  3E21 A;  5BMI A;  3B7N A;  2D3G A;  5IKC M;  1J7A A;  4LJ9 A;  4D80 A;  2G4S A;  1V33 A;  2RR9 A;  3WIM A;  2I2Y A;  5IAA C;  4HPP A;  4Q8H A;  3SC3 A;  1RFA A;  2XU4 A;  4N59 A;  2DNA A;  3OG5 A;  1ME4 A;  1U9V A;  2EO2 A;  4DR4 M;  4DUY M;  3GOE A;  1YSY A;  1QT9 A;  1WJU A;  2M19 A;  4NJ7 A;  5AUI A;  2O25 A;  4G4N A;  2ZVN A;  3PZ7 A;  3PZD A;  1JQ4 A;  1KXR A;  3RYT A;  3NZ3 A;  4YWG G;  2FIF A;  2PE6 B;  1BGO A;  1ET6 A;  1T3T A;  2BS3 B;  3T6P A;  4GB9 A;  4EZL A;  1FH0 A;  3AE4 B;  4I4L A;  1GJZ A;  2KC2 A;  2MLB A;  1AAR A;  1DGB A;  5JI3 E;  4ZDV A;  1HTQ A;  3TEZ A;  3P5W A;  1JWS D;  3V76 A;  3TMP B;  1EU3 A;  1TKY A;  2FID A;  5CVM A;  3VTU A;  3LQQ A;  4KT0 F;  3HM6 X;  4OHJ A;  2KDF B;  4PAD A;  4AQY M;  1HEZ E;  3MTN A;  4LCB A;  1DOI A;  1CJE A;  4B3S M;  2BQQ A;  2YFQ A;  4P1C C;  1L6V A;  4BLC A;  2KQ7 A;  3I04 M;  2C0Y A;  4BQV A;  3DVN V;  3BWK A;  3R2T A;  5J94 A;  1R2Y A;  3B1L X;  1WMH B;  2PVG C;  1CTE A;  1E9R A;  2KJH B;  2ZEQ A;  3SFE B;  2IO1 B;  1R5L A;  3K92 A;  5T8I A;  1D3Z A;  4IBK A;  4ASW C;  2VHS A;  1V81 A;  2PBH A;  1HNW M;  3VH4 B;  2JUJ A;  1HNX M;  4RH6 A;  2ARY A;  3P4S B;  4PS3 A;  3MC8 A;  1P3Q U;  2Z8Y M;  2KFJ A;  4W9D A;  2AVW A;  1VD2 A;  1FFU A;  1AYV A;  3A1Q A;  2MSE D;  4LF5 M;  3SDL C;  1GKI A;  4CO7 A;  2WYQ A;  1TS3 A;  1L6U A;  2L52 A;  3THG A;  4ANR A;  2M1M A;  2NBW B;  4NC6 A;  4I6P A;  4IOI E;  1BT0 A;  2FRQ A;  3K9M A;  3C19 A;  4ZRQ A;  2UYZ B;  1VEJ A;  1ZGU B;  1E0Z A;  2XEW A;  4N6E B;  3U6L A;  3CMM B;  3U6M A;  2L7H A;  1WX8 A;  2O6X A;  4MSX A;  2D3A A;  1P9D U;  2MBH A;  1UBQ A;  1NDD A;  1L2D A;  3DBH B;  4AJW A;  2ZAO A;  3BYT B;  1JWU D;  2CE7 A;  5EP3 A;  4I8O A;  1MI0 A;  4L78 A;  2Z0E B;  4J3O D;  2LHE A;  4B0E A;  1WYG A;  4X62 M;  2KDL A;  3N1Y C;  2HD5 A;  2FCM A;  1XNR M;  3P63 A;  4AI6 A;  3LJ3 A;  3J27 B;  2UXC M;  1TYG B;  2I1J A;  3IVF A;  1U4A A;  3BIN A;  3ONS A;  1GC6 A;  2LGX A;  4LNN A;  3PVS A;  2G7Y A;  2V1C A;  3EGR A;  1C79 A;  4DR7 M;  2JY5 A;  4I07 A;  1JAL A;  2JY8 A;  5C1Z A;  5H37 D;  1EE8 A;  3V6E A;  3SAV A;  4FCV A;  2J53 A;  1K3B B;  4WJO A;  2FNJ B;  2GOW A;  3VKH A;  1ZQ9 A;  3PS6 A;  2DBY A;  4GXB A;  1XB2 B;  1IGD A;  4KX6 B;  1QF6 A;  1YQ4 B;  1WXM A;  5G55 A;  2DNF A;  1IN5 A;  5C1B A;  3JW0 X;  2JXT A;  4G4O A;  3SAT A;  4E74 A;  2ZW0 A;  3ABV B;  3NZS A;  5FTK A;  3W1Y A;  1QQW A;  1K52 A;  1TL9 A;  1JR3 A;  3VQI A;  2AS8 A;  2R65 A;  4W9J A;  4R7G A;  5KPT A;  4Z8X A;  3IMA A;  4PP1 A;  2WSE F;  2E00 A;  1BXT A;  2K25 A;  4NQK E;  1MHW A;  4YTN B;  2F5P A;  1JRU A;  2KJR A;  2NR2 A;  1UM8 A;  2NPT B;  2M60 A;  4M00 A;  1Z5B A;  3QIJ A;  4B3M M;  1OAO C;  3AKZ A;  1WFY A;  4GDK A;  1G71 A;  1CS8 A;  3GCB A;  4TSS A;  4I6N B;  3MTV A;  2C9O A;  2LVQ D;  1P7E A;  3IHP A;  2JWZ A;  1C1Y B;  3URY A;  1FJG M;  1WI0 A;  1S3S G;  4PYZ A;  4IWQ A;  4IM3 A;  4B6W A;  2CIO A;  4DV7 M;  2QCU A;  4KHP M;  1TY2 A;  4YYU A;  4QNR A;  4EZK A;  4EIW A;  2DAI A;  5EGW A;  1N75 A;  2PNS A;  2R9M A;  2BTW B;  1WH3 A;  4YT0 B;  4GN1 A;  4IUM A;  2XF3 A;  1XXH E;  3LCV B;  3GLI B;  4LJ5 A;  3R66 C;  4NJC A;  2J7N A;  1SXT A;  1VZ7 A;  2FRA A;  4YHH M;  3JR4 A;  4RF1 A;  4IM0 A;  3E1Z B;  3T1H M;  4IWP A;  5AEK B;  1JW9 D;  1FEH A;  3RVX A;  3SFZ A;  2MBE A;  1WXV A;  3UIN B;  1CPJ A;  4XWT A;  5FK9 C;  3UF8 A;  1ZIV A;  2KXE A;  1FNU A;  3KUD B;  2GQF A;  1THE A;  1PGY A;  2J0J A;  4ZTB A;  3A9J B;  3N20 C;  1EM7 A;  2YVC A;  4ARC A;  3Q6B A;  1VG5 A;  4A3P A;  2CV2 A;  4FW9 A;  3HUI A;  1WZ0 A;  2WHI A;  3ZQ4 A;  5BYS A;  4TQ1 A;  3BY4 A;  3ZNH A;  3BBZ A;  2JRH A;  4ZUX U;  2GHU A;  3DZD A;  1POP A;  3GRV A;  1Y56 A;  4FJC A;  2BVC A;  2Z59 B;  2C7N B;  2WQY B;  1FRR A;  1RLF A;  1OEY J;  4FHK A;  1S3S A;  3BOS A;  3HK0 A;  3Q8X A;  3PHX B;  2R45 A;  1N62 A;  4W5C A;  4LTU A;  3U8Z A;  2CS4 A;  4JI6 M;  2M56 B;  1LXD A;  2L4E A;  4LFC M;  2WDR B;  3Q2A C;  2BKR B;  3B7Q A;  2I1K A;  1XO3 A;  3LB8 C;  3L13 A;  4EUT A;  1ITO A;  3P5X A;  3QAU A;  4LGY A;  2ZPY A;  1TY0 A;  1TT5 B;  4HDQ A;  2WS3 B;  2KNB A;  1N6Z A;  5BR8 M;  1TKE A;  2HDE A;  3MJW A;  1KFU L;  4QOZ C;  3J7A S;  4B7G A;  4ITK A;  4GRI A;  3MTN B;  1PJS A;  1NLJ A;  4L23 A;  2LHG A;  2D5G A;  3RD2 A;  3K8U A;  3ZTC A;  2W54 A;  5F02 A;  4HL4 A;  1L5P A;  2ZCB A;  1SGH A;  2VF7 A;  5J2R A;  1ZMU A;  3P5V A;  3PBH A;  1IN4 A;  4BOZ B;  3AOE A;  2KD0 A;  3DBH I;  3TEW A;  4XZX A;  1ZKH A;  4IDI A;  2G8L A;  3SAR A;  1T0Y A;  1UGJ A;  4IC7 B;  2PJH A;  4US9 A;  3U61 A;  3PLV A;  2ZTC A;  2QBY B;  5JZE B;  4YVA A;  3U2S C;  3RNE C;  1AIP C;  1IGC A;  1PPO A;  3AFH A;  1Z2M A;  2KX0 A;  3WXE A;  2LNH C;  4MH8 A;  2FNA A;  2JQG R;  4LJO B;  2EMS A;  4BKG A;  4XR7 A;  4CIS A;  1HT1 E;  2W82 A;  1F2R C;  4LNF A;  3N1X C;  2AL3 A;  2MEK A;  4ZHP A;  3MC0 B;  2N7E A;  2QZ4 A;  2F5N A;  4LFA M;  1OGW A;  3MP9 A;  4QNM A;  2LTU A;  2G3Q A;  1QAN A;  5D6J B;  4JQW C;  2E01 A;  1NI2 A;  2C9W B;  4JI7 M;  2RD0 A;  4YTP B;  2CB5 A;  3K9O A;  1G59 A;  2JRI A;  1VRA B;  4HEA 1;  3KW6 A;  7PCK A;  3E56 A;  4N58 A;  1C4C A;  2KDM A;  4P7I A;  3LQR A;  3PRM B;  1V34 A;  5KQ8 A;  1OIZ A;  4FLH A;  4PYU A;  2N9P C;  3DFZ A;  1UBI A;  1C78 A;  3NHE A;  2ACT A;  4A3V B;  2DWQ A;  1FXA A;  1L7Y A;  1KF6 B;  1SIJ A;  3AV8 A;  1JWM D;  2DX5 B;  2B76 B;  3VRB B;  1DF0 A;  2E03 A;  1TH4 A;  1EU4 A;  2QEJ C;  3PRP B;  2EUC A;  2L0F A;  1VEK A;  3N9Y C;  2XH9 A;  2ICI A;  4CYE A;  1E94 E;  3U60 A;  1GC7 A;  2N9X A;  5DPS A;  3NRZ A;  1OQY A;  1GNU A;  2WLB A;  4MGI E;  3VH3 B;  1FNW A;  2R4J A;  4D8E A;  3RFW A;  1FM0 D;  2M4N A;  3RE8 A;  2G9H D;  4HDO A;  2HKJ A;  2IGG A;  2TSS A;  3H6S A;  4R3D A;  2MJD A;  4HPL B;  4WUR A;  2EEL A;  4GIP A;  4IIW A;  3GB1 A;  2AU1 A;  4W9H A;  4DXG A;  4YY3 M;  2J0M A;  3J9C A;  2K6D B;  2DCD A;  3IOQ A;  3PLU A;  3HHX A;  4K3C A;  2N35 A;  3V6C B;  1QMY A;  1RYJ A;  8CAT A;  3WHK A;  3J80 S;  3GLF E;  1UWX A;  3MC9 A;  4DV2 M;  2R9C A;  1KH0 A;  2ZAM A;  1XCT L;  3GZN I;  4C4V B;  1D0M A;  4IG7 B;  3FTF A;  1WGG A;  2X8A A;  4JXJ A;  3ZCB B;  1ZDX A;  3VDU A;  4M01 A;  4B9K A;  2R46 A;  3HU1 A;  2LUM A;  4USA A;  3KW9 A;  3KH0 A;  3A46 A;  5E26 A;  4TKN A;  3TWK A;  3FE3 A;  5DCN A;  2BYV E;  4JWS C;  4B95 A;  3KP0 E;  3NJT A;  4WJN A;  5EP4 A;  2OJW A;  4ICU A;  2LVQ A;  3I5J C;  3KYC D;  4RGT A;  5JH5 C;  1XKG A;  1E9M A;  1OQQ A;  1SXJ B;  2BWE A;  3IEJ A;  3HVD A;  3NS8 A;  1SBB B;  3DHG C;  5MPO A;  1OFI A;  3AED B;  2G45 B;  4M0D A;  1MG8 A;  3EHV A;  3KWB X;  3R9X B;  3GLH A;  4L6V 6;  3C8Y A;  1IQP A;  3C0R B;  5E6P A;  4AXL A;  1PGA A;  3VR8 B;  2NTT A;  4QHS A;  2HTM E;  4GKJ M;  2JWS A;  1HQC A;  4URK A;  3VTV A;  4ICV A;  3W9C B;  1WWT A;  4AKH A;  4LNK A;  4WJQ A;  1MPE A;  1XMQ M;  2I38 A;  3IAS 1;  5GKN A;  3LW5 F;  3BCN A;  1EIJ A;  1IXR C;  1R4N B;  4KDL B;  1KLV A;  1I42 A;  2XU5 A;  1R4M B;  2WXO A;  3APC A;  5BPV A;  4FHJ A;  4WAA A;  4LG2 A;  4FCW A;  4WH4 A;  9PAP A;  1ZW7 A;  4BSQ A;  2XU3 A;  5TSS A;  1CV8 A;  2KOX A;  2Z4R A;  3HZJ A;  4IBB A;  3TMP A;  2N0S B;  1KM7 A;  4EKU A;  4DMX A;  2FOI C;  2KN4 A;  2KWV B;  2ATO A;  1JML A;  4G6Z A;  3R7Q A;  1XT9 B;  2WNM A;  1TH3 A;  1EUV B;  3AE2 B;  3QJZ A;  3D8B A;  3QK0 A;  1NB3 A;  2NTS A;  4FCT A;  2AEH A;  3PTF C;  2DZZ A;  2ZM6 M;  2DWM A;  2KW0 A;  3Q3M C;  3I51 A;  4B3R M;  5EE9 A;  1YJ1 A;  2F5S A;  4CZW A;  1TH2 A;  2LI5 A;  2CJO A;  1UWM A;  3M95 A;  1FNN A;  3ENE A;  2FAZ A;  1XNQ M;  1WMH A;  2V4L A;  4HRS A;  1J8C A;  2CWB A;  1I4X A;  4I04 A;  3B79 A;  2R4E A;  1D0L A;  1WGL A;  2CHG A;  3L2A A;  2R61 A;  3V60 A;  1MDW A;  5CHT A;  3UGJ A;  2MQJ A;  3B21 A;  4LF8 M;  3RNA C;  2NQG A;  1YJJ A;  5DPR A;  3M99 A;  4XUI A;  2DAG A;  3GS2 A;  3WAO A;  2YJ8 A;  1OQR A;  2KFK B;  1LO5 D;  3H9D A;  3FRH A;  2K6Q A;  3AE5 B;  2PTL A;  1A5R A;  3DA1 A;  4DK5 A;  1NL6 A;  3M0E A;  3ZNZ B;  2R9N A;  2GBM A;  1HR0 M;  1NQC A;  1N60 A;  3BVG A;  1SF0 A;  2OQ4 A;  5F3W A;  1GL7 A;  3ZNG C;  2LMC A;  3W68 A;  5EXX A;  2EKK A;  3FC4 A;  4NXM M;  4UDU C;  1C9F A;  2WXL A;  3SYK A;  2KWC A;  8PCH A;  1KOT A;  4MSQ B;  4M9S A;  4EE2 A;  1AN8 A;  1DGJ A;  4YXD B;  1ZPS A;  1V1P B;  3DHH C;  2KMC A;  2AGA A;  4K3B A;  1C1K A;  3RUI B;  3TJP A;  1PVJ A;  3I06 A;  4HWY A;  1GG3 A;  2BB5 A;  1GLN A;  2B1N A;  3MMP A;  4S17 A;  4RGO S;  3GRU A;  2OOA A;  3ZW3 A;  4PI3 A;  2OJR A;  2VH2 A;  2L8J A;  2D7H A;  3SHF A;  3FTD A;  1NNU C;  4X6J A;  3W67 A;  1M94 A;  4LCD E;  3IAM 1;  1IBL M;  5EP2 A;  2L7I A;  2KTR A;  2MRO B;  1PAD A;  2KZS A;  2UU9 M;  4ANV A;  5ITU A;  1UKF A;  1VSN A;  1MX0 A;  2AQ2 B;  4KSL C;  1AU2 A;  4XK8 F;  3FRI A;  3U5Z B;  1GAQ B;  4DWF A;  2BB6 A;  2JYE A;  1IP9 A;  1MIR A;  4K7C A;  3HHA A;  1NBF C;  3M3J A;  3PNY A;  1V9J A;  3WAL A;  1IN7 A;  3QA8 A;  1E9S A;  3T3N A;  2DC6 A;  3TE6 A;  1U9W A;  1R7R A;  2LRU A;  1WX9 A;  2FCS A;  3L54 A;  2Y3A A;  2PAD A;  1EWC A;  1SE4 A;  1OFH A;  3N4C A;  1PJT A;  1DO2 A;  2NPT A;  1GB4 A;  2CU1 A;  2LVO A;  5L83 A;  3TIX A;  3M6A A;  1TGZ B;  4NSO B;  3EC8 A;  1NB5 A;  3J81 S;  3ZUA A;  4EOY A;  2ACZ B;  3L4P A;  2FCQ A;  2KHW B;  4HKQ A;  3BOW A;  2ZCC A;  1ATK A;  3J2P B;  3K8Z A;  3HM3 A;  2DZN B;  4CHT B;  3Q8A A;  4ZYN A;  5LXH A;  3ZUN A;  1I35 A;  3K9P B;  1SXJ D;  2AYN A;  2ZW1 A;  2DAF A;  3DVG X;  4BS5 A;  1I94 M;  2D3C A;  2KC1 A;  3IUT A;  3B0A A;  1Z5S B;  2KX3 A;  2FUG 1;  1ESF A;  4M0W B;  5ITQ A;  1QZE A;  1I4R A;  3AEF B;  3AM9 A;  4JI1 M;  1STE A;  3ILK A;  3JSV A;  4BKS D;  1R7S A;  1SJH D;  5G5G A;  1AW7 A;  5FR6 A;  1AYW A;  3TWL A;  2BTW A;  2B1M A;  2DAK A;  5KQD A;  4LDT B;  4LRS A;  4DR6 M;  1FNV A;  3GLI A;  1VJK A;  4TUU A;  3UQA A;  1N33 M;  1XLN A;  3KOW E;  2WX0 A;  1DOX A;  4A5U A;  3AN1 A;  2IO2 B;  1FFV A;  4X64 M;  4F1S A;  2M8S A;  3H7S A;  4EEW A;  2JY7 A;  4JI8 M;  3VR9 B;  3L08 A;  4ZRJ A;  1R4M I;  1Z5A A;  2DOS A;  2V0G A;  3B74 A;  1VR9 A;  2KA6 B;  2WXJ A;  5EE0 A;  2APL A;  3ZGZ A;  3A9J A;  3Q3F A;  2XZF A;  1ISN A;  1XLQ A;  2LVP A;  3AE1 B;  3BZD B;  1EF1 A;  5E6O A;  3CWI A;  4DV6 M;  1Y8G A;  2L2D A;  3DOA A;  1D5M C;  1A5T A;  2F1G A;  4QRG A;  2YEP F;  1I4Q A;  3N1Z C;  2LGD A;  1Q6K A;  2C96 A;  2K1F A;  3NG0 A;  1ORY B;  1IUE A;  4RFB A;  1YAL A;  3RGP A;  4XDD A;  3DVG Y;  1AYF A;  3H89 A;  2DAM A;  1Q3C A;  2LAS A;  3OJ3 A;  3L25 A;  4OZB A;  1UH6 A;  3LYY A;  3VFK A;  1GVN A;  1V2Y A;  1YX6 B;  4OEM A;  3ZLZ A;  3PHX A;  1Q10 A;  2KO3 A;  1QUS A;  1OIP A;  1HJP A;  1NV9 A;  3AXC A; 
#chains in the Genus database with same CATH homology
 1YN5 A;  5KO3 A;  2YNM D;  3I4Y A;  3L28 A;  1QAM A;  1TDZ A;  1N34 M;  3SFD B;  1D5X C;  4IBI A;  3L26 A;  1T6B X;  2INP E;  4LJ4 A;  2AX5 A;  5FTL A;  3FTE A;  3LMM A;  3KFU G;  4BOZ A;  5ITR A;  3GQ5 A;  5D3I B;  1WXQ A;  3U7Z A;  4OVZ B;  4D8B A;  2QBY A;  5JZE A;  2LXE A;  1F0Z A;  3GRR A;  2CHV A;  3Q69 A;  2CJN A;  1NYR A;  1N63 A;  4RNA A;  2J7Q C;  3E4R A;  4DR1 M;  4FWH A;  1YJI A;  2K3U A;  3V05 A;  1IBK M;  4D81 A;  3PHU A;  4B7F A;  2VII A;  4MI7 A;  2CV0 A;  3PRM A;  2FE8 A;  3R8F A;  5FLX S;  3IXS A;  1FRD A;  2BBC A;  3UI3 A;  4I81 A;  4WW0 A;  4LF6 M;  3AEG B;  3MHV C;  2IGD A;  2CV1 A;  1IN8 A;  3BBA A;  3AOG A;  3PRP A;  3ZYY X;  3SAS A;  2LHD A;  3OTO M;  3GQ4 A;  4L1B A;  3O13 A;  2UXD M;  3HVZ A;  3MP2 A;  4PD2 A;  3A98 B;  1V1O A;  3FUW A;  3KOY E;  1F77 A;  1NVI D;  2PVO D;  3K2L A;  1PJI A;  3P42 A;  4GC9 A;  4MGH A;  4A6Q A;  3ZJV A;  2HL7 A;  2J52 A;  2XSZ D;  5EZQ A;  3HHZ A;  4GIT A;  3RNV A;  4Q2J A;  2QP9 X;  4NSR A;  1PUT A;  2E6X A;  5GXG B;  2BS2 B;  2BYT A;  1SXJ A;  4GHA A;  3B9J A;  3OQC A;  1C77 A;  2WXF A;  2D7G A;  3C0R A;  3TEX A;  4L4U A;  3FYC A;  4MH0 E;  5LMU M;  3IFU A;  2EKI A;  2C99 A;  4ITQ A;  1D6E C;  3SHG B;  1E32 A;  2K9X A;  2RDH A;  4XGI A;  4NAW B;  3AE7 B;  1NI3 A;  4OW0 A;  1J09 A;  4RGN A;  4IKG A;  2JYT A;  1OJL A;  1XHB A;  4S12 A;  4DR5 M;  3HHW A;  3KOX E;  4HLQ A;  1HNZ M;  2DWN A;  4HJG E;  1NJF A;  4FXC A;  4Z6Y A;  2H1R A;  1PM5 A;  3RGS A;  4JE3 B;  1T5X D;  3GRY A;  2RDG A;  1SE2 A;  4QHT A;  3EA6 A;  2E5L M;  3BK2 A;  2WXK A;  5C3J B;  1L1Z A;  2CHQ A;  1YE9 A;  2QSD A;  3L27 A;  3VLF B;  4MM3 B;  2DXI A;  3EIE A;  4LJ7 A;  1QOF A;  2L09 A;  3ZH9 B;  4O1N A;  5D7G A;  2XZU A;  1I7H A;  1L2C A;  3SMP A;  2IJ0 A;  2OPF A;  2PMV A;  3UZU A;  1K3X A;  4AG6 A;  5EJC A;  3GLG B;  2L83 A;  3VKG A;  2RGH A;  1C4A A;  3PNV A;  3ZC7 B;  3KSX A;  2UUA M;  3CF6 E;  1FCC C;  1G4A E;  4KKJ A;  3SAW A;  1ZUD 2;  1YN4 A;  3W0F A;  4FD2 A;  5FTJ A;  1V1P A;  1DKI A;  2WXR A;  1UUP A;  1JWB D;  2LJI A;  4B08 A;  1UNS A;  5HFY A;  2JX5 A;  2DZO B;  3OWE B;  3I4V A;  3KS8 A;  3FUU A;  2P5T A;  4PDI A;  5KPZ A;  3JAM S;  2BT6 A;  4B0M A;  1ET9 A;  3U5Z A;  1GOZ A;  1XXH A;  3T38 A;  4B7H A;  1IY2 A;  1QLB B;  2BJV A;  4PCZ A;  4BOQ A;  2Z3X A;  4MGZ E;  2F5O A;  3SAU A;  2NQ8 C;  1NY6 A;  1SSN A;  1N36 M;  4LF7 M;  3GP7 A;  3R2I A;  4RKX A;  2WXP A;  2JU6 X;  1EWY C;  1VZ8 A;  2CU3 A;  1DOY A;  2V3P A;  1QZM A;  1NJG A;  3FYD A;  4QOS A;  1KLU D;  2I7P A;  2UZJ A;  3AE9 B;  1HZ6 A;  4TQ0 A;  4M0W A;  2BTE A;  4KOD A;  1L8Q A;  1GL6 A;  2L32 A;  4NRW A;  2KAJ A;  1YZB A;  3MFG A;  1KFV A;  4GDL B;  4GH9 A;  2G1E A;  2PKO A;  4BOP A;  3KOZ E;  2QJL A;  1TS2 A;  5EXT A;  1M4V A;  3RFZ B;  2XSZ A;  4ZOH C;  4DV0 M;  3P1M A;  4LLG M;  4LFB M;  2BNK A;  4DV4 M;  3ZJU A;  3TQS A;  4OX9 M;  4C7Z A;  3PXG A;  3NVY A;  4XDC A;  4P16 A;  2GI9 A;  4JV5 M;  5HI1 A;  5IZ7 D;  5G5H A;  2ERC A;  5LMN M;  3GPU A;  2SEB D;  1PDX A;  1B9R A;  3TSS A;  4YSX B;  4PT5 A;  3FD9 A;  4JYA M;  2BU3 A;  1YN3 A;  3KSJ A;  3TRK A;  4GMQ A;  1SEB D;  1N78 A;  4KO8 A;  1D4B A;  3J7B A;  4HXD B;  2WDQ B;  4RGM A;  3EUB 2;  5IT9 S;  2Q2E B;  1A70 A;  2W3R A;  2I7N A;  1F2R I;  4OVZ A;  2CEA A;  4D8I A;  5DYI A;  2Y5C A;  4DR2 M;  2BW2 A;  7CAT A;  3CIR B;  1IM2 A;  3VFD A;  2R18 A;  3KP1 E;  5BMG A;  5EP1 A;  3IG5 A;  1DGH B;  1JWA D;  2PW9 A;  4AW4 A;  4C80 A;  3NWL A;  1QYR A;  3GPX A;  1K51 A;  1YUB A;  1Q39 A;  4KGR A;  2XNA C;  5FKA C;  3GLF A;  5BYQ A;  1Z6T A;  5ITY A;  1JRO A;  3HKP A;  1N32 M;  2V1U A;  4GC5 A;  4ZYS A;  1FCL A;  2KQ4 X;  3WCQ A;  1I4W A;  1HA5 A;  5H8Y E;  3LVV A;  4A90 A;  1DO0 A;  3HJS A;  1KTK A;  1XXH B;  3W5U B;  5EXS A;  1OFF A;  3BVM A;  4XWW A;  2Z84 A;  3TWM A;  3TUO A;  3DWM A;  4K0K M;  3T1Y M;  1TS4 A;  2VQE M;  3AEC B;  1K53 A;  2VZK B;  5IRE B;  1I4H A;  1L0X B;  4XE0 A;  2IPK D;  1FMA D;  4IJF A;  4MGY E;  2Y21 A;  3IT4 B;  4NL4 H;  2AQ3 B;  1E10 A;  3VRA B;  1IXS B;  4WWM A;  5LNK 1;  4KGS A;  4XBO A;  4IBJ A;  5A2Q S;  3DWG C;  3U6P A;  1CZP A;  2RGO A;  1VDD A;  3L29 A;  1RWS A;  1MHH E;  2J7O A;  3QWL A;  2WDV B;  1K82 A;  5FTM A;  5JI2 E;  2G5G X;  1NHG C;  2L6O A;  5AUK A;  4AKI A;  3U6O A;  1XC8 A;  2IGH A;  5HG2 A;  2OHF A;  3U6E A;  1J7C A;  1FXI A;  2RKO A;  3UJN A;  3AB5 A;  2MH7 A;  2LWX A;  1E6E B;  4LF4 M;  2M0A A;  5BMH A;  2K5P A;  3NVV A;  3P4P B;  5EE3 A;  3AH7 A;  3H8H A;  5H92 C;  2QIE B;  5IWA M;  2JTC A;  2KRU A;  4IBC A;  1WSP A;  2KAC A;  3FUX A;  2UUC M;  1J7B A;  3D8L A;  2BS4 B;  2Z7J A;  2XGN A;  2N9K A;  1NYQ A;  4BOU A;  2UXB M;  2C5R A;  1TKG A;  1B1Z A;  1BUI C;  2DLB A;  2Q5W D;  4RCO A;  4GKK M;  4PDG A;  3GLG A;  5ITX A;  3HWS A;  2WXM A;  3AJI B;  4IBG A;  3KVW A;  2V3N A;  3GPP A;  1QOG A;  2WU5 B;  3O65 A;  1XXG A;  2J4X A;  4ZPX A;  2VQF M;  3PT2 A;  1C4P A;  5EXP A;  4LY6 A;  3R8B A;  1SXJ E;  3W30 A;  1ZOY B;  2C9C A;  4AKG A;  2JZP A;  1ZDV A;  1IXZ A;  1RM6 C;  2YR0 A;  1IN6 A;  1QAO A;  3TL4 X;  2UUB M;  1VLB A;  4IJE A;  1ACC A;  3BB7 A;  3FTC A;  2PLP A;  3Q8E A;  2Z8L A;  2IDY A;  4JWU C;  1QOA A;  1L2B A;  2JSV X;  1X37 A;  2MJE A;  1KFY B;  3GLF B;  2DYM A;  1T3Q A;  3KS4 A;  1N5W A;  4LJA A;  2WXI A;  4OZA A;  2KZU A;  3Q8C A;  2XLJ A;  4HKZ E;  3A42 A;  1ZAE A;  2YEP B;  2XN9 C;  2VZK D;  2QMT A;  2DVW B;  3TEY A;  2R62 A;  3W31 A;  4L15 A;  4WIP A;  1LV7 A;  1ZXH A;  3VDP A;  4BB9 A;  2K47 A;  4NAM A;  3HU3 A;  3NBI A;  3RPF C;  1L1T A;  3NVW A;  2WXG A;  2F5Q A;  1JRP A;  3FUT A;  5C18 A;  5FTN A;  1J7K A;  2XEP A;  3MK6 A;  1IY0 A;  1TZO A;  2LGI A;  1PJJ A;  4IBD A;  3CF0 A;  1N61 A;  2JA2 A;  2GRI A;  2KEB A;  2D7E A;  2E3T A;  5JXV A;  3PO0 A;  4LZJ A;  2CFO A;  1YMH E;  3BVZ A;  2MJ3 A;  2WXQ A;  5ITT A;  1K50 A;  1Q3B A;  2Z4S A;  3ETR A;  1H6U A;  4AS1 A;  3E9S A;  1IBM M;  1HXY D;  3W2D A;  1J5E M;  3AMZ A;  1XMO M;  2AQ1 B;  3U4E G;  1V8C A;  3ZJT A;  1I4P A;  4JPS A;  5E6J A;  2KWD A;  1TDH A;  3LXF A;  1L4Z B;  3K1J A;  4WAF A;  4X65 M;  3GQ3 A;  1MHX A;  1W5T A;  1NEK B;  2F4V M;  4LGM A;  5BYR A;  3PSE A;  4DUZ M;  2LH0 A;  2SAK A;  3KXE C;  1IBX B;  2FBW B;  3FUV A;  3MHZ A;  3T3O A;  3I9V 1;  4BOS A;  2RMM A;  3A45 A;  2A5Y B;  4GHL A;  1DYQ A;  3U52 E;  2ONQ A;  5DNY A;  1ZP0 B;  1IY1 A;  2QIL A;  1KYI A;  1SE3 A;  4JI4 M;  3IT6 B;  5I4D A;  3GO8 A;  2RPV A;  3WHL A;  2DWZ B;  2V6Z M;  3T15 A;  3KQ4 A;  3FIL A;  1CQV A;  3PZ8 A;  1DGH A;  1FO4 A;  2M5Z A;  2QEN A;  1HQY E;  3HGI A;  4DV5 M;  3H4M A;  2V4I B;  2N9L A;  4ZHO A;  4JI0 M;  2X49 A;  1PYW D;  3U6Q A;  4KGT A;  3AEE B;  3B9P A;  4H2A A;  3W5V B;  3MJ5 A;  4FVM A;  3AE3 B;  1GPX A;  5FR3 A;  2AHM A;  1QKZ A;  4DR3 M;  1KRH A;  4M9X A;  2DWL A;  2GB1 A;  3NUH B;  1K3W A;  4NRV A;  3FAH A;  4ZRP A;  4JI2 M;  2JWU A;  4AQ7 A;  1HZ5 A;  1KLG D;  4DXF A;  3CF2 A;  4ARI A;  1NEN B;  1RFK A;  2DHR A;  1WGK A;  2H88 B;  4JI3 M;  3P4R B;  4IBE A;  2Y20 A;  3P4Q B;  4LZZ A;  1D5Z C;  4LF9 M;  3HJQ A;  4NOO B;  1DGG A;  4IBF A;  4P6V F;  3C58 A;  3V3X A;  4CQN A;  1C76 A;  3B2G A;  1WRI A;  2X38 A;  4D82 A;  1CK1 A;  4OU7 A;  4LJ8 A;  1E7P B;  3KLS X;  4OZC A;  5EQT A;  1PGB A;  4YSY B;  1DGF A;  2KMM A;  3SEB A;  4GUA A;  3BYY B;  1SB3 C;  1JQJ C;  2WP9 B;  4MB7 A;  4DV1 M;  2LEK A;  2O5R A;  2NMQ A;  3GPY A;  4B3T M;  2W55 A;  4C56 C;  4KKI A;  3B2F A;  3HJ8 A;  3VK8 A;  3FKE A;  3KDS E;  2Y0T A;  1XLO A;  4C7Y A;  3U6S A;  1XCQ L;  2WXH A;  1NHW C;  2X4A A;  3TPZ A;  1VZ6 A;  4GDK B;  4LJ6 A;  3M7G A;  1QIL A;  4AZF A;  1G41 A;  4TUW A;  4US8 A;  1BML C;  1XWI A;  3SMS A;  2QPA A;  1D2N A;  3JR5 A;  3PHW A;  1KSF X;  1I4G A;  1L0Y B;  3AEB B;  3HHY A;  2HHH M;  5FSW A;  4AG5 A;  2BJW A;  2INN E;  3Q8F A;  1MVK A;  4G4R A;  3AV0 A;  3SBJ A;  1G3I A;  1SXJ C;  4LK0 M;  2LFI A;  2XFS A;  1QQR A;  2Y5P A;  4L2Y A;  5EZS A;  4M9Z A;  4TMA B;  2YQZ A;  1ZE3 D;  2W3S A;  4A9A A;  4LRT A;  3AE6 B;  2HCB A;  3I57 A;  1PFD A;  1NVM A;  2J7Q A;  3BII D;  4MAC A;  1L0V B;  4MT5 A;  4HRO A;  1AWD A;  3FIL B;  4NZL B;  3VK7 A;  3SYL A;  1R6B X;  1YNT E;  2Y0Q A;  4DV3 M;  1GB1 A;  1FIQ A;  3NS1 A;  1ROE A;  1SJE D;  1JCK B;  3BWU D;  2K22 A;  3AE8 B;  4BBA A;  4II7 A;  2K0P A;  2J42 A;  1MU5 A;  2PIA A;  4YTM B;  1N77 A;  4NXN M;  1NSF A;  3GP1 A;  3AL0 C;  2H89 B;  4JN6 A;  3KWV A;  1TGU A;  1ZXI A;  3KWL A;  3U61 B;  1TJE A;  4A8X C;  3AOE C;  4IP3 A;  2KRK A;  3UMM A;  1QAQ A;  2CUZ A;  1VDV A;  3AEA B;  1W5S A;  1NNJ A;  3SR6 A;  4CGY B;  2C98 A;  3NVZ A;  1N5X A;  4L16 A;  2XFT A;  2L1A A;  2HWK A;  1JR3 D;  2N7J A;  2JQR B;  4FWD A;  1HT2 E;  5ITX E;  1YQ3 B;  3W1S A;  1QVR A;  1QOB A;  2OED A;  4W5W A;  1XEE A;  2WXN A;  3UK6 A;  5KPR A;  3Q8B A;  4X66 M;  1G8P A;  2WU2 B;  3U60 B;  1P7F A;  4A55 A;  3W0L B;  4D2K A;  5HHD G;  1PGX A;  1Z5C A;  3PFI A;  4G4Q A;  3BK1 A;  5C2T B;  1NY5 A;  3LVW A;  4KLN A;  1V97 A;  3EIH A;  1HQR D;  5DYG A;  2DYO A;  3CTW B;  4GLS C;  4YSZ B;  3U6C A;  3HU2 A;  4I5S A;  1TS5 A;  4L8R C;  4RF0 A;  2FFJ A;  2EA0 A;  2ZAN A;  1Z59 A;  4JI5 M;  1ENF A;  3IG8 A;  4REZ A;  1XLP A;  4WQM A;  5D3D A;  2ZBK B;  5EE1 A;  3HRD D;  3U6D A;  4DQO C;  1XF5 L;  2ON8 A;  1IBX A;  4FWG A;  4JX1 C;  4MGK E;  3GLH B;  1FD6 A;  1L4D B;  1R2Z A;  5BMI A;  1J7A A;  4LJ9 A;  4D80 A;  2I2Y A;  3SC3 A;  4N59 A;  2EO2 A;  4DR4 M;  4DUY M;  1YSY A;  1QT9 A;  2M19 A;  5AUI A;  4G4N A;  3PZ7 A;  1JQ4 A;  3NZ3 A;  4YWG G;  1ET6 A;  1T3T A;  2BS3 B;  3AE4 B;  4I4L A;  1DGB A;  5JI3 E;  3TEZ A;  1JWS D;  1EU3 A;  1TKY A;  3LQQ A;  4OHJ A;  4AQY M;  1HEZ E;  4LCB A;  1DOI A;  1CJE A;  4B3S M;  2YFQ A;  1L6V A;  4BLC A;  3R2T A;  1R2Y A;  2PVG C;  1E9R A;  3SFE B;  3K92 A;  5T8I A;  4IBK A;  1HNW M;  4RH6 A;  1HNX M;  3P4S B;  1FFU A;  4LF5 M;  1GKI A;  1TS3 A;  1L6U A;  2L52 A;  3THG A;  4IOI E;  4ZRQ A;  1E0Z A;  4N6E B;  3U6L A;  3U6M A;  2L7H A;  1L2D A;  2ZAO A;  3BYT B;  1JWU D;  2CE7 A;  5EP3 A;  4I8O A;  1MI0 A;  4L78 A;  4J3O D;  2LHE A;  4B0E A;  1WYG A;  4X62 M;  1XNR M;  3P63 A;  4AI6 A;  3J27 B;  2UXC M;  1TYG B;  3PVS A;  2V1C A;  3EGR A;  1C79 A;  4DR7 M;  1JAL A;  5H37 D;  1EE8 A;  3SAV A;  4FCV A;  2J53 A;  3VKH A;  1ZQ9 A;  2DBY A;  1IGD A;  1QF6 A;  4KX6 B;  1YQ4 B;  1IN5 A;  5C1B A;  2JXT A;  4G4O A;  3SAT A;  2ZW0 A;  3ABV B;  5FTK A;  1QQW A;  1K52 A;  1JR3 A;  3VQI A;  2R65 A;  4R7G A;  5KPT A;  4Z8X A;  1BXT A;  4YTN B;  2F5P A;  1UM8 A;  2M60 A;  1Z5B A;  4B3M M;  3AKZ A;  4TSS A;  3MTV A;  2C9O A;  1P7E A;  3URY A;  1FJG M;  4DV7 M;  1TY2 A;  4KHP M;  2QCU A;  4QNR A;  4EIW A;  1N75 A;  2BTW B;  4YT0 B;  4IUM A;  2XF3 A;  3GLI B;  4LJ5 A;  4NJC A;  2J7N A;  1SXT A;  1VZ7 A;  4YHH M;  3JR4 A;  4RF1 A;  3T1H M;  1JW9 D;  1FEH A;  3SFZ A;  4XWT A;  5FK9 C;  2KXE A;  1FNU A;  4ZTB A;  1EM7 A;  4ARC A;  2CV2 A;  4FW9 A;  3HUI A;  3ZQ4 A;  5BYS A;  4TQ1 A;  3BY4 A;  3ZNH A;  3DZD A;  3GRV A;  1Y56 A;  2WQY B;  1FRR A;  1S3S A;  3BOS A;  3Q8X A;  2R45 A;  1N62 A;  4LTU A;  4JI6 M;  2M56 B;  2WDR B;  4LFC M;  1XO3 A;  3LB8 C;  3QAU A;  4LGY A;  1TY0 A;  2WS3 B;  5BR8 M;  1TKE A;  2HDE A;  4QOZ C;  3J7A S;  4B7G A;  4ITK A;  4GRI A;  4L23 A;  2D5G A;  2W54 A;  4HL4 A;  1L5P A;  1IN4 A;  3AOE A;  4XZX A;  3TEW A;  4IDI A;  2G8L A;  3SAR A;  1UGJ A;  4US9 A;  3U61 A;  2QBY B;  3U2S C;  1IGC A;  3AFH A;  2LNH C;  4MH8 A;  2FNA A;  4CIS A;  1HT1 E;  2W82 A;  1F2R C;  4ZHP A;  2MEK A;  3MC0 B;  2QZ4 A;  2F5N A;  4LFA M;  3MP9 A;  4QNM A;  1QAN A;  4JI7 M;  4YTP B;  1G59 A;  2JRI A;  1VRA B;  4HEA 1;  3KW6 A;  3E56 A;  4N58 A;  1C4C A;  2KDM A;  3LQR A;  5KQ8 A;  3DFZ A;  1C78 A;  4A3V B;  2DWQ A;  1FXA A;  1SIJ A;  1KF6 B;  3AV8 A;  1JWM D;  2B76 B;  3VRB B;  1TH4 A;  1EU4 A;  2QEJ C;  2EUC A;  3N9Y C;  2XH9 A;  2ICI A;  1E94 E;  3U60 A;  3NRZ A;  2WLB A;  4MGI E;  1FNW A;  2R4J A;  4D8E A;  3RFW A;  1FM0 D;  3RE8 A;  2G9H D;  2HKJ A;  2IGG A;  2TSS A;  4R3D A;  2MJD A;  4WUR A;  2EEL A;  4GIP A;  4IIW A;  3GB1 A;  4DXG A;  4YY3 M;  3J9C A;  3HHX A;  1RYJ A;  8CAT A;  3WHK A;  3J80 S;  1UWX A;  4DV2 M;  1KH0 A;  2ZAM A;  1XCT L;  3FTF A;  2X8A A;  4JXJ A;  3ZCB B;  1ZDX A;  3VDU A;  2R46 A;  3HU1 A;  2LUM A;  4USA A;  3A46 A;  5E26 A;  3TWK A;  4JWS C;  3KP0 E;  5EP4 A;  4RGT A;  1E9M A;  1OQQ A;  1SXJ B;  3HVD A;  1SBB B;  5MPO A;  1OFI A;  3AED B;  4M0D A;  3R9X B;  3GLH A;  3C8Y A;  1IQP A;  1PGA A;  3VR8 B;  2NTT A;  4QHS A;  2HTM E;  4GKJ M;  1HQC A;  3W9C B;  1WWT A;  4AKH A;  1MPE A;  1XMQ M;  2I38 A;  3IAS 1;  5GKN A;  1IXR C;  2WXO A;  5BPV A;  4LG2 A;  4FCW A;  4WH4 A;  5TSS A;  2Z4R A;  4IBB A;  3TMP A;  2N0S B;  2FOI C;  2KN4 A;  1JML A;  4G6Z A;  2WNM A;  1TH3 A;  3AE2 B;  3D8B A;  2NTS A;  4FCT A;  2ZM6 M;  2DWM A;  2KW0 A;  3I51 A;  4B3R M;  5EE9 A;  2F5S A;  1TH2 A;  2CJO A;  1UWM A;  1FNN A;  4HRS A;  1XNQ M;  1I4X A;  2R4E A;  2CHG A;  2R61 A;  3L2A A;  3UGJ A;  3B21 A;  4LF8 M;  1YJJ A;  3GS2 A;  1OQR A;  1LO5 D;  3AE5 B;  2PTL A;  3DA1 A;  3M0E A;  1HR0 M;  1N60 A;  3BVG A;  1SF0 A;  2OQ4 A;  5F3W A;  1GL7 A;  2LMC A;  5EXX A;  3FC4 A;  4NXM M;  4UDU C;  1C9F A;  2WXL A;  3SYK A;  4M9S A;  4EE2 A;  1AN8 A;  1DGJ A;  4YXD B;  1ZPS A;  1V1P B;  2AGA A;  1C1K A;  1PVJ A;  2BB5 A;  1GLN A;  4RGO S;  3GRU A;  2D7H A;  3SHF A;  3FTD A;  1NNU C;  3IAM 1;  1IBL M;  5EP2 A;  2L7I A;  2KZS A;  2UU9 M;  5ITU A;  1UKF A;  1MX0 A;  2AQ2 B;  3U5Z B;  1GAQ B;  2BB6 A;  2JYE A;  3PNY A;  1IN7 A;  1E9S A;  3T3N A;  3TE6 A;  1R7R A;  2Y3A A;  1EWC A;  1SE4 A;  1OFH A;  1DO2 A;  1GB4 A;  3M6A A;  4NSO B;  3J81 S;  2ACZ B;  3L4P A;  4HKQ A;  3J2P B;  3K8Z A;  2DZN B;  4CHT B;  3Q8A A;  1SXJ D;  2ZW1 A;  1I94 M;  2FUG 1;  1ESF A;  5ITQ A;  1I4R A;  3AEF B;  3AM9 A;  4JI1 M;  1STE A;  3ILK A;  1R7S A;  1SJH D;  5G5G A;  1AW7 A;  3TWL A;  2BTW A;  5KQD A;  4LRS A;  4DR6 M;  1FNV A;  3GLI A;  1VJK A;  1N33 M;  1XLN A;  3KOW E;  1DOX A;  4A5U A;  3AN1 A;  1FFV A;  4X64 M;  4JI8 M;  3VR9 B;  1Z5A A;  2DOS A;  2V0G A;  5EE0 A;  1VR9 A;  2KA6 B;  2WXJ A;  3ZGZ A;  2XZF A;  3BZD B;  1XLQ A;  3AE1 B;  3CWI A;  4DV6 M;  3DOA A;  1D5M C;  2YEP F;  1I4Q A;  2C96 A;  1ORY B;  1IUE A;  4RFB A;  3RGP A;  4XDD A;  1AYF A;  1Q3C A;  3L25 A;  4OZB A;  3LYY A;  1GVN A;  3PHX A;  1Q10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...