4RNAA

Crystal structure of plpro from middle east respiratory syndrome (mers) coronavirus
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
321
structure length
319
Chain Sequence
LTIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVDKVRSLKLSDNNYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSDCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords papain-like protease
publication title Inhibitor Recognition Specificity of MERS-CoV Papain-like Protease May Differ from That of SARS-CoV.
pubmed doi rcsb
source organism Human betacoronavirus 2c emc/2012
total genus 92
structure length 319
sequence length 321
ec nomenclature ec 3.4.22.-:
pdb deposition date 2014-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4rnaA02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rnaA01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4rnaA03
4PT5A 4OVZA 4OW0A 4M0WA 4RF0A 5E6JA 3MJ5A 3MP2A 5KO3A 4R3DA 4RNAA 4WURA 4REZA 4MM3B 4OVZB 4P16A 4RF1A 2FE8A 3E9SA
chains in the Genus database with same CATH superfamily
3NJTA 1G71A 1IBKM 1HJPA 2J5YA 1X9YA 3KUZA 1AU0A 4WAFA 3KKUA 1XCQL 1IN7A 1E8YA 1LM8B 2E00A 4ZTBA 3SHFA 3V6EA 2A5UA 1UZXB 3AE7B 2ZAMA 3B89A 2L09A 4PD2A 1EWLA 3GLGA 3EECA 2JX5A 1GPXA 4RCOA 4DR4M 1VJVA 5PADA 4WURA 2AWTA 2ZZPB 4HCPB 4PK1A 1PBHA 2XZUA 3BYTB 4HEOA 2NQIA 2K9XA 3P63A 2CJOA 3GRRA 3L28A 2V1YA 7PCKA 2YJ2A 4B7HA 2G8EA 4EZKA 3LQQA 2XZFA 2DWNA 3DBHI 3HHWA 1YSYA 1UGMA 4HCNB 3RVWA 2IBIA 1MFWA 1EIJA 3Q3JA 3PPAA 4BKTA 2EKIA 1QUTA 1VG5A 3GLFE 4LF9M 4LK0M 2J4XA 4OHJA 2V4IB 3P2BA 3TMPB 4FCWA 3TL5A 3MHSA 1RLFA 2WXOA 4GDKB 1ZAEA 2CHZA 4B3TM 3FD9A 4NC6A 2QBYB 4LJ8A 2MLBA 1UUPA 4LFBM 2LHCA 4HRSA 4ICUA 3DVNU 1HNZM 1QZEA 2DYMA 3VRBB 1V34A 4LJPB 3RD2A 1Q39A 2VQEM 3WANA 4YV8A 2LZ6A 5H8YE 5FTJA 2OEDA 5DPSA 4K7CA 4FA6A 4MACA 3UGJA 4KKJA 2WXGA 1NDDA 1F2RI 1P1AA 2SAKA 1XNQM 3IG3A 3KSXA 4DR6M 4TUUA 1PPPA 4GIPA 3IAS1 1L1TA 1A5RA 2FO5A 4EUTA 1IN4A 2FFJA 4MH8A 4XX5A 4RF1A 4LF8M 1V2YA 3KLSX 4IJFA 2DYOA 4B95A 1NNJA 1PXVA 4BOQA 3RVXA 4PDIA 2KFKA 3PBHA 1YK8A 3U6PA 2R9MA 4M8NA 1F29A 1TGUA 1WR1B 2DHYA 2DZMA 2K8BA 3ZDTA 5E6JA 1IGCA 1SJHD 1EWOA 1QVRA 4CGYB 5DYIA 4QOSA 3I9V1 4WJQA 2RKOA 2VHFA 2GBNA 3VKHA 1LV7A 4BBAA 2G6DA 4R3DA 3W0FA 1ME3A 4UDUC 4LJOB 3ZQJA 4YSZB 3VK7A 2OJWA 4E74A 2LWPA 1R4MB 9PAPA 1YIWA 1XLOA 4GB9A 4MDKE 2CHVA 3AI5A 4MM3A 1V5TA 5JZEB 4XWTA 2PVOD 3FUTA 1N5WA 2M4NA 1PJTA 5HHDG 4B0EA 5J18A 1KFUL 1V9JA 3PREA 2F5QA 4LFAM 4FJVB 3D8BA 2G4SA 3FILB 2MBOA 3RNEC 3AEEB 1KM7A 3BOWA 1QOFA 3HM6X 1AYFA 3Q8FA 3BWKA 1XO3A 2FIFA 1S1QB 2V3PA 4AOFA 3B79A 4UN2B 5GMVA 4RGNA 2FT2A 1WXQA 4LLGM 2LMCA 2PEAA 2AQ2B 1NNUC 1DKIA 1TTEA 5LXIB 3FTDA 1E94E 2HD5B 2JVCA 4OVUA 2Q2EB 2PJHA 3BZDB 3A9KB 4NJ7A 3ZJTA 1XXHE 1BP4A 4NSOB 3Q8BA 2BJVA 4JXJA 2QHOB 4GLSC 2G3QB 1BXTA 4BOPA 1OJLA 2KD0A 3RYTA 2PLPA 4KT0F 2DAGA 4OZAA 3IXSA 3T15A 4ARCA 3NUHB 3QYEA 1FFVA 2UU9M 4C4VA 3PVSA 2MW5A 3B0AA 1TKEA 4WAAA 4AJWA 1VZ6A 4MGZE 3RPFC 1KHPA 2R4EA 3CGWA 2B76B 1MHHE 2Z0DB 3QK0A 2E03A 4AXLA 1WZ3A 1GECE 3MHHA 2N0SB 2MP2A 3LXSA 3QX1A 3Q3FA 4BOUA 2KT7A 4NL4H 4X64M 2FNJB 3RT3B 3NHEB 3GQ5A 1QOGA 4DV6M 1G3IA 4RMAA 1STFE 4KGTA 2WBFX 2JWZA 4JLCA 1ORYB 4ZRQA 2E6XA 3OVXA 2FRAA 3PRPA 4BKGA 5D6JB 1Z5BA 1YJJA 3N3KB 4LNIA 2CRUA 1HZ6A 1I4XA 1JWUD 2RGHA 3J80S 2KOXA 3EGRA 2LVAA 4FVMA 4MGKE 3ZNZB 1NV8A 2W82A 4M02A 4YWGG 1QDRA 1I7HA 3V05A 1YZBA 5AZHA 5FK9C 5ITRA 2CV1A 5HKHA 2H7JA 1PIPA 1I42A 3TL4X 4Q8HA 1HUCB 3A9JA 5IA7A 1RM6C 3B1LX 1X37A 1WI0A 1NI3A 5AEKB 1WMHB 3SMSA 5F3WA 3K9MA 1HXYD 2Z0EB 4FJZA 5KQ8A 5GXGB 4D8IA 4RNAA 4I04A 2G8JA 3WXEA 1N75A 4OZCA 2J7QA 3O0UA 4YYQA 1SB3C 4MJSA 1TTNA 1D5XC 3DVNV 4HDQA 4OVVA 4IWQA 1ZW7A 4QRGA 5J2RA 1FD6A 5EP2A 5DFLA 2UXCM 1GC6A 1AYWA 1L2DA 1TZ1A 3U4EG 4DXGA 2QSFX 3I3TA 1XF5L 4YSXB 1GABA 2G5GX 2WXRA 3U2SC 2AUXA 2AYNA 2Z59B 1RRBA 4X66M 4W9FA 1WY8A 3GRUA 4IBBA 2BYTA 3KWZA 3R7RA 5CHVA 2WSFF 3HHYA 1K52A 1AARA 3GS2A 2R0IA 4NAMA 4G50A 2FOIC 2C99A 4M00A 1T6OA 5ITQA 4JYAM 2IO3B 5AZFA 4QOZC 2KX0A 4JI4M 2YJCA 1YN5A 4JX1C 4DV4M 1V86A 2IY1B 3H8CA 1WGDA 4DR1M 3AULA 1OQQA 3A33B 1NY6A 2CB5A 2ATOA 1PPDA 4NOOB 3KOWE 2KRKA 1RU3A 2DENA 3H89A 4X62M 1N62A 4XZXA 2JNHA 4TQ1A 1FM0D 2N4FA 1MIRA 1JCKB 2D3CA 1HQYE 1IYFA 2RPQA 4CJ6A 4XGIA 2JQFR 3ONSA 1JB0F 3BY4B 3T1HM 3U6EA 2D5GA 4KIKB 4ZYNA 2EMSA 1YUBA 1KJTA 4AKHA 1OEYJ 3IG8A 2D10A 2K8CA 2HE7A 3TPZA 2M56B 3KYDD 2O6VD 5IN7A 2C0YA 3KW9A 2JTCA 1Y8GA 1P3QU 4LNKA 3ZUAA 4MGYE 3UK6A 1GC7A 2G8LA 4A90A 4D8EA 4W9GA 3APCA 3BK2A 3V6EB 2DWZB 8CATA 4HL4A 2WDTB 1TS2A 3VTUA 1C1YB 1PYWD 3GLGB 4N59A 3MJ5A 1CPJA 2D3AA 4KZ0A 4LNFA 4G4RA 5HI1A 4GRIA 4WWMA 3BOSA 2R9CA 2D2QA 5FLXS 1TIFA 4Z6YA 1SEBD 3HY5A 3ZXRA 3FTCA 2Y21A 3P5WA 5IWAM 3KX1A 1HQRD 1SE2A 5JH3A 3T38A 4BBNF 4M9XA 4DR3M 2WS3B 2IBIB 5CHTA 2XBBC 2O25A 1QAMA 3NVZA 3J81S 4L16A 3JSVB 4L2YA 1QLBB 2LNHC 2DZIA 3RVVA 4WA6A 1L0YB 4F8CB 3N4CA 4KLBA 2IY0B 1TS4A 5H37D 3MP2A 1WJ6A 2V1CA 2MRPA 2ZVNA 1NSFA 2KJRA 3B08A 3DBRI 5DPRA 2IO0B 4S0RA 2JZZA 1IQPA 1G6JA 1GL7A 2DNAA 5ITUA 4QH6A 4W9CA 4ASWC 1NHGC 2QILA 1JQPA 2ON8A 1RFKA 3ZCBB 1F77A 1V33A 5AUKA 2K22A 2QJLA 3PTFC 2Z8YM 2RDGA 1STEA 1CTEA 1ATKA 1BGOA 4HPLB 4AZFA 4BSQA 3RMKC 4HPPA 4HWIB 3BXWA 2QIEB 2P7UA 2D3BA 2DWLA 2K8HA 4FK5A 4HPMB 2INCC 4MT5A 2CIOA 1ME4A 3NBXX 3U6CA 5IT9S 1R2YA 1XHBA 2PVGC 1C77A 2GBKA 4LNNA 5JXVA 2DX5B 2BS4B 4I6LB 3GOEA 4I81A 2XGNA 4S12A 2ZNVC 3N9YC 4ANVA 1YT7A 1BT0A 1DOIA 4HWYA 2GBRA 1UF0A 2C5LC 3APDA 2DC9A 3R2TA 1I4GA 3DWMA 3HK0A 4ANXA 4ZDVA 1E10A 3NS1A 4NXMM 3OAWA 4XGAB 3HU2A 4DUYM 2GQFA 5JH5C 2JA2A 1Z5CA 3M3JA 3L2AA 3L27A 3AE3B 2LXAA 1QXPA 3R3MA 4DDGD 4P6EA 5EQTA 2L7RA 4YXDB 1QOLA 2AYOA 1ZGUB 3C0RB 1NJGA 3L25A 1F52A 3SC3A 4MM3B 4DV1M 4KVGB 3HHAA 1TZOA 1C3TA 1SG9A 3KOZE 4EOYA 3FYCA 2FTDA 1IBXB 3X23A 3PT2A 4OZBA 4B3SM 1F2RC 2H5XA 2J53A 3AU5A 1J09A 3QQ8B 2MGWA 2KXEA 3EA6A 3D6SA 1GVNA 3RNFC 3RNGC 2KQSA 4O1NA 3FTFA 1WIVA 1IP9A 1P9DU 3MMPA 1FMAD 3ZW3A 3I06A 5EXTA 1DOYA 4MZSA 1V1PB 4PS3A 1TKYA 2KX3A 1JWAD 1HT1E 5FTMA 3Q8AA 2J0MA 2Y5CA 2LASA 3KFUG 1J7KA 4LJ5A 1KLGD 2B3AA 3N1ZC 4LCDE 1EWMA 4YYRA 1FCCC 4A3VB 4BZAA 2CP8A 3NOBA 3I57A 2AU1A 2GMIC 3R2IA 1SNKA 2JY6A 1GMYA 2JP7A 3MHZA 2JZ1A 3KVFB 4FULA 3C9EA 3NVVA 4IBGA 1MI0A 4C4VB 3SHGB 3D8LA 3NHEA 3H1UA 2NS5A 3VAWA 1UWXA 3AEFB 5JHAA 2WNMA 2BW2A 1JR3A 1N78A 3CSTA 4ZRJA 1TLOA 2P86A 1DV0A 1F9JA 1FO4A 2ERCA 3AU4A 1MJGM 1GOZA 1T3TA 4A20A 3TEWA 2J7OA 3HIZA 3N3KA 4YVAA 1GG3A 3HWSA 3A46A 2XH9A 3K9OB 4LTUA 2NR2A 3LJ3A 2K6BA 2KC2A 5K16A 2BPSA 4G6ZA 2KDMA 3WHKA 2KTRA 1TYGB 2W3SA 2L8JA 3PRPB 3IVFA 2JWSA 4FBJB 1PQSA 4TMAB 4LZZA 3KUDB 1TS3A 2KZUA 4W5WA 1ZDVA 5KHOA 4NXNM 4MGHA 1FRDA 2VF7A 5JI2E 4GH9A 4IBFA 2D7EA 4RM9A 4G11A 2QENA 3U6OA 1GJTA 3M95A 1WMHA 2AL3A 3RN9C 2FUHB 2IDYA 4BAXA 1TBEA 1QDQA 2DZZA 2ZBKB 2R2OA 5D7GA 1WZ0A 1JQJC 2Y5BB 3T3NA 3A9JB 4J3OD 4JPSA 2PW9A 3DBRB 4LRSA 5TR5A 2LXEA 2WX0A 2WX1A 3VTWA 1OTRA 1M94A 1ZOYB 4ZRPA 2JF5A 1V6EA 1XLPA 5ITXE 2PNSA 1XT9B 1ZQ9A 3B2FA 4XBOA 1GCBA 5EE9A 2J7QB 1YX6B 2MJEA 4MJSB 2R6FA 3Q6BA 2L0TA 2MA9B 4FWGA 2HTME 4Z8XA 3B7NA 1Q1OA 2ACTA 2LVQA 3GLFB 3GLHE 2ACZB 5AZGA 3AI8A 5KPZA 3N1XC 1U9VA 1YQBA 2X8AA 2RRUA 3RNBC 3SAWA 2LD9A 3I3TB 1NYRA 2MX2A 3ZQ4A 2BNKA 4BS5A 4FCTA 4DHJB 1XMOM 2G7YA 2LUEA 3LDZE 4ZUXU 2KZRA 3GLIE 4CQNA 2XSZA 1V1OA 5FTNA 5BYQA 1LFDA 1WJUA 2DVWB 1WX9A 1KOTA 2DCDA 4RY2A 1V5OA 1U5IA 2DAEA 3KWLA 1I4HA 2D11A 3PHWA 2WXLA 4OVZB 3L13A 3X0WA 2LVOA 2DZYA 2KN5A 1QDTA 4HJGE 4M9SA 1U9WA 3C19A 4PYZA 1Z2MA 2F5OA 1SE3A 4XK8F 4IOIE 2LHEA 1AU4A 4FLHA 3UINB 3APFA 2HCBA 2GOWA 1W5TA 2CS4A 1KYIA 4W9HA 3I04M 2R44A 1WSPA 2DBYA 5BYSA 3BY4A 4DWFA 2XNAC 3BPMA 2DENB 4KIKA 1ACCA 3PFIA 2APLA 4FHJA 1DYQA 2UUAM 3UIOB 2L4EA 2DZKA 3MC8A 2LHGA 2OP3A 4CDDB 4Q7JA 1D3ZA 2Y5PA 4DV2M 3SYKA 2MBEA 2BGFA 3TRKA 1N61A 4A5UA 1AUAA 1Y08A 1XD3B 1TS5A 1PGAA 3KW6A 4BB9A 4LRTA 3AE1B 3DVGY 3NS8A 3JR5A 4P1CC 2K47A 2DJFB 3ZJUA 3KOXE 1E32A 4EKUA 3U5ZA 5EP4A 2WDVB 3H4JA 4ICVA 1VEKA 1GLNA 2UZJA 1VLBA 4RGTA 3CTWB 5CVMA 4IM2A 1T0RC 1WJ7A 1VRAB 2R6NA 2MWSB 1PJJA 4NNJB 4YT0B 4C00A 1Y8RC 3I63C 2R9OA 1SXJC 1ESFA 4G3XB 2Y6EA 2M17A 2R61A 5KPRA 1IUEA 3JSVA 5HG2A 1WE7A 4BQVA 3FTEA 1JRUA 2KDFB 5IKCM 1BUIC 1GL6A 3FUUA 5JHBA 2MHJA 1PVJA 3H7DA 2KDEB 3VRAB 3L17A 2INDC 5KPTA 4Q2JA 4YTNB 1PGYA 2BBCA 1XXHB 3VQIA 5E6PA 3GO8A 4L8RC 2FUDA 5EE0A 2JRIA 2I7NA 1QQRA 3WHLA 1QANA 3T3OA 4K81A 1WGHA 4GMQA 3K8ZA 2LVPC 5CHFA 2DC7A 2Z4SA 2LGDA 1OIPA 5EF4A 1SSNA 5A24A 3IT4B 3PNRA 4LZJA 3EFUA 2N9LA 4JL9A 4JI0M 2N35A 1OFHA 2QPAA 3IFWB 3RNCC 2FQ9A 4MSQB 1TH3A 1YNTE 4TSSA 3VH4B 2NCNA 2DC6A 1QUSA 2FYEA 2K0PA 1VDVA 4C80A 3AECB 2NQGA 1AIMA 4K3BA 3H8HA 3JYUA 1QT9A 4PT5A 2H89B 8PCHA 2H1RA 1MN3A 1L6VA 3NVYA 4NRVA 2HWJA 1MVKA 4KGSA 3QWLA 3VUXA 1VDDA 2AEHA 4R7GA 5A2QS 1WGKA 1H6UA 4LJ9A 1P98A 1QKZA 2GB1A 4WQMA 5EXXA 2OJRA 4C7ZA 2LI5A 2IGHA 3BC3A 3UF8A 7CATA 4IP3A 1JALA 1FIQA 2FNAA 3KS8A 4REZA 3NZ3A 4RKUF 2KDIA 3Q3OC 1T0YA 1VZ7A 2KFJA 2WXQA 3LYYA 3RZFA 4TQ0A 1XWIA 2V9HA 3C0RA 1D6EC 3W9CB 5FR6A 4L4UA 2BTWA 3W5VB 4BS6A 1KLVA 2CV0A 1S3SA 1EU4A 1ZP0B 2QQ8A 4HKZE 1IBXA 5LLIA 1A5TA 1FXAA 3P5UA 3B74A 3FE3A 3OTOM 2AYOB 4X6HA 1SXJA 2HL7A 4BFRA 5IZ7D 1IFYA 5BPVA 2Z7JA 1CJEA 3URYA 1TT5B 1YE9A 4X6JA 2JY7A 1V49A 5DCNA 1KHQA 3T9LA 3PS6A 1IXZA 3IECA 2J7QC 3PT2B 1Q0WB 4IBCA 4A55A 1RYJA 3FRIA 4WWPA 1V1PA 2FH0A 4N4ZA 4GGQA 4GKKM 1CZPA 3DPDA 3E46A 3EHVA 3AOGA 2W55A 3AE6B 3MK6A 1SIJA 1IGDA 2IZVB 1TDZA 2LVPA 4IBKA 1GB4A 2IJ0A 4A3PA 3BB7A 1GJZA 1K3BB 2BB5A 4Q8GA 4GKJM 1XXGA 4HEA1 2L00B 5CHVC 1Z5SB 3AE5B 1ET9A 2L52A 1VQ1A 1EWYC 2CFOA 2G1EA 3FC4A 4YTPB 1YK7A 1N32M 3KP0E 3E4RA 4B3RM 2WQYB 2OOBA 3W0LB 4USAA 5E6NA 4ZRKA 2JY6B 2KDLA 2FCQA 4CYEA 2GRIA 2CU1A 1NVID 4G4NA 3KVWA 1XLNA 2BWFA 3WIMA 4LG2A 6PADA 1ICFA 4DHZE 1VSNA 1DO2A 2EUCA 4JI7M 1R6BX 3K9OA 1WYWB 3CMMB 3BBAA 4ZRIA 3BBZA 2EO2A 1C4CA 3IOQA 1ZMVA 1WHCA 2REXA 5DNYA 2C96A 2HH5A 2CV2A 3TCAA 4WW0A 2AVWA 2OPFA 4QBBA 3VXWA 3WAOA 3CBJA 3DBHB 5LMUM 1NO1A 2QDFA 5BYRA 1F1HA 1AU3A 2ZNVB 1YX5B 2LRWA 4W5CA 2KTRB 1UBQA 3KFQA 4JI1M 2R18A 5EXSA 2WXKA 2ZTDA 3UGBB 1I4WA 3J7AS 2PE9A 1ZKHA 1E0ZA 4KV2A 2KKCA 1J8CA 1HR0M 3TE6A 2Y5BA 2CR5A 3WAPA 2UUCM 2DYBA 3UIPB 2NQAA 1N6ZA 2VDBB 1WGRA 1U9QX 3ZO5B 3HHXA 3SAVA 4YYWA 2FAZA 2WU2B 1TY2A 2KC1A 3PVLA 4IIWA 2CKHB 2O6XA 2Y3AA 3ZVVA 2N7EA 2F7DA 2MSED 1LGRA 1PGXA 4DK5A 2CWBA 3QCAA 1N60A 3BVZA 2C9OA 4HJKA 1MHXA 1N5XA 1OTRB 3K92A 2M8SA 2EELA 2M0AA 2J7NA 3GLFA 2DZLA 2DAMA 3Q8GA 1J7BA 3P4PB 5J17A 3J7BA 4PS8A 3LCUA 3HKPA 2HKJA 3L54A 4FWHA 2TSSA 2ZW0A 3AE8B 1NJFA 4WJNA 2X4AA 4KSKC 1ITOA 2R4JA 2AX5A 4MSXA 2WU5B 3AJIB 1XMQM 4P1BC 4CDEB 4URKA 3KUCB 2ZM6M 1I4RA 1OQYA 2ARYA 4LNOA 2DI0A 1AIPC 1ZV1A 3P5VA 4OVZA 2O01F 3VR8B 3KWVA 4HVBA 2BKRB 3DBLI 3NG0A 1L2CA 3VUYA 2KYWA 5C1BA 2MJDA 2LUMA 2JQRB 4K7UA 2NPTA 4KHPM 1T6BX 3GPPA 3TJPA 1B1ZA 3PHWB 2LGIA 1Q3CA 3SYLA 1WWTA 2JXXA 4B9KA 3RUIB 3FKEA 3PXGA 5JI3E 3P4QB 3LB8C 5IREB 2C7HA 3B7ZA 2XN9C 1QOAA 3PW3A 4X57B 2J52A 4NY0A 3DVGX 2C9CA 3U6SA 3P1MA 4L15A 3OF9A 3ZIMA 3IT6B 1NBFC 3A4SC 4MH0E 3QAQA 2LGSA 3P4RB 4L78A 2JY5A 3ERVA 1FFUA 2J0JA 4DBGA 3GZNI 2F5SA 3OJ4B 4ZPXA 1YD8U 4JV5M 3GPYA 1OAOC 2J42A 3B9JA 3V61A 3VK8A 2M60A 2KHHA 4FXCA 4LDTB 4L1BA 4P6GA 5KHQA 2F4VM 2WGSA 1FPYA 3I5JC 1E8ZA 1T0QC 2RMMA 4DQOC 2L3ZA 1TL9A 3OWEB 3TSSA 1WRDB 3U5ZB 4PS7A 4B6WA 1E7VA 4KKIA 4RH6A 1FJGM 2FCSA 4EEWA 2X8XX 3QSDA 1LO5D 4L6V6 4DR2M 2DNFA 2XK5A 1F2BA 3VH3B 3AV8A 1ZCMA 4RGMA 5C23A 2IGDA 3ZRFA 1L5PA 1KFYB 2JRHA 4US9A 3O65A 4YY3M 2ZJDA 2QNJA 2ZPNA 3N20C 1DGJA 2KQ7A 2WXFA 3DHIC 4GITA 4HXDA 2E02A 2XFSA 1XXHA 2K6QA 2WZJA 1QQWA 4IJEA 3ZTCA 1KFXL 4PDGA 4KSLC 2KNBA 2Y0TA 4RF0A 3ETRA 1TR8A 4D8BA 2XEWA 5D2MB 2V6ZM 1WXMA 3QJZA 2M0XA 2BS2B 4P17A 5CVNB 3HUIA 2E5LM 3VKGA 4N8WA 1KLUD 5E6OA 3OG5A 4W9EA 2PREA 2JRIB 3QT4A 3IBEA 2Q5WD 2K6DB 4M01A 4D80A 2BT6A 1PJIA 1PUTA 3K24A 3QYBA 3P5XA 4G4OA 1T0SC 3HD3A 5BO4B 2INNE 2L0FA 3ZC7B 1THEA 1IXRC 1XB2B 4FJYA 1JROA 3TEXA 2J0KA 2L2DA 1P7EA 1V97A 3I4YA 2ZTCA 1DGHA 3U6LA 4TUWA 5TSSA 3S3QA 1Q02A 2RGFA 1X1MA 3TEYA 3HHZA 3Q69A 4RM8A 3LQRA 2DHRA 2HWKA 3C3DA 2VZKB 4OEMA 2QMTA 2F1GA 2Y0QA 1UM8A 3M0EA 2JZ0A 1KF6B 2O6VA 2DCCA 2OOAA 1OFIA 1JWSD 1OFFA 2KVZA 2JXTA 3EFCA 3THGA 2HDEA 2DOSA 1DO0A 1EU3A 1DOXA 1MEMA 1JR3D 1C4PA 3UQAA 5EXPA 3K9PA 2KLCA 1NB5A 3Q3MC 3Q8EA 4G3OA 1JMLA 4AQ7A 1VD2A 3LXFA 1YJIA 1WFYA 4FWDA 1OAIA 1PDXA 1E7PB 1C4AA 4P16A 1QOBA 2BTWB 5FPWA 2V4LA 1CUKA 3JAMS 1P7FA 3H6SA 1E9MA 2BS3B 3HHMA 3C3EA 2ZANA 4B08A 2N1WA 1C1KA 1UD7A 1GAQB 3MC9A 2BWEA 2HAKA 1WGNA 2D3GA 1SXJB 5C3JB 2BWBA 1R7RA 1IN6A 3U61B 1CV8A 2WYQA 1TDHA 1LXDA 1GJSA 3CF6E 1EF5A 3Q8CA 3GLGE 4MEMA 3F75A 3AOEA 4W9JA 1Q5WB 4IWPA 2R46A 4D2KA 1IXSA 2KLGA 1HT2E 3AEDB 2AS8A 3QARA 2FE8A 4DR7M 3GE8C 3UZUA 2YJ8A 2WXHA 1ZMUA 4XYCA 1GB1A 4AWJA 4D81A 4CDFB 3PZ7A 3IV2A 3GZNB 3SATA 4PADA 3L4PA 5EDSA 1C76A 3ZH9B 1L0VB 2PE6B 2PTLA 1M4VA 3TBLD 3ZJVA 5EE3A 1HZ5A 2JYEA 4GXBA 4B7FA 2DLBA 1HQCA 2BB6A 4G0NB 1C78A 2LVQD 2LVOC 2OOBB 3S3RA 4P7IA 4M9ZA 4GMVA 2BVCA 2N1VA 4IBIA 1EWCA 2C7MB 1XCTL 2KWCA 3GCBA 4EFOA 1SJED 4D82A 4BOSC 4PP1A 2LHDA 2INPE 2L7IA 3DOAA 3DBSA 4WH4A 3BINA 5BMGA 1P0RA 1ROEA 2KWUB 1QAQA 2LEKA 2WSCF 1WJ4A 2MR9A 3N30A 2PKOA 1MX0A 2XSZD 3L08A 1K51A 1EF7A 4AUQC 4XUIA 2JXNA 3KDSE 2VRRB 4A3OA 2X38A 2ZCCA 5KO3A 4K0KM 4IC7B 1IY0A 3V6CA 1SGHA 1JRPA 2RPVA 2X49A 5L8RF 3DHHC 4FJCA 3W1YA 5H92C 3UQBA 3AV0A 1ZIVA 1YOVB 3T8MA 2HTHA 4JE3B 4IWOA 2WLBA 1DGFA 3A1QA 4WIPA 3HZJA 3SASA 3PRZA 2GHUA 1AWDA 5FSWA 2LRUA 2B3TA 2KTFA 1PGBA 3Q14C 2MQJA 2YR0A 1NY5A 4EZJA 1U9XA 3VDPA 1T3QA 1R4GA 3SU8X 4LJ4A 2KEBA 1NYQA 3HJQA 3IMAA 3K8UA 2IO2B 3OVZA 3DDCB 2VIIA 1UNSA 3LCVB 1QILA 4AG5A 2ZW1A 3B2GA 1CMXB 4II7A 4YYSA 3CF2A 1KXRA 1PFDA 2QEJC 3QJ3A 4GOCA 1NV9A 3CSFA 2JY8A 4LY6A 5AUIA 4ANWA 2DZNB 3QC8B 3AN1A 3Q2AC 4FHKA 1POPA 2FCNA 2KZSA 2F5NA 2EMTA 1K82A 1EFUB 4MI7A 2Z8LA 4XC2A 3B9PA 1ZE3D 4GN1A 1D0LA 1ZMWA 3TWLA 3ZNHB 4H2AA 5CTRC 1TGZB 2K0BX 4AJYB 3SEBA 4IBDA 4HROA 2AUZA 4YTMB 2MBBB 2VHSA 2KHWB 2OO9A 4JI5M 2Z84A 1HTQA 3SD5A 1J5EM 4NJCA 4XZ4A 3S2AA 2HHHM 3L10B 1MG4A 2XU1A 3EUB2 4BKSA 4CHTB 1H8CA 4KDLB 2AIMA 2DKLA 3SHQA 3U30A 4XR7A 3SDLC 2GBJA 4BOSA 2NPTB 5KQDA 1YJ1A 3I01M 3QIJA 4ITQA 1NHWC 1R4MI 1EO6A 3V76A 1L0XB 3ECIA 3MHSD 3CH3X 5EGWA 2RD0A 4DXAB 2BU3A 1GNUA 4JWUC 2CU3A 4QNRA 3VDZA 4CO7A 3CWIA 2UXDM 1CB5A 2EA0A 2XU4A 3DOWA 2MROB 3PLUA 2C7NB 1IN8A 3SARA 5EZQA 4F2LA 2KVRA 4NJ6A 4K7WA 3H7SA 3A42A 4ZOHC 1YLAA 4AQYM 3BYYB 1N77A 1TKGA 4OELA 2AQ3B 1E7UA 2N9EB 3H4MA 3AB5A 1IY2A 1R7SA 4DBGB 2HJ1A 3R7QA 4ANUA 5I4DA 1R2ZA 2L76A 4LJAA 2C60A 2LXCA 3VHTC 1NB3A 3SAUA 3W30A 3GB1A 2GI9A 4WJPA 4DMXA 2YLMA 4ARIA 4AKIA 2BF8B 5L83A 4KDIC 4RFBA 1PCIA 1F0ZA 1Q6KA 2WXIA 1EUVB 3PDFA 1VDLA 5G2NA 2R9FA 1HNWM 4X6IA 3A98B 3A45A 4MGIE 1TH2A 1N34M 3HWNA 5EJCA 4AG6A 4IBJA 3AEAB 1WGYA 5GKNA 3K1JA 5FR3A 1M6DA 4M0WA 3PV1A 4PCZA 3MC0B 3IUTA 2C98A 3MTNA 2XK5B 5FTKA 3TEZA 4ZHOA 3VLFB 1K3XA 2Z4RA 4W9KA 4AP4C 1E8XA 3HJSA 3O65B 3HJ8A 4DV3M 1AW7A 4CHKA 2JT4B 1EM7A 1Q3BA 3TUOA 4I4LA 2DZJA 4HXDB 1ZPSA 3MP9A 3DA1A 4ZHPA 2EKFA 3M63B 3IHPC 3AFHA 3ZXVA 2BTEA 4QRVA 5EP3A 4BPVA 2V1UA 4OW0A 2IYDB 1SXJD 1MDWA 1MHWA 2GNOA 3U52E 2MEKA 2KXJA 3CIRB 2V0GA 2UU7A 2YJBA 5D94A 1K53A 4B3MM 1NQCA 2LBCA 2L83A 3SFZA 4GHLA 5DYGA 5L95C 2HHNA 4N9F4 4DHZB 2P0RA 2GFOA 1K8RB 2KW0A 1OKSA 2KA6B 1ZUD2 4I07A 3TIXA 5JA7A 3H7PA 1WE6A 2B1NA 1L8QA 4DV0M 2YJ9A 3ZGZA 2MJ3A 1F2AA 4B0MA 1FXTB 2Z3XA 1C79A 3RGSA 1DGHB 4RGOS 1KTKA 1E9SA 3BCNA 4GUAA 1V80A 1T43A 3ML8A 1JQ4A 3KSEA 1EE8A 1QYRA 3DFZA 1JWMD 3RFWA 3B7QA 3M99A 5MPOA 3LVVA 4I6NB 2O6VB 5G5GA 2XFTA 4CIZA 3KSJA 5FTLA 3ILKA 1FNNA 4JI8M 4NAWA 1PADA 2DC8A 2K1FA 3QWZB 1BY8A 2VF8A 5LXHA 1V81A 1QF6A 1UFZA 3C8YA 4KO8A 1UELA 1YQ3B 1Y4HA 2AHMA 3K9PB 1AU2A 3O1GA 4BOZA 5ITXA 3AKZA 4LF7M 2NQDB 3ENEA 4ACFA 2YNMD 4JN6A 1I4QA 4KZCA 2O5RA 2Y20A 3SR6A 1I35A 1TY0A 1Q10A 2NQ8C 2OULA 4EIWA 3AEBB 1VCBA 3U61A 3RZWC 2PBHA 1PE6A 2XLJA 2QCUA 3VDUA 2SEBD 1WXAA 3N32A 1UBIA 1H4RA 2ONQA 2BYFA 3SFDB 2N7JA 3HGIA 3GLHA 2G9HD 3VFKA 3WXFA 3VTVA 1FEHA 2DZOB 3KOYE 4DR5M 1IM2A 3Q8XA 2DWMA 3IHPA 3GPXA 1TU6A 2UXBM 4C56C 2R2QA 3NY5A 1E8WA 1FNUA 5HFYA 3FUWA 1SE4A 3E1ZB 3V60A 2NTSA 1GLOA 4W5BA 3GLIA 3PRMA 2G45B 2OQ4A 1D5MC 3BIID 3KWBX 3U6QA 1KSFX 3L29A 1XEEA 3D32A 1IXSB 3BVGA 2L32A 3PO0A 2KJ6A 1L4DB 1K50A 3ZNID 2KMMA 2DWQA 1WX7A 2WXNA 4IG7B 4ZYSA 1NEKB 5LMNM 4OX9M 1EWPA 4IUMA 4LF6M 3DWGC 2KACA 1SP4B 4GSWA 2NBUA 3GE3C 3U7ZA 1TF0B 4IDIA 4FIPA 1F4IA 3W1SC 1WR6E 3PHXA 1N36M 2YEPB 2AGAA 3EC8A 3PNVA 4I5SA 4DHJD 1FCLA 1U4AA 1GUAB 2WDQB 2QC8A 3AEGB 2YQZA 2F5PA 4PI3A 2CEAA 2FIDA 4YL8A 5IAAC 4XDDA 1I94M 1S3SG 3J2PB 3HM3A 3L0WB 4N79A 2CJNA 3FKYA 3HVZA 3I51A 3AE2B 3OJ3A 4JI6M 2KJHB 4B7GA 3L16A 2V3SA 3LW5F 4E71A 2KNVA 4W4UA 3KH0A 3V6CB 1PPNA 4QRXA 4PYUA 1VJKA 4AS1A 3KP1E 4A6QA 3GRVA 2G4DB 5T8IA 4E3CA 1OIZA 2JQGR 2D07B 2W3RA 1BVSA 1GO5A 1OEYA 2R9NA 5E26A 3A1QB 3F5VA 1IPGA 2UUBM 4F1SA 3W2DA 4LCBA 2RGOA 4IW0A 4PP2E 1ISNA 3ZDMC 2JYTA 2ASQA 1MJDA 3M62B 2KO3A 1E6EB 1UH6A 4QHSA 1V8CA 3DQVA 4FW9A 1J7CA 3GPUA 3V3XA 4II3B 1CSBB 2WXPA 4FN2A 3PZ8A 4I6PA 2BWES 2YVCA 4AW4A 3T1YM 1D2NA 3ZNHA 4DMYA 3JVZX 2L4FA 3L26A 1WRIA 3IAM1 4HLQA 1HEZE 3N1YC 1WGGA 1S4VA 3EIEA 2BYEA 4TV3A 4IM3A 3AMZA 2WXMA 5IOIA 3SMPA 1YN4A 3K2LA 2QCZA 1TH4A 3FUXA 1HE8A 2LFIA 1KH0A 1TJEA 2ZVOA 3AM9A 4GC5A 3MTVA 5C18A 1WXVA 1JWBD 2K25A 4NZLB 2IGGA 2M19A 2DAKA 4M0DA 3W1SA 1SBBB 1K3WA 1FXIA 4BLCA 4G54A 3LMMA 2O2VA 3IFUA 3UJNA 4A8XC 4NQKE 3Q3NC 4JIOU 1G59A 4EE2A 3H9DA 3PSEA 3FRHA 4GDLB 2L1AA 2CHXA 2QSDA 5ITTA 3RI7C 1JW9D 3ABVB 1RWSA 4DUZM 4IKGA 4W9DA 3ALBA 2ZEQA 2OZ2A 2R45A 3NWLA 1CJLA 1YN3A 1DGBA 2DJGB 3IEJA 5G55A 2UYZB 3HRDD 1NI2A 4BVUC 3KQ4A 1OQRA 2XU5A 3U60A 1L1ZA 2WP9B 3EIHA 3RNVA 3NBIA 3A4RA 4LF4M 2DXIA 2XF3A 4WWOA 1G41A 4KLNA 1Z59A 4YYVA 5BR8M 3HU1A 1JR3E 3JR4A 2A5YB 1NL6A 1B9RA 3PHUA 1CQDA 4DDID 2MH8A 1L4ZB 1NVMA 2HJ8A 2JPHA 2M1MA 3CBKA 3MJWA 5LNK1 3U6MA 3R8FA 2RSUA 3SBJA 4XE0A 2GBMA 3DHGC 2FBWB 2LVNC 3KS4A 2QP9X 1UGJA 4W9LA 3BVMA 4L23A 4JGHB 1SIFA 3TQSA 3AXCA 4QNMA 1ET6A 3OISA 1UKFA 4FCVA 2KDBA 4W9IA 5D3IB 2I38A 3AE9B 2K9DA 2PIAA 2IO1B 1WH3A 4BBNC 4XDCA 1FNWA 3QAUA 4CISA 2BKFA 3PZDA 4M0WB 3MTNB 5FKAC 2ZPYA 1MG8A 3RNAC 1WYGA 1IWDA 4K7SA 3DF0A 1MEGA 3USVA 4JI3M 3WAMA 3MFGA 2DHZA 3TNXA 1G8PA 4N6EB 3R66C 3AOEC 2E3TA 1XQQA 4KX6B 1DGGA 2DAFA 1RAXA 4WJOA 2K5PA 4MB7A 2CHGA 4GEWA 2C9WB 3JW0X 4HLEA 1IN5A 1EF1A 1PPOA 3TMPA 3U8EA 2L7HA 4GDKA 4P6VF 2C5RA 4OU7A 2QBYA 3O13A 4II2B 3J9CA 2DCAA 3GQ4A 4M8MA 1L6UA 1VEJA 2EJSA 4X65M 2XEPA 3NZUA 3OLMD 2CHQA 4I05A 1IBMM 3DCGA 2NBVB 2LTUA 4IBEA 4LJ7A 1V92A 1I4PA 2MJ5B 3NVWA 3WCQA 3H7PB 3C58A 5EE1A 1AYVA 1NPZA 2KANA 1CVZA 1WM3A 2K3UA 2NMQA 3RFZB 3PGEA 5ITYA 3HVDA 3UI3A 2CUZA 1LQBA 1L2NA 2WWZA 4K1RB 2BDLA 4LFCM 3ZTDA 2LJ5A 3H6NA 2RDBC 1HA5A 3TWKA 2FS1A 4F7ZA 5J94A 4WWNA 2YEPF 1WR1A 3ML9A 3RE8A 1ZDXA 2W9NA 1N33M 1FH0A 1FNVA 4RKXA 1WX8A 4JI2M 4NAWB 1J7AA 2LGYA 4DV5M 2KFKB 1YQ4B 3E56A 2KK8A 3M6AA 3UMMA 2KWDA 3DBLB 4DXFA 1VEGA 2UWQA 1R4NI 4ANRA 4BOZB 1A70A 1SF0A 1KFVA 1GKIA 1MPEA 2LWXA 2P5TA 5JZEA 3SFEB 2KNZA 3C9PA 4NPNA 2R65A 4F1IA 5DPWA 3W68A 1DF0A 3H8BA 2L6OA 2M5ZA 2KQ4X 3KXEC 2D7GA 1ZXHA 4CZWA 3FILA 1YALA 2DAIA 4K3CA 3U6DA 3U8ZA 4LF5M 1UWMA 3GLHB 3MORA 4QAYA 3LVWA 3IG5A 2PADA 1W5SA 1WGLA 3KYCD 4JQWC 5BMIA 1L2BA 1HTOA 3T6PA 3WXGA 4NRWA 2PPHA 1E9RA 4HK2A 1A6RA 3CH2X 3E21A 4KGRA 1KRHA 2JSVX 2KN4A 2N9XA 1E90A 2HXZA 1WJNA 3GLIB 1RFAA 3PRMB 2BJWA 1VZ8A 3BWUD 2HD5A 1VR9A 1XC8A 1CQVA 4S17A 1CS8A 2RDHA 1D5ZC 2B1MA 4NSRA 3GP1A 3A9KA 2LH0A 3GP7A 3U7DA 2I7PA 3ZLZA 2XU3A 4YYUA 4WP2A 3W5UB 2QHOA 1D0KA 2G3QA 4US8A 4NQLB 1J19A 4IUMB 2MH7A 3J27B 3HX3A 4MELA 1QAOA 1C7YA 2MBQA 2KAJA 1MS6A 3OF8A 5C2TB 4I8OA 2D7HA 4MZOA 1E5WA 3V62A 1SXTA 1XLQA 4CDCB 3PHXB 3NRZA 1BMLC 5F02A 2JUJA 3B21A 2BYVE 2LGXA 2BDZA 3W31A 2WSEF 2KMCA 3OQCA 1YMHE 3CF0A 3DZDA 1AN8A 2AL6A 3P42A 1XNRM 2A4ZA 5IP4D 1MU5A 1HNXM 1Z5AA 3ZYYX 2IPPB 2JZPA 2KRUA 2JWUA 4BKSD 2I1JA 2FCMA 4GHAA 2JZ3B 2WXJA 2MP2B 2YFQA 3GQ3A 2W54A 5CVOB 5IO9A 3E9SA 1WXSA 2NVUI 2JU6X 1FRRA 1G4AE 4A9AA 2N9KA 3FYDA 2N9PC 1N63A 2I2YA 2KWVB 3BPFA 2K39A 3M7GA 4LJ6A 5EZSA 1WM2A 4JWSC 3N3GA 5CHWA 1QMYA 4GIVA 3R8BA 4EZLA 2EKKA 5EP1A 4Y28F 2RR9A 3RULA 1DEUA 3W67A 1ENFA 4FADA 3VFDA 3R9XB 5C1ZA 1PJQA 3GRYA 1R5LA 4LDTD 4GC9A 1LTMA 3QHTA 1L7YA 2KNAA 2DAJA 1YVBA 2AQ1B 2QZ4A 2WDRB 2E01A 2FUG1 1PRBA 3FAHA 3PLVA 4G4QA 1PM5A 3ZNGC 3HU3A 4C7YA 3KW5B 1WIAA 3P4SB 1P3QQ 4J6IA 5DPTA 3PNYA 2NBWB 3AH7A 4ITKA 1XKGA 1OGWA 4AKGA 1D0MA 3QA8A 1SXJE 2ICIA 2IPKD 5D3DA 2MCNB 4AI6A 3WA0A 1AYUA 2VQFM 2GLSA 3ZRCA 2PMVA 4TKNA 4R71A 4WQOB 3LFYA 4LGMA 2EKEC 1C9FA 4GDLA 3RCZA 4AXMA 1SE9A 1NENB 3VVWB 1WF9A 5CX3A 1BQIA 4XWWA 1CK1A 4GU2A 3VR9B 4LGYA 2OHFA 1J0GA 2O2VB 4IM0A 2FRQA 3NZSA 2NTTA 3MHVC 4QHTA 2L05A 3PSEB 1R4NB 1O0EA 4KODA 4YSYB 1T5XD 2MBHA 2VH2A 1IBLM 2ZAOA 2BQQA 1PJSA 2CE7A 4FD2A 1IY1A 3ZKJC 3HHIA 2N7DA 2WHIA 5BMHA 4DV7M 1Y56A 2I1KA 1F2CA 4N58A 4HKQA 3F92A 4YHHM 3BK1A 3VUWA 2LJIA 2DCBA 5G5HA 4MSMB 3TWMA 1ZXIA 1NLJA 2CHWA 3RGPA 2KMAA 1D4BA 3U60B 1Z6TA 2H88B 2ZCBA 2V3NA 4HDOA 1AECA 3AL0C 3ZUNA 2VZKD 1QZMA 3WALA 3AE4B 2JUOA 2R62A 3I4VA 3FUVA 2VH1A
chains in the Genus database with same CATH topology
1IBKM 4WAFA 1XCQL 1IN7A 4ZTBA 3SHFA 3AE7B 2ZAMA 2L09A 4PD2A 3GLGA 2JX5A 1GPXA 4RCOA 4DR4M 4WURA 2XZUA 3BYTB 2K9XA 3P63A 2CJOA 3GRRA 3L28A 4B7HA 3LQQA 2XZFA 2DWNA 3HHWA 1YSYA 2EKIA 4OHJA 4LF9M 4LK0M 2J4XA 2V4IB 4FCWA 4GDKB 2WXOA 1ZAEA 4B3TM 3FD9A 2QBYB 4LJ8A 1UUPA 4LFBM 4HRSA 1HNZM 2DYMA 3VRBB 1Q39A 2VQEM 5H8YE 5FTJA 2OEDA 4MACA 3UGJA 4KKJA 2WXGA 1F2RI 2SAKA 1XNQM 3KSXA 4DR6M 4GIPA 3IAS1 1L1TA 1IN4A 2FFJA 4MH8A 4RF1A 4LF8M 3KLSX 4IJFA 2DYOA 1NNJA 4BOQA 4PDIA 3U6PA 1TGUA 5E6JA 1IGCA 1SJHD 1QVRA 4CGYB 5DYIA 4QOSA 3I9V1 2RKOA 3VKHA 1LV7A 4BBAA 4R3DA 3W0FA 4UDUC 4YSZB 3VK7A 1XLOA 2CHVA 4XWTA 2PVOD 3FUTA 1N5WA 5HHDG 4B0EA 2F5QA 4LFAM 3D8BA 3FILB 3AEEB 1QOFA 1AYFA 3Q8FA 1XO3A 2V3PA 4RGNA 1WXQA 4LLGM 2LMCA 2AQ2B 1NNUC 1DKIA 3FTDA 1E94E 2Q2EB 3BZDB 3ZJTA 4NSOB 3Q8BA 2BJVA 4JXJA 4GLSC 1BXTA 4BOPA 1OJLA 2PLPA 4OZAA 3IXSA 3T15A 4ARCA 3NUHB 1FFVA 2UU9M 3PVSA 1TKEA 1VZ6A 4MGZE 3RPFC 2R4EA 2B76B 1MHHE 2N0SB 4BOUA 4NL4H 4X64M 3GQ5A 1QOGA 4DV6M 1G3IA 4KGTA 1ORYB 4ZRQA 2E6XA 3PRPA 1Z5BA 1YJJA 1HZ6A 1I4XA 1JWUD 2RGHA 3J80S 3EGRA 4FVMA 4MGKE 2W82A 4YWGG 1I7HA 3V05A 1YZBA 5FK9C 5ITRA 2CV1A 3TL4X 1RM6C 1X37A 1NI3A 3SMSA 5F3WA 1HXYD 5KQ8A 5GXGB 4D8IA 4RNAA 1N75A 4OZCA 2J7QA 1SB3C 1D5XC 1FD6A 5EP2A 2UXCM 1L2DA 3U4EG 4DXGA 1XF5L 4YSXB 2G5GX 2WXRA 3U2SC 4X66M 3GRUA 4IBBA 2BYTA 3HHYA 1K52A 3GS2A 4NAMA 2FOIC 2C99A 5ITQA 4JYAM 4QOZC 4JI4M 1YN5A 4JX1C 4DV4M 4DR1M 1OQQA 1NY6A 4NOOB 3KOWE 2KRKA 4X62M 1N62A 4XZXA 4TQ1A 1FM0D 1JCKB 1HQYE 4XGIA 3T1HM 3U6EA 2D5GA 1YUBA 4AKHA 3IG8A 3TPZA 2M56B 2JTCA 4MGYE 3UK6A 2G8LA 4A90A 4D8EA 3BK2A 2DWZB 8CATA 4HL4A 1TS2A 1PYWD 3GLGB 4N59A 3MJ5A 4G4RA 5HI1A 4GRIA 4WWMA 3BOSA 5FLXS 4Z6YA 1SEBD 3FTCA 2Y21A 5IWAM 1HQRD 1SE2A 3T38A 4M9XA 4DR3M 2WS3B 1QAMA 3NVZA 3J81S 4L16A 4L2YA 1QLBB 2LNHC 1L0YB 1TS4A 5H37D 3MP2A 2V1CA 1NSFA 1IQPA 1GL7A 5ITUA 1NHGC 2QILA 2ON8A 1RFKA 3ZCBB 1F77A 5AUKA 2K22A 2QJLA 2RDGA 1STEA 4AZFA 2QIEB 2DWLA 4MT5A 3U6CA 5IT9S 1R2YA 1XHBA 2PVGC 1C77A 5JXVA 2BS4B 4I81A 2XGNA 4S12A 3N9YC 1DOIA 3R2TA 1I4GA 3DWMA 1E10A 3NS1A 4NXMM 3HU2A 4DUYM 2JA2A 1Z5CA 3L2AA 3L27A 3AE3B 5EQTA 4YXDB 1NJGA 3L25A 3SC3A 4MM3B 4DV1M 1TZOA 3KOZE 3FYCA 1IBXB 3PT2A 4OZBA 4B3SM 1F2RC 2J53A 1J09A 2KXEA 3EA6A 1GVNA 4O1NA 3FTFA 1FMAD 5EXTA 1DOYA 1V1PB 1TKYA 1JWAD 1HT1E 5FTMA 3Q8AA 2Y5CA 3KFUG 1J7KA 4LJ5A 1KLGD 1FCCC 4A3VB 3I57A 3R2IA 3MHZA 3NVVA 4IBGA 1MI0A 3SHGB 3D8LA 1UWXA 3AEFB 2WNMA 2BW2A 1JR3A 1N78A 1FO4A 2ERCA 1GOZA 1T3TA 3TEWA 2J7OA 3HWSA 3A46A 2XH9A 4LTUA 4G6ZA 2KDMA 3WHKA 1TYGB 2W3SA 4TMAB 4LZZA 1TS3A 2KZUA 4W5WA 1ZDVA 4NXNM 4MGHA 1FRDA 5JI2E 4GH9A 4IBFA 2D7EA 2QENA 3U6OA 2IDYA 2ZBKB 5D7GA 1JQJC 3T3NA 4J3OD 4JPSA 2PW9A 4LRSA 2LXEA 1ZOYB 4ZRPA 1XLPA 5ITXE 1ZQ9A 3B2FA 4XBOA 5EE9A 2MJEA 4FWGA 2HTME 4Z8XA 3GLFB 2ACZB 5KPZA 2X8AA 3SAWA 1NYRA 3ZQ4A 2BNKA 4FCTA 1XMOM 4CQNA 2XSZA 1V1OA 5FTNA 5BYQA 2DVWB 3KWLA 1I4HA 3PHWA 2WXLA 4OVZB 4HJGE 4M9SA 2F5OA 1SE3A 4IOIE 2LHEA 2HCBA 1W5TA 1KYIA 1WSPA 2DBYA 5BYSA 3BY4A 2XNAC 1ACCA 3PFIA 1DYQA 2UUAM 2Y5PA 4DV2M 3SYKA 3TRKA 1N61A 4A5UA 1TS5A 1PGAA 3KW6A 4BB9A 4LRTA 3AE1B 3JR5A 2K47A 3ZJUA 3KOXE 1E32A 3U5ZA 5EP4A 2WDVB 1GLNA 2UZJA 1VLBA 4RGTA 3CTWB 1VRAB 1PJJA 4YT0B 1SXJC 1ESFA 2R61A 5KPRA 1IUEA 5HG2A 3FTEA 1BUIC 1GL6A 3FUUA 1PVJA 3VRAB 5KPTA 4Q2JA 4YTNB 2BBCA 1XXHB 3VQIA 3GO8A 4L8RC 5EE0A 2JRIA 2I7NA 1QQRA 3WHLA 1QANA 3T3OA 4GMQA 3K8ZA 2Z4SA 1SSNA 3IT4B 4LZJA 2N9LA 4JI0M 1OFHA 2QPAA 1TH3A 1YNTE 4TSSA 2K0PA 1VDVA 4C80A 3AECB 3H8HA 1QT9A 4PT5A 2H89B 2H1RA 1L6VA 3NVYA 4NRVA 1MVKA 4KGSA 3QWLA 1VDDA 4R7GA 5A2QS 1WGKA 1H6UA 4LJ9A 1QKZA 2GB1A 4WQMA 5EXXA 4C7ZA 2IGHA 7CATA 4IP3A 1JALA 1FIQA 2FNAA 3KS8A 4REZA 3NZ3A 1VZ7A 2WXQA 3LYYA 4TQ0A 1XWIA 3C0RA 1D6EC 3W9CB 2BTWA 4L4UA 3W5VB 2CV0A 1S3SA 1EU4A 1ZP0B 4HKZE 1IBXA 1FXAA 3OTOM 1SXJA 2HL7A 5IZ7D 5BPVA 2Z7JA 1CJEA 3URYA 1YE9A 2J7QC 1IXZA 4IBCA 4A55A 1RYJA 1V1PA 4GKKM 1CZPA 3AOGA 2W55A 3AE6B 3MK6A 1SIJA 1IGDA 1TDZA 4IBKA 1GB4A 2IJ0A 3BB7A 2BB5A 4GKJM 1XXGA 4HEA1 3AE5B 1ET9A 2L52A 2G1EA 1EWYC 2CFOA 3FC4A 4YTPB 1N32M 3KP0E 3E4RA 4B3RM 2WQYB 3W0LB 4USAA 2GRIA 1NVID 4G4NA 3KVWA 1XLNA 4LG2A 1DO2A 2EUCA 4JI7M 1R6BX 3BBAA 2EO2A 1C4CA 5DNYA 2C96A 2CV2A 4WW0A 2OPFA 5LMUM 5BYRA 4JI1M 2R18A 5EXSA 2WXKA 1I4WA 3J7AS 1E0ZA 1HR0M 3TE6A 2UUCM 3HHXA 3SAVA 2WU2B 1TY2A 4IIWA 2Y3AA 1PGXA 1N60A 3BVZA 2C9OA 1MHXA 1N5XA 3K92A 2EELA 2M0AA 2J7NA 3GLFA 1J7BA 3P4PB 3J7BA 3HKPA 2HKJA 4FWHA 2TSSA 2ZW0A 3AE8B 1NJFA 2X4AA 2R4JA 2AX5A 2WU5B 3AJIB 1XMQM 2ZM6M 1I4RA 4OVZA 3VR8B 3KWVA 1L2CA 5C1BA 2MJDA 2LUMA 2JQRB 4KHPM 1T6BX 3GPPA 1B1ZA 2LGIA 1Q3CA 3SYLA 1WWTA 3FKEA 3PXGA 5JI3E 3P4QB 3LB8C 5IREB 2XN9C 1QOAA 2J52A 2C9CA 3U6SA 3P1MA 4L15A 3IT6B 4MH0E 3P4RB 4L78A 1FFUA 2F5SA 4ZPXA 3B9JA 4JV5M 3GPYA 2J42A 3VK8A 2M60A 4FXCA 4L1BA 2F4VM 2RMMA 4DQOC 3OWEB 3TSSA 3U5ZB 4KKIA 4RH6A 1FJGM 1LO5D 4DR2M 3AV8A 4RGMA 2IGDA 1L5PA 1KFYB 4US9A 3O65A 4YY3M 1DGJA 2WXFA 4GITA 2XFSA 1XXHA 1QQWA 4IJEA 4PDGA 2Y0TA 4RF0A 3ETRA 4D8BA 2V6ZM 2BS2B 3HUIA 2E5LM 3VKGA 1KLUD 2Q5WD 4D80A 2BT6A 1PJIA 1PUTA 4G4OA 2INNE 3ZC7B 1IXRC 1JROA 3TEXA 1P7EA 1V97A 3I4YA 1DGHA 3U6LA 4TUWA 5TSSA 3TEYA 3HHZA 3Q69A 3LQRA 2DHRA 2HWKA 2VZKB 2QMTA 2Y0QA 1UM8A 3M0EA 1KF6B 1OFIA 1JWSD 1OFFA 2JXTA 3THGA 2HDEA 2DOSA 1DO0A 1EU3A 1DOXA 1JR3D 1C4PA 5EXPA 3Q8EA 1JMLA 4AQ7A 3LXFA 1YJIA 4FWDA 1PDXA 1E7PB 1C4AA 4P16A 1QOBA 2BTWB 3JAMS 1P7FA 1E9MA 2BS3B 2ZANA 4B08A 1C1KA 1GAQB 1SXJB 5C3JB 1R7RA 1IN6A 3U61B 1TDHA 3CF6E 3Q8CA 3AOEA 4D2KA 2R46A 3AEDB 1HT2E 2FE8A 4DR7M 3UZUA 2WXHA 1GB1A 4D81A 3PZ7A 3SATA 3L4PA 1C76A 3ZH9B 1L0VB 2PTLA 1M4VA 3ZJVA 5EE3A 1HZ5A 2JYEA 4B7FA 2DLBA 1HQCA 2BB6A 1C78A 4M9ZA 4IBIA 1EWCA 1XCTL 1SJED 4D82A 2LHDA 2INPE 2L7IA 3DOAA 4WH4A 5BMGA 1ROEA 1QAQA 2LEKA 2PKOA 1MX0A 2XSZD 1K51A 3KDSE 2X38A 5KO3A 4K0KM 1IY0A 1JRPA 2RPVA 2X49A 5H92C 3AV0A 4JE3B 2WLBA 1DGFA 4WIPA 3SASA 1AWDA 5FSWA 1PGBA 2YR0A 1NY5A 3VDPA 1T3QA 4LJ4A 2KEBA 1NYQA 3HJQA 2VIIA 1UNSA 1QILA 4AG5A 2ZW1A 3B2GA 4II7A 3CF2A 1PFDA 2QEJC 4LY6A 5AUIA 2DZNB 3AN1A 2KZSA 2F5NA 1K82A 4MI7A 2Z8LA 3B9PA 1ZE3D 3TWLA 4H2AA 3SEBA 4IBDA 4HROA 4YTMB 4JI5M 2Z84A 1J5EM 4NJCA 2HHHM 3EUB2 4CHTB 4BOSA 5KQDA 4ITQA 1NHWC 1L0XB 2BU3A 4JWUC 2CU3A 4QNRA 3CWIA 2UXDM 2EA0A 1IN8A 3SARA 5EZQA 3A42A 4ZOHC 4AQYM 3BYYB 1N77A 1TKGA 2AQ3B 3H4MA 3AB5A 1IY2A 1R7SA 5I4DA 1R2ZA 4LJAA 3SAUA 3W30A 3GB1A 2GI9A 4ARIA 4AKIA 4RFBA 1F0ZA 2WXIA 1HNWM 3A98B 3A45A 4MGIE 1TH2A 1N34M 5EJCA 4AG6A 4IBJA 3AEAB 5FR3A 5GKNA 3K1JA 4M0WA 4PCZA 3MC0B 2C98A 5FTKA 3TEZA 4ZHOA 3VLFB 1K3XA 2Z4RA 3HJSA 3HJ8A 4DV3M 1AW7A 1EM7A 1Q3BA 3TUOA 4I4LA 4HXDB 1ZPSA 3MP9A 3DA1A 4ZHPA 3AFHA 2BTEA 5EP3A 2V1UA 4OW0A 1SXJD 3U52E 2MEKA 3CIRB 2V0GA 1K53A 4B3MM 2L83A 3SFZA 4GHLA 5DYGA 2KW0A 2KA6B 1ZUD2 1L8QA 4DV0M 3ZGZA 2MJ3A 4B0MA 2Z3XA 1C79A 3RGSA 1DGHB 4RGOS 1KTKA 1E9SA 4GUAA 1JQ4A 1EE8A 1QYRA 3DFZA 1JWMD 3RFWA 5MPOA 3LVVA 5G5GA 2XFTA 3KSJA 5FTLA 3ILKA 1FNNA 4JI8M 1QF6A 3C8YA 4KO8A 1YQ3B 2AHMA 4BOZA 5ITXA 3AKZA 4LF7M 2YNMD 4JN6A 1I4QA 2O5RA 2Y20A 3SR6A 1TY0A 1Q10A 2NQ8C 4EIWA 3AEBB 3U61A 2XLJA 2QCUA 3VDUA 2SEBD 2ONQA 3SFDB 2N7JA 3HGIA 3GLHA 2G9HD 1FEHA 2DZOB 3KOYE 4DR5M 1IM2A 3Q8XA 2DWMA 3GPXA 2UXBM 4C56C 1FNUA 5HFYA 3FUWA 1SE4A 2NTSA 3GLIA 3PRMA 2OQ4A 1D5MC 3BIID 3U6QA 1KSFX 3L29A 1XEEA 1IXSB 3BVGA 2L32A 3PO0A 1L4DB 1K50A 2KMMA 2DWQA 2WXNA 4ZYSA 1NEKB 5LMNM 4OX9M 4IUMA 4LF6M 3DWGC 2KACA 3U7ZA 4IDIA 3PHXA 1N36M 2YEPB 2AGAA 3PNVA 4I5SA 1FCLA 2WDQB 3AEGB 2YQZA 2F5PA 2CEAA 4XDDA 1I94M 3J2PB 2CJNA 3HVZA 3I51A 3AE2B 4JI6M 4B7GA 1VJKA 4AS1A 3KP1E 4A6QA 3GRVA 5T8IA 2W3RA 5E26A 2UUBM 3W2DA 4LCBA 2RGOA 2JYTA 1E6EB 4QHSA 1V8CA 4FW9A 1J7CA 3GPUA 3V3XA 2WXPA 3PZ8A 4AW4A 3T1YM 1D2NA 3ZNHA 3L26A 1WRIA 3IAM1 4HLQA 1HEZE 3EIEA 3AMZA 2WXMA 3SMPA 1YN4A 3K2LA 1TH4A 3FUXA 2LFIA 1KH0A 1TJEA 3AM9A 4GC5A 3MTVA 5C18A 1JWBD 4NZLB 2IGGA 2M19A 4M0DA 3W1SA 1SBBB 1K3WA 1FXIA 4BLCA 3LMMA 3IFUA 3UJNA 4A8XC 1G59A 4EE2A 3PSEA 4GDLB 2L1AA 2QSDA 5ITTA 1JW9D 3ABVB 1RWSA 4DUZM 4IKGA 2R45A 3NWLA 1YN3A 1DGBA 3HRDD 3KQ4A 1OQRA 3U60A 1L1ZA 2WP9B 3EIHA 3RNVA 3NBIA 4LF4M 2DXIA 2XF3A 1G41A 4KLNA 1Z59A 5BR8M 3HU1A 3JR4A 2A5YB 1B9RA 3PHUA 1L4ZB 1NVMA 5LNK1 3U6MA 3R8FA 3SBJA 4XE0A 2FBWB 3KS4A 2QP9X 1UGJA 3BVMA 4L23A 3TQSA 4QNMA 1ET6A 1UKFA 4FCVA 5D3IB 2I38A 3AE9B 2PIAA 4XDCA 1FNWA 3QAUA 4CISA 5FKAC 1WYGA 4JI3M 3MFGA 1G8PA 4N6EB 3AOEC 2E3TA 4KX6B 1DGGA 2K5PA 4MB7A 2CHGA 3TMPA 1IN5A 2L7HA 4P6VF 2C5RA 4OU7A 2QBYA 3O13A 3J9CA 3GQ4A 1L6UA 4X65M 2XEPA 2CHQA 1IBMM 4IBEA 4LJ7A 1I4PA 3NVWA 3WCQA 3C58A 5EE1A 2NMQA 2K3UA 3RFZB 5ITYA 3HVDA 3UI3A 2CUZA 4LFCM 1HA5A 3TWKA 2YEPF 3RE8A 1ZDXA 1N33M 1FNVA 4RKXA 4JI2M 4NAWB 1J7AA 4DV5M 1YQ4B 3E56A 3M6AA 3UMMA 2KWDA 4DXFA 1A70A 1SF0A 1KFVA 1GKIA 1MPEA 2LWXA 2P5TA 5JZEA 3SFEB 2R65A 2L6OA 2M5ZA 2KQ4X 3KXEC 2D7GA 1ZXHA 3FILA 3U6DA 4LF5M 1UWMA 3GLHB 3LVWA 3IG5A 1W5SA 5BMIA 1L2BA 4NRWA 1E9RA 4KGRA 1KRHA 2JSVX 2KN4A 3GLIB 2BJWA 1VZ8A 3BWUD 1VR9A 1XC8A 1CQVA 2RDHA 1D5ZC 4NSRA 3GP1A 2LH0A 3GP7A 2I7PA 3W5UB 4US8A 2MH7A 3J27B 1QAOA 2KAJA 5C2TB 4I8OA 2D7HA 1SXTA 1XLQA 3NRZA 1BMLC 3B21A 3W31A 3OQCA 1YMHE 3CF0A 3DZDA 1AN8A 3P42A 1XNRM 1MU5A 1HNXM 1Z5AA 3ZYYX 2JZPA 2KRUA 2JWUA 4GHAA 2WXJA 2YFQA 3GQ3A 2W54A 3E9SA 2JU6X 1FRRA 1G4AE 4A9AA 2N9KA 3FYDA 1N63A 2I2YA 5EZSA 3M7GA 4LJ6A 4JWSC 3R8BA 5EP1A 1ENFA 3VFDA 3R9XB 3GRYA 4GC9A 2AQ1B 2QZ4A 2WDRB 2FUG1 3FAHA 4G4QA 1PM5A 3HU3A 4C7YA 3P4SB 3PNYA 3AH7A 4ITKA 4AKGA 1SXJE 2ICIA 2IPKD 5D3DA 4AI6A 2VQFM 2PMVA 4LGMA 1C9FA 1NENB 4XWWA 1CK1A 3VR9B 4LGYA 2OHFA 2NTTA 3MHVC 4QHTA 4KODA 4YSYB 1T5XD 1IBLM 2ZAOA 2CE7A 4FD2A 1IY1A 5BMHA 4DV7M 1Y56A 4N58A 4HKQA 4YHHM 3BK1A 2LJIA 5G5HA 3TWMA 1ZXIA 3RGPA 1D4BA 3U60B 1Z6TA 2H88B 2V3NA 3AL0C 2VZKD 1QZMA 3AE4B 2R62A 3I4VA 3FUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PT5 A;  4OVZ A;  4OW0 A;  4M0W A;  4RF0 A;  5E6J A;  3MJ5 A;  3MP2 A;  5KO3 A;  4R3D A;  4RNA A;  4WUR A;  4REZ A;  4MM3 B;  4OVZ B;  4P16 A;  4RF1 A;  2FE8 A;  3E9S A; 
#chains in the Genus database with same CATH topology
 3NJT A;  1G71 A;  1IBK M;  1HJP A;  2J5Y A;  1X9Y A;  3KUZ A;  1AU0 A;  4WAF A;  3KKU A;  1XCQ L;  1IN7 A;  1E8Y A;  1LM8 B;  2E00 A;  4ZTB A;  3SHF A;  3V6E A;  2A5U A;  1UZX B;  3AE7 B;  2ZAM A;  3B89 A;  2L09 A;  4PD2 A;  1EWL A;  3GLG A;  3EEC A;  2JX5 A;  1GPX A;  4RCO A;  4DR4 M;  1VJV A;  5PAD A;  4WUR A;  2AWT A;  2ZZP B;  4HCP B;  4PK1 A;  1PBH A;  2XZU A;  3BYT B;  4HEO A;  2NQI A;  2K9X A;  3P63 A;  2CJO A;  3GRR A;  3L28 A;  2V1Y A;  7PCK A;  2YJ2 A;  4B7H A;  2G8E A;  4EZK A;  3LQQ A;  2XZF A;  2DWN A;  3DBH I;  3HHW A;  1YSY A;  1UGM A;  4HCN B;  3RVW A;  2IBI A;  1MFW A;  1EIJ A;  3Q3J A;  3PPA A;  4BKT A;  2EKI A;  1QUT A;  1VG5 A;  3GLF E;  4LF9 M;  4LK0 M;  2J4X A;  4OHJ A;  2V4I B;  3P2B A;  3TMP B;  4FCW A;  3TL5 A;  3MHS A;  1RLF A;  2WXO A;  4GDK B;  1ZAE A;  2CHZ A;  4B3T M;  3FD9 A;  4NC6 A;  2QBY B;  4LJ8 A;  2MLB A;  1UUP A;  4LFB M;  2LHC A;  4HRS A;  4ICU A;  3DVN U;  1HNZ M;  1QZE A;  2DYM A;  3VRB B;  1V34 A;  4LJP B;  3RD2 A;  1Q39 A;  2VQE M;  3WAN A;  4YV8 A;  2LZ6 A;  5H8Y E;  5FTJ A;  2OED A;  5DPS A;  4K7C A;  4FA6 A;  4MAC A;  3UGJ A;  4KKJ A;  2WXG A;  1NDD A;  1F2R I;  1P1A A;  2SAK A;  1XNQ M;  3IG3 A;  3KSX A;  4DR6 M;  4TUU A;  1PPP A;  4GIP A;  3IAS 1;  1L1T A;  1A5R A;  2FO5 A;  4EUT A;  1IN4 A;  2FFJ A;  4MH8 A;  4XX5 A;  4RF1 A;  4LF8 M;  1V2Y A;  3KLS X;  4IJF A;  2DYO A;  4B95 A;  1NNJ A;  1PXV A;  4BOQ A;  3RVX A;  4PDI A;  2KFK A;  3PBH A;  1YK8 A;  3U6P A;  2R9M A;  4M8N A;  1F29 A;  1TGU A;  1WR1 B;  2DHY A;  2DZM A;  2K8B A;  3ZDT A;  5E6J A;  1IGC A;  1SJH D;  1EWO A;  1QVR A;  4CGY B;  5DYI A;  4QOS A;  3I9V 1;  4WJQ A;  2RKO A;  2VHF A;  2GBN A;  3VKH A;  1LV7 A;  4BBA A;  2G6D A;  4R3D A;  3W0F A;  1ME3 A;  4UDU C;  4LJO B;  3ZQJ A;  4YSZ B;  3VK7 A;  2OJW A;  4E74 A;  2LWP A;  1R4M B;  9PAP A;  1YIW A;  1XLO A;  4GB9 A;  4MDK E;  2CHV A;  3AI5 A;  4MM3 A;  1V5T A;  5JZE B;  4XWT A;  2PVO D;  3FUT A;  1N5W A;  2M4N A;  1PJT A;  5HHD G;  4B0E A;  5J18 A;  1KFU L;  1V9J A;  3PRE A;  2F5Q A;  4LFA M;  4FJV B;  3D8B A;  2G4S A;  3FIL B;  2MBO A;  3RNE C;  3AEE B;  1KM7 A;  3BOW A;  1QOF A;  3HM6 X;  1AYF A;  3Q8F A;  3BWK A;  1XO3 A;  2FIF A;  1S1Q B;  2V3P A;  4AOF A;  3B79 A;  4UN2 B;  5GMV A;  4RGN A;  2FT2 A;  1WXQ A;  4LLG M;  2LMC A;  2PEA A;  2AQ2 B;  1NNU C;  1DKI A;  1TTE A;  5LXI B;  3FTD A;  1E94 E;  2HD5 B;  2JVC A;  4OVU A;  2Q2E B;  2PJH A;  3BZD B;  3A9K B;  4NJ7 A;  3ZJT A;  1XXH E;  1BP4 A;  4NSO B;  3Q8B A;  2BJV A;  4JXJ A;  2QHO B;  4GLS C;  2G3Q B;  1BXT A;  4BOP A;  1OJL A;  2KD0 A;  3RYT A;  2PLP A;  4KT0 F;  2DAG A;  4OZA A;  3IXS A;  3T15 A;  4ARC A;  3NUH B;  3QYE A;  1FFV A;  2UU9 M;  4C4V A;  3PVS A;  2MW5 A;  3B0A A;  1TKE A;  4WAA A;  4AJW A;  1VZ6 A;  4MGZ E;  3RPF C;  1KHP A;  2R4E A;  3CGW A;  2B76 B;  1MHH E;  2Z0D B;  3QK0 A;  2E03 A;  4AXL A;  1WZ3 A;  1GEC E;  3MHH A;  2N0S B;  2MP2 A;  3LXS A;  3QX1 A;  3Q3F A;  4BOU A;  2KT7 A;  4NL4 H;  4X64 M;  2FNJ B;  3RT3 B;  3NHE B;  3GQ5 A;  1QOG A;  4DV6 M;  1G3I A;  4RMA A;  1STF E;  4KGT A;  2WBF X;  2JWZ A;  4JLC A;  1ORY B;  4ZRQ A;  2E6X A;  3OVX A;  2FRA A;  3PRP A;  4BKG A;  5D6J B;  1Z5B A;  1YJJ A;  3N3K B;  4LNI A;  2CRU A;  1HZ6 A;  1I4X A;  1JWU D;  2RGH A;  3J80 S;  2KOX A;  3EGR A;  2LVA A;  4FVM A;  4MGK E;  3ZNZ B;  1NV8 A;  2W82 A;  4M02 A;  4YWG G;  1QDR A;  1I7H A;  3V05 A;  1YZB A;  5AZH A;  5FK9 C;  5ITR A;  2CV1 A;  5HKH A;  2H7J A;  1PIP A;  1I42 A;  3TL4 X;  4Q8H A;  1HUC B;  3A9J A;  5IA7 A;  1RM6 C;  3B1L X;  1X37 A;  1WI0 A;  1NI3 A;  5AEK B;  1WMH B;  3SMS A;  5F3W A;  3K9M A;  1HXY D;  2Z0E B;  4FJZ A;  5KQ8 A;  5GXG B;  4D8I A;  4RNA A;  4I04 A;  2G8J A;  3WXE A;  1N75 A;  4OZC A;  2J7Q A;  3O0U A;  4YYQ A;  1SB3 C;  4MJS A;  1TTN A;  1D5X C;  3DVN V;  4HDQ A;  4OVV A;  4IWQ A;  1ZW7 A;  4QRG A;  5J2R A;  1FD6 A;  5EP2 A;  5DFL A;  2UXC M;  1GC6 A;  1AYW A;  1L2D A;  1TZ1 A;  3U4E G;  4DXG A;  2QSF X;  3I3T A;  1XF5 L;  4YSX B;  1GAB A;  2G5G X;  2WXR A;  3U2S C;  2AUX A;  2AYN A;  2Z59 B;  1RRB A;  4X66 M;  4W9F A;  1WY8 A;  3GRU A;  4IBB A;  2BYT A;  3KWZ A;  3R7R A;  5CHV A;  2WSF F;  3HHY A;  1K52 A;  1AAR A;  3GS2 A;  2R0I A;  4NAM A;  4G50 A;  2FOI C;  2C99 A;  4M00 A;  1T6O A;  5ITQ A;  4JYA M;  2IO3 B;  5AZF A;  4QOZ C;  2KX0 A;  4JI4 M;  2YJC A;  1YN5 A;  4JX1 C;  4DV4 M;  1V86 A;  2IY1 B;  3H8C A;  1WGD A;  4DR1 M;  3AUL A;  1OQQ A;  3A33 B;  1NY6 A;  2CB5 A;  2ATO A;  1PPD A;  4NOO B;  3KOW E;  2KRK A;  1RU3 A;  2DEN A;  3H89 A;  4X62 M;  1N62 A;  4XZX A;  2JNH A;  4TQ1 A;  1FM0 D;  2N4F A;  1MIR A;  1JCK B;  2D3C A;  1HQY E;  1IYF A;  2RPQ A;  4CJ6 A;  4XGI A;  2JQF R;  3ONS A;  1JB0 F;  3BY4 B;  3T1H M;  3U6E A;  2D5G A;  4KIK B;  4ZYN A;  2EMS A;  1YUB A;  1KJT A;  4AKH A;  1OEY J;  3IG8 A;  2D10 A;  2K8C A;  2HE7 A;  3TPZ A;  2M56 B;  3KYD D;  2O6V D;  5IN7 A;  2C0Y A;  3KW9 A;  2JTC A;  1Y8G A;  1P3Q U;  4LNK A;  3ZUA A;  4MGY E;  3UK6 A;  1GC7 A;  2G8L A;  4A90 A;  4D8E A;  4W9G A;  3APC A;  3BK2 A;  3V6E B;  2DWZ B;  8CAT A;  4HL4 A;  2WDT B;  1TS2 A;  3VTU A;  1C1Y B;  1PYW D;  3GLG B;  4N59 A;  3MJ5 A;  1CPJ A;  2D3A A;  4KZ0 A;  4LNF A;  4G4R A;  5HI1 A;  4GRI A;  4WWM A;  3BOS A;  2R9C A;  2D2Q A;  5FLX S;  1TIF A;  4Z6Y A;  1SEB D;  3HY5 A;  3ZXR A;  3FTC A;  2Y21 A;  3P5W A;  5IWA M;  3KX1 A;  1HQR D;  1SE2 A;  5JH3 A;  3T38 A;  4BBN F;  4M9X A;  4DR3 M;  2WS3 B;  2IBI B;  5CHT A;  2XBB C;  2O25 A;  1QAM A;  3NVZ A;  3J81 S;  4L16 A;  3JSV B;  4L2Y A;  1QLB B;  2LNH C;  2DZI A;  3RVV A;  4WA6 A;  1L0Y B;  4F8C B;  3N4C A;  4KLB A;  2IY0 B;  1TS4 A;  5H37 D;  3MP2 A;  1WJ6 A;  2V1C A;  2MRP A;  2ZVN A;  1NSF A;  2KJR A;  3B08 A;  3DBR I;  5DPR A;  2IO0 B;  4S0R A;  2JZZ A;  1IQP A;  1G6J A;  1GL7 A;  2DNA A;  5ITU A;  4QH6 A;  4W9C A;  4ASW C;  1NHG C;  2QIL A;  1JQP A;  2ON8 A;  1RFK A;  3ZCB B;  1F77 A;  1V33 A;  5AUK A;  2K22 A;  2QJL A;  3PTF C;  2Z8Y M;  2RDG A;  1STE A;  1CTE A;  1ATK A;  1BGO A;  4HPL B;  4AZF A;  4BSQ A;  3RMK C;  4HPP A;  4HWI B;  3BXW A;  2QIE B;  2P7U A;  2D3B A;  2DWL A;  2K8H A;  4FK5 A;  4HPM B;  2INC C;  4MT5 A;  2CIO A;  1ME4 A;  3NBX X;  3U6C A;  5IT9 S;  1R2Y A;  1XHB A;  2PVG C;  1C77 A;  2GBK A;  4LNN A;  5JXV A;  2DX5 B;  2BS4 B;  4I6L B;  3GOE A;  4I81 A;  2XGN A;  4S12 A;  2ZNV C;  3N9Y C;  4ANV A;  1YT7 A;  1BT0 A;  1DOI A;  4HWY A;  2GBR A;  1UF0 A;  2C5L C;  3APD A;  2DC9 A;  3R2T A;  1I4G A;  3DWM A;  3HK0 A;  4ANX A;  4ZDV A;  1E10 A;  3NS1 A;  4NXM M;  3OAW A;  4XGA B;  3HU2 A;  4DUY M;  2GQF A;  5JH5 C;  2JA2 A;  1Z5C A;  3M3J A;  3L2A A;  3L27 A;  3AE3 B;  2LXA A;  1QXP A;  3R3M A;  4DDG D;  4P6E A;  5EQT A;  2L7R A;  4YXD B;  1QOL A;  2AYO A;  1ZGU B;  3C0R B;  1NJG A;  3L25 A;  1F52 A;  3SC3 A;  4MM3 B;  4DV1 M;  4KVG B;  3HHA A;  1TZO A;  1C3T A;  1SG9 A;  3KOZ E;  4EOY A;  3FYC A;  2FTD A;  1IBX B;  3X23 A;  3PT2 A;  4OZB A;  4B3S M;  1F2R C;  2H5X A;  2J53 A;  3AU5 A;  1J09 A;  3QQ8 B;  2MGW A;  2KXE A;  3EA6 A;  3D6S A;  1GVN A;  3RNF C;  3RNG C;  2KQS A;  4O1N A;  3FTF A;  1WIV A;  1IP9 A;  1P9D U;  3MMP A;  1FMA D;  3ZW3 A;  3I06 A;  5EXT A;  1DOY A;  4MZS A;  1V1P B;  4PS3 A;  1TKY A;  2KX3 A;  1JWA D;  1HT1 E;  5FTM A;  3Q8A A;  2J0M A;  2Y5C A;  2LAS A;  3KFU G;  1J7K A;  4LJ5 A;  1KLG D;  2B3A A;  3N1Z C;  4LCD E;  1EWM A;  4YYR A;  1FCC C;  4A3V B;  4BZA A;  2CP8 A;  3NOB A;  3I57 A;  2AU1 A;  2GMI C;  3R2I A;  1SNK A;  2JY6 A;  1GMY A;  2JP7 A;  3MHZ A;  2JZ1 A;  3KVF B;  4FUL A;  3C9E A;  3NVV A;  4IBG A;  1MI0 A;  4C4V B;  3SHG B;  3D8L A;  3NHE A;  3H1U A;  2NS5 A;  3VAW A;  1UWX A;  3AEF B;  5JHA A;  2WNM A;  2BW2 A;  1JR3 A;  1N78 A;  3CST A;  4ZRJ A;  1TLO A;  2P86 A;  1DV0 A;  1F9J A;  1FO4 A;  2ERC A;  3AU4 A;  1MJG M;  1GOZ A;  1T3T A;  4A20 A;  3TEW A;  2J7O A;  3HIZ A;  3N3K A;  4YVA A;  1GG3 A;  3HWS A;  3A46 A;  2XH9 A;  3K9O B;  4LTU A;  2NR2 A;  3LJ3 A;  2K6B A;  2KC2 A;  5K16 A;  2BPS A;  4G6Z A;  2KDM A;  3WHK A;  2KTR A;  1TYG B;  2W3S A;  2L8J A;  3PRP B;  3IVF A;  2JWS A;  4FBJ B;  1PQS A;  4TMA B;  4LZZ A;  3KUD B;  1TS3 A;  2KZU A;  4W5W A;  1ZDV A;  5KHO A;  4NXN M;  4MGH A;  1FRD A;  2VF7 A;  5JI2 E;  4GH9 A;  4IBF A;  2D7E A;  4RM9 A;  4G11 A;  2QEN A;  3U6O A;  1GJT A;  3M95 A;  1WMH A;  2AL3 A;  3RN9 C;  2FUH B;  2IDY A;  4BAX A;  1TBE A;  1QDQ A;  2DZZ A;  2ZBK B;  2R2O A;  5D7G A;  1WZ0 A;  1JQJ C;  2Y5B B;  3T3N A;  3A9J B;  4J3O D;  4JPS A;  2PW9 A;  3DBR B;  4LRS A;  5TR5 A;  2LXE A;  2WX0 A;  2WX1 A;  3VTW A;  1OTR A;  1M94 A;  1ZOY B;  4ZRP A;  2JF5 A;  1V6E A;  1XLP A;  5ITX E;  2PNS A;  1XT9 B;  1ZQ9 A;  3B2F A;  4XBO A;  1GCB A;  5EE9 A;  2J7Q B;  1YX6 B;  2MJE A;  4MJS B;  2R6F A;  3Q6B A;  2L0T A;  2MA9 B;  4FWG A;  2HTM E;  4Z8X A;  3B7N A;  1Q1O A;  2ACT A;  2LVQ A;  3GLF B;  3GLH E;  2ACZ B;  5AZG A;  3AI8 A;  5KPZ A;  3N1X C;  1U9V A;  1YQB A;  2X8A A;  2RRU A;  3RNB C;  3SAW A;  2LD9 A;  3I3T B;  1NYR A;  2MX2 A;  3ZQ4 A;  2BNK A;  4BS5 A;  4FCT A;  4DHJ B;  1XMO M;  2G7Y A;  2LUE A;  3LDZ E;  4ZUX U;  2KZR A;  3GLI E;  4CQN A;  2XSZ A;  1V1O A;  5FTN A;  5BYQ A;  1LFD A;  1WJU A;  2DVW B;  1WX9 A;  1KOT A;  2DCD A;  4RY2 A;  1V5O A;  1U5I A;  2DAE A;  3KWL A;  1I4H A;  2D11 A;  3PHW A;  2WXL A;  4OVZ B;  3L13 A;  3X0W A;  2LVO A;  2DZY A;  2KN5 A;  1QDT A;  4HJG E;  4M9S A;  1U9W A;  3C19 A;  4PYZ A;  1Z2M A;  2F5O A;  1SE3 A;  4XK8 F;  4IOI E;  2LHE A;  1AU4 A;  4FLH A;  3UIN B;  3APF A;  2HCB A;  2GOW A;  1W5T A;  2CS4 A;  1KYI A;  4W9H A;  3I04 M;  2R44 A;  1WSP A;  2DBY A;  5BYS A;  3BY4 A;  4DWF A;  2XNA C;  3BPM A;  2DEN B;  4KIK A;  1ACC A;  3PFI A;  2APL A;  4FHJ A;  1DYQ A;  2UUA M;  3UIO B;  2L4E A;  2DZK A;  3MC8 A;  2LHG A;  2OP3 A;  4CDD B;  4Q7J A;  1D3Z A;  2Y5P A;  4DV2 M;  3SYK A;  2MBE A;  2BGF A;  3TRK A;  1N61 A;  4A5U A;  1AUA A;  1Y08 A;  1XD3 B;  1TS5 A;  1PGA A;  3KW6 A;  4BB9 A;  4LRT A;  3AE1 B;  3DVG Y;  3NS8 A;  3JR5 A;  4P1C C;  2K47 A;  2DJF B;  3ZJU A;  3KOX E;  1E32 A;  4EKU A;  3U5Z A;  5EP4 A;  2WDV B;  3H4J A;  4ICV A;  1VEK A;  1GLN A;  2UZJ A;  1VLB A;  4RGT A;  3CTW B;  5CVM A;  4IM2 A;  1T0R C;  1WJ7 A;  1VRA B;  2R6N A;  2MWS B;  1PJJ A;  4NNJ B;  4YT0 B;  4C00 A;  1Y8R C;  3I63 C;  2R9O A;  1SXJ C;  1ESF A;  4G3X B;  2Y6E A;  2M17 A;  2R61 A;  5KPR A;  1IUE A;  3JSV A;  5HG2 A;  1WE7 A;  4BQV A;  3FTE A;  1JRU A;  2KDF B;  5IKC M;  1BUI C;  1GL6 A;  3FUU A;  5JHB A;  2MHJ A;  1PVJ A;  3H7D A;  2KDE B;  3VRA B;  3L17 A;  2IND C;  5KPT A;  4Q2J A;  4YTN B;  1PGY A;  2BBC A;  1XXH B;  3VQI A;  5E6P A;  3GO8 A;  4L8R C;  2FUD A;  5EE0 A;  2JRI A;  2I7N A;  1QQR A;  3WHL A;  1QAN A;  3T3O A;  4K81 A;  1WGH A;  4GMQ A;  3K8Z A;  2LVP C;  5CHF A;  2DC7 A;  2Z4S A;  2LGD A;  1OIP A;  5EF4 A;  1SSN A;  5A24 A;  3IT4 B;  3PNR A;  4LZJ A;  3EFU A;  2N9L A;  4JL9 A;  4JI0 M;  2N35 A;  1OFH A;  2QPA A;  3IFW B;  3RNC C;  2FQ9 A;  4MSQ B;  1TH3 A;  1YNT E;  4TSS A;  3VH4 B;  2NCN A;  2DC6 A;  1QUS A;  2FYE A;  2K0P A;  1VDV A;  4C80 A;  3AEC B;  2NQG A;  1AIM A;  4K3B A;  3H8H A;  3JYU A;  1QT9 A;  4PT5 A;  2H89 B;  8PCH A;  2H1R A;  1MN3 A;  1L6V A;  3NVY A;  4NRV A;  2HWJ A;  1MVK A;  4KGS A;  3QWL A;  3VUX A;  1VDD A;  2AEH A;  4R7G A;  5A2Q S;  1WGK A;  1H6U A;  4LJ9 A;  1P98 A;  1QKZ A;  2GB1 A;  4WQM A;  5EXX A;  2OJR A;  4C7Z A;  2LI5 A;  2IGH A;  3BC3 A;  3UF8 A;  7CAT A;  4IP3 A;  1JAL A;  1FIQ A;  2FNA A;  3KS8 A;  4REZ A;  3NZ3 A;  4RKU F;  2KDI A;  3Q3O C;  1T0Y A;  1VZ7 A;  2KFJ A;  2WXQ A;  3LYY A;  3RZF A;  4TQ0 A;  1XWI A;  2V9H A;  3C0R A;  1D6E C;  3W9C B;  5FR6 A;  4L4U A;  2BTW A;  3W5V B;  4BS6 A;  1KLV A;  2CV0 A;  1S3S A;  1EU4 A;  1ZP0 B;  2QQ8 A;  4HKZ E;  1IBX A;  5LLI A;  1A5T A;  1FXA A;  3P5U A;  3B74 A;  3FE3 A;  3OTO M;  2AYO B;  4X6H A;  1SXJ A;  2HL7 A;  4BFR A;  5IZ7 D;  1IFY A;  5BPV A;  2Z7J A;  1CJE A;  3URY A;  1TT5 B;  1YE9 A;  4X6J A;  2JY7 A;  1V49 A;  5DCN A;  1KHQ A;  3T9L A;  3PS6 A;  1IXZ A;  3IEC A;  2J7Q C;  3PT2 B;  1Q0W B;  4IBC A;  4A55 A;  1RYJ A;  3FRI A;  4WWP A;  1V1P A;  2FH0 A;  4N4Z A;  4GGQ A;  4GKK M;  1CZP A;  3DPD A;  3E46 A;  3EHV A;  3AOG A;  2W55 A;  3AE6 B;  3MK6 A;  1SIJ A;  1IGD A;  2IZV B;  1TDZ A;  2LVP A;  4IBK A;  1GB4 A;  2IJ0 A;  4A3P A;  3BB7 A;  1GJZ A;  1K3B B;  2BB5 A;  4Q8G A;  4GKJ M;  1XXG A;  4HEA 1;  2L00 B;  5CHV C;  1Z5S B;  3AE5 B;  1ET9 A;  2L52 A;  1VQ1 A;  1EWY C;  2CFO A;  2G1E A;  3FC4 A;  4YTP B;  1YK7 A;  1N32 M;  3KP0 E;  3E4R A;  4B3R M;  2WQY B;  2OOB A;  3W0L B;  4USA A;  5E6N A;  4ZRK A;  2JY6 B;  2KDL A;  2FCQ A;  4CYE A;  2GRI A;  2CU1 A;  1NVI D;  4G4N A;  3KVW A;  1XLN A;  2BWF A;  3WIM A;  4LG2 A;  6PAD A;  1ICF A;  4DHZ E;  1VSN A;  1DO2 A;  2EUC A;  4JI7 M;  1R6B X;  3K9O A;  1WYW B;  3CMM B;  3BBA A;  4ZRI A;  3BBZ A;  2EO2 A;  1C4C A;  3IOQ A;  1ZMV A;  1WHC A;  2REX A;  5DNY A;  2C96 A;  2HH5 A;  2CV2 A;  3TCA A;  4WW0 A;  2AVW A;  2OPF A;  4QBB A;  3VXW A;  3WAO A;  3CBJ A;  3DBH B;  5LMU M;  1NO1 A;  2QDF A;  5BYR A;  1F1H A;  1AU3 A;  2ZNV B;  1YX5 B;  2LRW A;  4W5C A;  2KTR B;  1UBQ A;  3KFQ A;  4JI1 M;  2R18 A;  5EXS A;  2WXK A;  2ZTD A;  3UGB B;  1I4W A;  3J7A S;  2PE9 A;  1ZKH A;  1E0Z A;  4KV2 A;  2KKC A;  1J8C A;  1HR0 M;  3TE6 A;  2Y5B A;  2CR5 A;  3WAP A;  2UUC M;  2DYB A;  3UIP B;  2NQA A;  1N6Z A;  2VDB B;  1WGR A;  1U9Q X;  3ZO5 B;  3HHX A;  3SAV A;  4YYW A;  2FAZ A;  2WU2 B;  1TY2 A;  2KC1 A;  3PVL A;  4IIW A;  2CKH B;  2O6X A;  2Y3A A;  3ZVV A;  2N7E A;  2F7D A;  2MSE D;  1LGR A;  1PGX A;  4DK5 A;  2CWB A;  3QCA A;  1N60 A;  3BVZ A;  2C9O A;  4HJK A;  1MHX A;  1N5X A;  1OTR B;  3K92 A;  2M8S A;  2EEL A;  2M0A A;  2J7N A;  3GLF A;  2DZL A;  2DAM A;  3Q8G A;  1J7B A;  3P4P B;  5J17 A;  3J7B A;  4PS8 A;  3LCU A;  3HKP A;  2HKJ A;  3L54 A;  4FWH A;  2TSS A;  2ZW0 A;  3AE8 B;  1NJF A;  4WJN A;  2X4A A;  4KSK C;  1ITO A;  2R4J A;  2AX5 A;  4MSX A;  2WU5 B;  3AJI B;  1XMQ M;  4P1B C;  4CDE B;  4URK A;  3KUC B;  2ZM6 M;  1I4R A;  1OQY A;  2ARY A;  4LNO A;  2DI0 A;  1AIP C;  1ZV1 A;  3P5V A;  4OVZ A;  2O01 F;  3VR8 B;  3KWV A;  4HVB A;  2BKR B;  3DBL I;  3NG0 A;  1L2C A;  3VUY A;  2KYW A;  5C1B A;  2MJD A;  2LUM A;  2JQR B;  4K7U A;  2NPT A;  4KHP M;  1T6B X;  3GPP A;  3TJP A;  1B1Z A;  3PHW B;  2LGI A;  1Q3C A;  3SYL A;  1WWT A;  2JXX A;  4B9K A;  3RUI B;  3FKE A;  3PXG A;  5JI3 E;  3P4Q B;  3LB8 C;  5IRE B;  2C7H A;  3B7Z A;  2XN9 C;  1QOA A;  3PW3 A;  4X57 B;  2J52 A;  4NY0 A;  3DVG X;  2C9C A;  3U6S A;  3P1M A;  4L15 A;  3OF9 A;  3ZIM A;  3IT6 B;  1NBF C;  3A4S C;  4MH0 E;  3QAQ A;  2LGS A;  3P4R B;  4L78 A;  2JY5 A;  3ERV A;  1FFU A;  2J0J A;  4DBG A;  3GZN I;  2F5S A;  3OJ4 B;  4ZPX A;  1YD8 U;  4JV5 M;  3GPY A;  1OAO C;  2J42 A;  3B9J A;  3V61 A;  3VK8 A;  2M60 A;  2KHH A;  4FXC A;  4LDT B;  4L1B A;  4P6G A;  5KHQ A;  2F4V M;  2WGS A;  1FPY A;  3I5J C;  1E8Z A;  1T0Q C;  2RMM A;  4DQO C;  2L3Z A;  1TL9 A;  3OWE B;  3TSS A;  1WRD B;  3U5Z B;  4PS7 A;  4B6W A;  1E7V A;  4KKI A;  4RH6 A;  1FJG M;  2FCS A;  4EEW A;  2X8X X;  3QSD A;  1LO5 D;  4L6V 6;  4DR2 M;  2DNF A;  2XK5 A;  1F2B A;  3VH3 B;  3AV8 A;  1ZCM A;  4RGM A;  5C23 A;  2IGD A;  3ZRF A;  1L5P A;  1KFY B;  2JRH A;  4US9 A;  3O65 A;  4YY3 M;  2ZJD A;  2QNJ A;  2ZPN A;  3N20 C;  1DGJ A;  2KQ7 A;  2WXF A;  3DHI C;  4GIT A;  4HXD A;  2E02 A;  2XFS A;  1XXH A;  2K6Q A;  2WZJ A;  1QQW A;  4IJE A;  3ZTC A;  1KFX L;  4PDG A;  4KSL C;  2KNB A;  2Y0T A;  4RF0 A;  3ETR A;  1TR8 A;  4D8B A;  2XEW A;  5D2M B;  2V6Z M;  1WXM A;  3QJZ A;  2M0X A;  2BS2 B;  4P17 A;  5CVN B;  3HUI A;  2E5L M;  3VKG A;  4N8W A;  1KLU D;  5E6O A;  3OG5 A;  4W9E A;  2PRE A;  2JRI B;  3QT4 A;  3IBE A;  2Q5W D;  2K6D B;  4M01 A;  4D80 A;  2BT6 A;  1PJI A;  1PUT A;  3K24 A;  3QYB A;  3P5X A;  4G4O A;  1T0S C;  3HD3 A;  5BO4 B;  2INN E;  2L0F A;  3ZC7 B;  1THE A;  1IXR C;  1XB2 B;  4FJY A;  1JRO A;  3TEX A;  2J0K A;  2L2D A;  1P7E A;  1V97 A;  3I4Y A;  2ZTC A;  1DGH A;  3U6L A;  4TUW A;  5TSS A;  3S3Q A;  1Q02 A;  2RGF A;  1X1M A;  3TEY A;  3HHZ A;  3Q69 A;  4RM8 A;  3LQR A;  2DHR A;  2HWK A;  3C3D A;  2VZK B;  4OEM A;  2QMT A;  2F1G A;  2Y0Q A;  1UM8 A;  3M0E A;  2JZ0 A;  1KF6 B;  2O6V A;  2DCC A;  2OOA A;  1OFI A;  1JWS D;  1OFF A;  2KVZ A;  2JXT A;  3EFC A;  3THG A;  2HDE A;  2DOS A;  1DO0 A;  1EU3 A;  1DOX A;  1MEM A;  1JR3 D;  1C4P A;  3UQA A;  5EXP A;  3K9P A;  2KLC A;  1NB5 A;  3Q3M C;  3Q8E A;  4G3O A;  1JML A;  4AQ7 A;  1VD2 A;  3LXF A;  1YJI A;  1WFY A;  4FWD A;  1OAI A;  1PDX A;  1E7P B;  1C4A A;  4P16 A;  1QOB A;  2BTW B;  5FPW A;  2V4L A;  1CUK A;  3JAM S;  1P7F A;  3H6S A;  1E9M A;  2BS3 B;  3HHM A;  3C3E A;  2ZAN A;  4B08 A;  2N1W A;  1C1K A;  1UD7 A;  1GAQ B;  3MC9 A;  2BWE A;  2HAK A;  1WGN A;  2D3G A;  1SXJ B;  5C3J B;  2BWB A;  1R7R A;  1IN6 A;  3U61 B;  1CV8 A;  2WYQ A;  1TDH A;  1LXD A;  1GJS A;  3CF6 E;  1EF5 A;  3Q8C A;  3GLG E;  4MEM A;  3F75 A;  3AOE A;  4W9J A;  1Q5W B;  4IWP A;  2R46 A;  4D2K A;  1IXS A;  2KLG A;  1HT2 E;  3AED B;  2AS8 A;  3QAR A;  2FE8 A;  4DR7 M;  3GE8 C;  3UZU A;  2YJ8 A;  2WXH A;  1ZMU A;  4XYC A;  1GB1 A;  4AWJ A;  4D81 A;  4CDF B;  3PZ7 A;  3IV2 A;  3GZN B;  3SAT A;  4PAD A;  3L4P A;  5EDS A;  1C76 A;  3ZH9 B;  1L0V B;  2PE6 B;  2PTL A;  1M4V A;  3TBL D;  3ZJV A;  5EE3 A;  1HZ5 A;  2JYE A;  4GXB A;  4B7F A;  2DLB A;  1HQC A;  2BB6 A;  4G0N B;  1C78 A;  2LVQ D;  2LVO C;  2OOB B;  3S3R A;  4P7I A;  4M9Z A;  4GMV A;  2BVC A;  2N1V A;  4IBI A;  1EWC A;  2C7M B;  1XCT L;  2KWC A;  3GCB A;  4EFO A;  1SJE D;  4D82 A;  4BOS C;  4PP1 A;  2LHD A;  2INP E;  2L7I A;  3DOA A;  3DBS A;  4WH4 A;  3BIN A;  5BMG A;  1P0R A;  1ROE A;  2KWU B;  1QAQ A;  2LEK A;  2WSC F;  1WJ4 A;  2MR9 A;  3N30 A;  2PKO A;  1MX0 A;  2XSZ D;  3L08 A;  1K51 A;  1EF7 A;  4AUQ C;  4XUI A;  2JXN A;  3KDS E;  2VRR B;  4A3O A;  2X38 A;  2ZCC A;  5KO3 A;  4K0K M;  4IC7 B;  1IY0 A;  3V6C A;  1SGH A;  1JRP A;  2RPV A;  2X49 A;  5L8R F;  3DHH C;  4FJC A;  3W1Y A;  5H92 C;  3UQB A;  3AV0 A;  1ZIV A;  1YOV B;  3T8M A;  2HTH A;  4JE3 B;  4IWO A;  2WLB A;  1DGF A;  3A1Q A;  4WIP A;  3HZJ A;  3SAS A;  3PRZ A;  2GHU A;  1AWD A;  5FSW A;  2LRU A;  2B3T A;  2KTF A;  1PGB A;  3Q14 C;  2MQJ A;  2YR0 A;  1NY5 A;  4EZJ A;  1U9X A;  3VDP A;  1T3Q A;  1R4G A;  3SU8 X;  4LJ4 A;  2KEB A;  1NYQ A;  3HJQ A;  3IMA A;  3K8U A;  2IO2 B;  3OVZ A;  3DDC B;  2VII A;  1UNS A;  3LCV B;  1QIL A;  4AG5 A;  2ZW1 A;  3B2G A;  1CMX B;  4II7 A;  4YYS A;  3CF2 A;  1KXR A;  1PFD A;  2QEJ C;  3QJ3 A;  4GOC A;  1NV9 A;  3CSF A;  2JY8 A;  4LY6 A;  5AUI A;  4ANW A;  2DZN B;  3QC8 B;  3AN1 A;  3Q2A C;  4FHK A;  1POP A;  2FCN A;  2KZS A;  2F5N A;  2EMT A;  1K82 A;  1EFU B;  4MI7 A;  2Z8L A;  4XC2 A;  3B9P A;  1ZE3 D;  4GN1 A;  1D0L A;  1ZMW A;  3TWL A;  3ZNH B;  4H2A A;  5CTR C;  1TGZ B;  2K0B X;  4AJY B;  3SEB A;  4IBD A;  4HRO A;  2AUZ A;  4YTM B;  2MBB B;  2VHS A;  2KHW B;  2OO9 A;  4JI5 M;  2Z84 A;  1HTQ A;  3SD5 A;  1J5E M;  4NJC A;  4XZ4 A;  3S2A A;  2HHH M;  3L10 B;  1MG4 A;  2XU1 A;  3EUB 2;  4BKS A;  4CHT B;  1H8C A;  4KDL B;  2AIM A;  2DKL A;  3SHQ A;  3U30 A;  4XR7 A;  3SDL C;  2GBJ A;  4BOS A;  2NPT B;  5KQD A;  1YJ1 A;  3I01 M;  3QIJ A;  4ITQ A;  1NHW C;  1R4M I;  1EO6 A;  3V76 A;  1L0X B;  3ECI A;  3MHS D;  3CH3 X;  5EGW A;  2RD0 A;  4DXA B;  2BU3 A;  1GNU A;  4JWU C;  2CU3 A;  4QNR A;  3VDZ A;  4CO7 A;  3CWI A;  2UXD M;  1CB5 A;  2EA0 A;  2XU4 A;  3DOW A;  2MRO B;  3PLU A;  2C7N B;  1IN8 A;  3SAR A;  5EZQ A;  4F2L A;  2KVR A;  4NJ6 A;  4K7W A;  3H7S A;  3A42 A;  4ZOH C;  1YLA A;  4AQY M;  3BYY B;  1N77 A;  1TKG A;  4OEL A;  2AQ3 B;  1E7U A;  2N9E B;  3H4M A;  3AB5 A;  1IY2 A;  1R7S A;  4DBG B;  2HJ1 A;  3R7Q A;  4ANU A;  5I4D A;  1R2Z A;  2L76 A;  4LJA A;  2C60 A;  2LXC A;  3VHT C;  1NB3 A;  3SAU A;  3W30 A;  3GB1 A;  2GI9 A;  4WJP A;  4DMX A;  2YLM A;  4ARI A;  4AKI A;  2BF8 B;  5L83 A;  4KDI C;  4RFB A;  1PCI A;  1F0Z A;  1Q6K A;  2WXI A;  1EUV B;  3PDF A;  1VDL A;  5G2N A;  2R9F A;  1HNW M;  4X6I A;  3A98 B;  3A45 A;  4MGI E;  1TH2 A;  1N34 M;  3HWN A;  5EJC A;  4AG6 A;  4IBJ A;  3AEA B;  1WGY A;  5GKN A;  3K1J A;  5FR3 A;  1M6D A;  4M0W A;  3PV1 A;  4PCZ A;  3MC0 B;  3IUT A;  2C98 A;  3MTN A;  2XK5 B;  5FTK A;  3TEZ A;  4ZHO A;  3VLF B;  1K3X A;  2Z4R A;  4W9K A;  4AP4 C;  1E8X A;  3HJS A;  3O65 B;  3HJ8 A;  4DV3 M;  1AW7 A;  4CHK A;  2JT4 B;  1EM7 A;  1Q3B A;  3TUO A;  4I4L A;  2DZJ A;  4HXD B;  1ZPS A;  3MP9 A;  3DA1 A;  4ZHP A;  2EKF A;  3M63 B;  3IHP C;  3AFH A;  3ZXV A;  2BTE A;  4QRV A;  5EP3 A;  4BPV A;  2V1U A;  4OW0 A;  2IYD B;  1SXJ D;  1MDW A;  1MHW A;  2GNO A;  3U52 E;  2MEK A;  2KXJ A;  3CIR B;  2V0G A;  2UU7 A;  2YJB A;  5D94 A;  1K53 A;  4B3M M;  1NQC A;  2LBC A;  2L83 A;  3SFZ A;  4GHL A;  5DYG A;  5L95 C;  2HHN A;  4N9F 4;  4DHZ B;  2P0R A;  2GFO A;  1K8R B;  2KW0 A;  1OKS A;  2KA6 B;  1ZUD 2;  4I07 A;  3TIX A;  5JA7 A;  3H7P A;  1WE6 A;  2B1N A;  1L8Q A;  4DV0 M;  2YJ9 A;  3ZGZ A;  2MJ3 A;  1F2A A;  4B0M A;  1FXT B;  2Z3X A;  1C79 A;  3RGS A;  1DGH B;  4RGO S;  1KTK A;  1E9S A;  3BCN A;  4GUA A;  1V80 A;  1T43 A;  3ML8 A;  1JQ4 A;  3KSE A;  1EE8 A;  1QYR A;  3DFZ A;  1JWM D;  3RFW A;  3B7Q A;  3M99 A;  5MPO A;  3LVV A;  4I6N B;  2O6V B;  5G5G A;  2XFT A;  4CIZ A;  3KSJ A;  5FTL A;  3ILK A;  1FNN A;  4JI8 M;  4NAW A;  1PAD A;  2DC8 A;  2K1F A;  3QWZ B;  1BY8 A;  2VF8 A;  5LXH A;  1V81 A;  1QF6 A;  1UFZ A;  3C8Y A;  4KO8 A;  1UEL A;  1YQ3 B;  1Y4H A;  2AHM A;  3K9P B;  1AU2 A;  3O1G A;  4BOZ A;  5ITX A;  3AKZ A;  4LF7 M;  2NQD B;  3ENE A;  4ACF A;  2YNM D;  4JN6 A;  1I4Q A;  4KZC A;  2O5R A;  2Y20 A;  3SR6 A;  1I35 A;  1TY0 A;  1Q10 A;  2NQ8 C;  2OUL A;  4EIW A;  3AEB B;  1VCB A;  3U61 A;  3RZW C;  2PBH A;  1PE6 A;  2XLJ A;  2QCU A;  3VDU A;  2SEB D;  1WXA A;  3N32 A;  1UBI A;  1H4R A;  2ONQ A;  2BYF A;  3SFD B;  2N7J A;  3HGI A;  3GLH A;  2G9H D;  3VFK A;  3WXF A;  3VTV A;  1FEH A;  2DZO B;  3KOY E;  4DR5 M;  1IM2 A;  3Q8X A;  2DWM A;  3IHP A;  3GPX A;  1TU6 A;  2UXB M;  4C56 C;  2R2Q A;  3NY5 A;  1E8W A;  1FNU A;  5HFY A;  3FUW A;  1SE4 A;  3E1Z B;  3V60 A;  2NTS A;  1GLO A;  4W5B A;  3GLI A;  3PRM A;  2G45 B;  2OQ4 A;  1D5M C;  3BII D;  3KWB X;  3U6Q A;  1KSF X;  3L29 A;  1XEE A;  3D32 A;  1IXS B;  3BVG A;  2L32 A;  3PO0 A;  2KJ6 A;  1L4D B;  1K50 A;  3ZNI D;  2KMM A;  2DWQ A;  1WX7 A;  2WXN A;  4IG7 B;  4ZYS A;  1NEK B;  5LMN M;  4OX9 M;  1EWP A;  4IUM A;  4LF6 M;  3DWG C;  2KAC A;  1SP4 B;  4GSW A;  2NBU A;  3GE3 C;  3U7Z A;  1TF0 B;  4IDI A;  4FIP A;  1F4I A;  3W1S C;  1WR6 E;  3PHX A;  1N36 M;  2YEP B;  2AGA A;  3EC8 A;  3PNV A;  4I5S A;  4DHJ D;  1FCL A;  1U4A A;  1GUA B;  2WDQ B;  2QC8 A;  3AEG B;  2YQZ A;  2F5P A;  4PI3 A;  2CEA A;  2FID A;  4YL8 A;  5IAA C;  4XDD A;  1I94 M;  1S3S G;  3J2P B;  3HM3 A;  3L0W B;  4N79 A;  2CJN A;  3FKY A;  3HVZ A;  3I51 A;  3AE2 B;  3OJ3 A;  4JI6 M;  2KJH B;  4B7G A;  3L16 A;  2V3S A;  3LW5 F;  4E71 A;  2KNV A;  4W4U A;  3KH0 A;  3V6C B;  1PPN A;  4QRX A;  4PYU A;  1VJK A;  4AS1 A;  3KP1 E;  4A6Q A;  3GRV A;  2G4D B;  5T8I A;  4E3C A;  1OIZ A;  2JQG R;  2D07 B;  2W3R A;  1BVS A;  1GO5 A;  1OEY A;  2R9N A;  5E26 A;  3A1Q B;  3F5V A;  1IPG A;  2UUB M;  4F1S A;  3W2D A;  4LCB A;  2RGO A;  4IW0 A;  4PP2 E;  1ISN A;  3ZDM C;  2JYT A;  2ASQ A;  1MJD A;  3M62 B;  2KO3 A;  1E6E B;  1UH6 A;  4QHS A;  1V8C A;  3DQV A;  4FW9 A;  1J7C A;  3GPU A;  3V3X A;  4II3 B;  1CSB B;  2WXP A;  4FN2 A;  3PZ8 A;  4I6P A;  2BWE S;  2YVC A;  4AW4 A;  3T1Y M;  1D2N A;  3ZNH A;  4DMY A;  3JVZ X;  2L4F A;  3L26 A;  1WRI A;  3IAM 1;  4HLQ A;  1HEZ E;  3N1Y C;  1WGG A;  1S4V A;  3EIE A;  2BYE A;  4TV3 A;  4IM3 A;  3AMZ A;  2WXM A;  5IOI A;  3SMP A;  1YN4 A;  3K2L A;  2QCZ A;  1TH4 A;  3FUX A;  1HE8 A;  2LFI A;  1KH0 A;  1TJE A;  2ZVO A;  3AM9 A;  4GC5 A;  3MTV A;  5C18 A;  1WXV A;  1JWB D;  2K25 A;  4NZL B;  2IGG A;  2M19 A;  2DAK A;  4M0D A;  3W1S A;  1SBB B;  1K3W A;  1FXI A;  4BLC A;  4G54 A;  3LMM A;  2O2V A;  3IFU A;  3UJN A;  4A8X C;  4NQK E;  3Q3N C;  4JIO U;  1G59 A;  4EE2 A;  3H9D A;  3PSE A;  3FRH A;  4GDL B;  2L1A A;  2CHX A;  2QSD A;  5ITT A;  3RI7 C;  1JW9 D;  3ABV B;  1RWS A;  4DUZ M;  4IKG A;  4W9D A;  3ALB A;  2ZEQ A;  2OZ2 A;  2R45 A;  3NWL A;  1CJL A;  1YN3 A;  1DGB A;  2DJG B;  3IEJ A;  5G55 A;  2UYZ B;  3HRD D;  1NI2 A;  4BVU C;  3KQ4 A;  1OQR A;  2XU5 A;  3U60 A;  1L1Z A;  2WP9 B;  3EIH A;  3RNV A;  3NBI A;  3A4R A;  4LF4 M;  2DXI A;  2XF3 A;  4WWO A;  1G41 A;  4KLN A;  1Z59 A;  4YYV A;  5BR8 M;  3HU1 A;  1JR3 E;  3JR4 A;  2A5Y B;  1NL6 A;  1B9R A;  3PHU A;  1CQD A;  4DDI D;  2MH8 A;  1L4Z B;  1NVM A;  2HJ8 A;  2JPH A;  2M1M A;  3CBK A;  3MJW A;  5LNK 1;  3U6M A;  3R8F A;  2RSU A;  3SBJ A;  4XE0 A;  2GBM A;  3DHG C;  2FBW B;  2LVN C;  3KS4 A;  2QP9 X;  1UGJ A;  4W9L A;  3BVM A;  4L23 A;  4JGH B;  1SIF A;  3TQS A;  3AXC A;  4QNM A;  1ET6 A;  3OIS A;  1UKF A;  4FCV A;  2KDB A;  4W9I A;  5D3I B;  2I38 A;  3AE9 B;  2K9D A;  2PIA A;  2IO1 B;  1WH3 A;  4BBN C;  4XDC A;  1FNW A;  3QAU A;  4CIS A;  2BKF A;  3PZD A;  4M0W B;  3MTN B;  5FKA C;  2ZPY A;  1MG8 A;  3RNA C;  1WYG A;  1IWD A;  4K7S A;  3DF0 A;  1MEG A;  3USV A;  4JI3 M;  3WAM A;  3MFG A;  2DHZ A;  3TNX A;  1G8P A;  4N6E B;  3R66 C;  3AOE C;  2E3T A;  1XQQ A;  4KX6 B;  1DGG A;  2DAF A;  1RAX A;  4WJO A;  2K5P A;  4MB7 A;  2CHG A;  4GEW A;  2C9W B;  3JW0 X;  4HLE A;  1IN5 A;  1EF1 A;  1PPO A;  3TMP A;  3U8E A;  2L7H A;  4GDK A;  4P6V F;  2C5R A;  4OU7 A;  2QBY A;  3O13 A;  4II2 B;  3J9C A;  2DCA A;  3GQ4 A;  4M8M A;  1L6U A;  1VEJ A;  2EJS A;  4X65 M;  2XEP A;  3NZU A;  3OLM D;  2CHQ A;  4I05 A;  1IBM M;  3DCG A;  2NBV B;  2LTU A;  4IBE A;  4LJ7 A;  1V92 A;  1I4P A;  2MJ5 B;  3NVW A;  3WCQ A;  3H7P B;  3C58 A;  5EE1 A;  1AYV A;  1NPZ A;  2KAN A;  1CVZ A;  1WM3 A;  2K3U A;  2NMQ A;  3RFZ B;  3PGE A;  5ITY A;  3HVD A;  3UI3 A;  2CUZ A;  1LQB A;  1L2N A;  2WWZ A;  4K1R B;  2BDL A;  4LFC M;  3ZTD A;  2LJ5 A;  3H6N A;  2RDB C;  1HA5 A;  3TWK A;  2FS1 A;  4F7Z A;  5J94 A;  4WWN A;  2YEP F;  1WR1 A;  3ML9 A;  3RE8 A;  1ZDX A;  2W9N A;  1N33 M;  1FH0 A;  1FNV A;  4RKX A;  1WX8 A;  4JI2 M;  4NAW B;  1J7A A;  2LGY A;  4DV5 M;  2KFK B;  1YQ4 B;  3E56 A;  2KK8 A;  3M6A A;  3UMM A;  2KWD A;  3DBL B;  4DXF A;  1VEG A;  2UWQ A;  1R4N I;  4ANR A;  4BOZ B;  1A70 A;  1SF0 A;  1KFV A;  1GKI A;  1MPE A;  2LWX A;  2P5T A;  5JZE A;  3SFE B;  2KNZ A;  3C9P A;  4NPN A;  2R65 A;  4F1I A;  5DPW A;  3W68 A;  1DF0 A;  3H8B A;  2L6O A;  2M5Z A;  2KQ4 X;  3KXE C;  2D7G A;  1ZXH A;  4CZW A;  3FIL A;  1YAL A;  2DAI A;  4K3C A;  3U6D A;  3U8Z A;  4LF5 M;  1UWM A;  3GLH B;  3MOR A;  4QAY A;  3LVW A;  3IG5 A;  2PAD A;  1W5S A;  1WGL A;  3KYC D;  4JQW C;  5BMI A;  1L2B A;  1HTO A;  3T6P A;  3WXG A;  4NRW A;  2PPH A;  1E9R A;  4HK2 A;  1A6R A;  3CH2 X;  3E21 A;  4KGR A;  1KRH A;  2JSV X;  2KN4 A;  2N9X A;  1E90 A;  2HXZ A;  1WJN A;  3GLI B;  1RFA A;  3PRM B;  2BJW A;  1VZ8 A;  3BWU D;  2HD5 A;  1VR9 A;  1XC8 A;  1CQV A;  4S17 A;  1CS8 A;  2RDH A;  1D5Z C;  2B1M A;  4NSR A;  3GP1 A;  3A9K A;  2LH0 A;  3GP7 A;  3U7D A;  2I7P A;  3ZLZ A;  2XU3 A;  4YYU A;  4WP2 A;  3W5U B;  2QHO A;  1D0K A;  2G3Q A;  4US8 A;  4NQL B;  1J19 A;  4IUM B;  2MH7 A;  3J27 B;  3HX3 A;  4MEL A;  1QAO A;  1C7Y A;  2MBQ A;  2KAJ A;  1MS6 A;  3OF8 A;  5C2T B;  4I8O A;  2D7H A;  4MZO A;  1E5W A;  3V62 A;  1SXT A;  1XLQ A;  4CDC B;  3PHX B;  3NRZ A;  1BML C;  5F02 A;  2JUJ A;  3B21 A;  2BYV E;  2LGX A;  2BDZ A;  3W31 A;  2WSE F;  2KMC A;  3OQC A;  1YMH E;  3CF0 A;  3DZD A;  1AN8 A;  2AL6 A;  3P42 A;  1XNR M;  2A4Z A;  5IP4 D;  1MU5 A;  1HNX M;  1Z5A A;  3ZYY X;  2IPP B;  2JZP A;  2KRU A;  2JWU A;  4BKS D;  2I1J A;  2FCM A;  4GHA A;  2JZ3 B;  2WXJ A;  2MP2 B;  2YFQ A;  3GQ3 A;  2W54 A;  5CVO B;  5IO9 A;  3E9S A;  1WXS A;  2NVU I;  2JU6 X;  1FRR A;  1G4A E;  4A9A A;  2N9K A;  3FYD A;  2N9P C;  1N63 A;  2I2Y A;  2KWV B;  3BPF A;  2K39 A;  3M7G A;  4LJ6 A;  5EZS A;  1WM2 A;  4JWS C;  3N3G A;  5CHW A;  1QMY A;  4GIV A;  3R8B A;  4EZL A;  2EKK A;  5EP1 A;  4Y28 F;  2RR9 A;  3RUL A;  1DEU A;  3W67 A;  1ENF A;  4FAD A;  3VFD A;  3R9X B;  5C1Z A;  1PJQ A;  3GRY A;  1R5L A;  4LDT D;  4GC9 A;  1LTM A;  3QHT A;  1L7Y A;  2KNA A;  2DAJ A;  1YVB A;  2AQ1 B;  2QZ4 A;  2WDR B;  2E01 A;  2FUG 1;  1PRB A;  3FAH A;  3PLV A;  4G4Q A;  1PM5 A;  3ZNG C;  3HU3 A;  4C7Y A;  3KW5 B;  1WIA A;  3P4S B;  1P3Q Q;  4J6I A;  5DPT A;  3PNY A;  2NBW B;  3AH7 A;  4ITK A;  1XKG A;  1OGW A;  4AKG A;  1D0M A;  3QA8 A;  1SXJ E;  2ICI A;  2IPK D;  5D3D A;  2MCN B;  4AI6 A;  3WA0 A;  1AYU A;  2VQF M;  2GLS A;  3ZRC A;  2PMV A;  4TKN A;  4R71 A;  4WQO B;  3LFY A;  4LGM A;  2EKE C;  1C9F A;  4GDL A;  3RCZ A;  4AXM A;  1SE9 A;  1NEN B;  3VVW B;  1WF9 A;  5CX3 A;  1BQI A;  4XWW A;  1CK1 A;  4GU2 A;  3VR9 B;  4LGY A;  2OHF A;  1J0G A;  2O2V B;  4IM0 A;  2FRQ A;  3NZS A;  2NTT A;  3MHV C;  4QHT A;  2L05 A;  3PSE B;  1R4N B;  1O0E A;  4KOD A;  4YSY B;  1T5X D;  2MBH A;  2VH2 A;  1IBL M;  2ZAO A;  2BQQ A;  1PJS A;  2CE7 A;  4FD2 A;  1IY1 A;  3ZKJ C;  3HHI A;  2N7D A;  2WHI A;  5BMH A;  4DV7 M;  1Y56 A;  2I1K A;  1F2C A;  4N58 A;  4HKQ A;  3F92 A;  4YHH M;  3BK1 A;  3VUW A;  2LJI A;  2DCB A;  5G5H A;  4MSM B;  3TWM A;  1ZXI A;  1NLJ A;  2CHW A;  3RGP A;  2KMA A;  1D4B A;  3U60 B;  1Z6T A;  2H88 B;  2ZCB A;  2V3N A;  4HDO A;  1AEC A;  3AL0 C;  3ZUN A;  2VZK D;  1QZM A;  3WAL A;  3AE4 B;  2JUO A;  2R62 A;  3I4V A;  3FUV A;  2VH1 A; 
#chains in the Genus database with same CATH homology
 1IBK M;  4WAF A;  1XCQ L;  1IN7 A;  4ZTB A;  3SHF A;  3AE7 B;  2ZAM A;  2L09 A;  4PD2 A;  3GLG A;  2JX5 A;  1GPX A;  4RCO A;  4DR4 M;  4WUR A;  2XZU A;  3BYT B;  2K9X A;  3P63 A;  2CJO A;  3GRR A;  3L28 A;  4B7H A;  3LQQ A;  2XZF A;  2DWN A;  3HHW A;  1YSY A;  2EKI A;  4OHJ A;  4LF9 M;  4LK0 M;  2J4X A;  2V4I B;  4FCW A;  4GDK B;  2WXO A;  1ZAE A;  4B3T M;  3FD9 A;  2QBY B;  4LJ8 A;  1UUP A;  4LFB M;  4HRS A;  1HNZ M;  2DYM A;  3VRB B;  1Q39 A;  2VQE M;  5H8Y E;  5FTJ A;  2OED A;  4MAC A;  3UGJ A;  4KKJ A;  2WXG A;  1F2R I;  2SAK A;  1XNQ M;  3KSX A;  4DR6 M;  4GIP A;  3IAS 1;  1L1T A;  1IN4 A;  2FFJ A;  4MH8 A;  4RF1 A;  4LF8 M;  3KLS X;  4IJF A;  2DYO A;  1NNJ A;  4BOQ A;  4PDI A;  3U6P A;  1TGU A;  5E6J A;  1IGC A;  1SJH D;  1QVR A;  4CGY B;  5DYI A;  4QOS A;  3I9V 1;  2RKO A;  3VKH A;  1LV7 A;  4BBA A;  4R3D A;  3W0F A;  4UDU C;  4YSZ B;  3VK7 A;  1XLO A;  2CHV A;  4XWT A;  2PVO D;  3FUT A;  1N5W A;  5HHD G;  4B0E A;  2F5Q A;  4LFA M;  3D8B A;  3FIL B;  3AEE B;  1QOF A;  1AYF A;  3Q8F A;  1XO3 A;  2V3P A;  4RGN A;  1WXQ A;  4LLG M;  2LMC A;  2AQ2 B;  1NNU C;  1DKI A;  3FTD A;  1E94 E;  2Q2E B;  3BZD B;  3ZJT A;  4NSO B;  3Q8B A;  2BJV A;  4JXJ A;  4GLS C;  1BXT A;  4BOP A;  1OJL A;  2PLP A;  4OZA A;  3IXS A;  3T15 A;  4ARC A;  3NUH B;  1FFV A;  2UU9 M;  3PVS A;  1TKE A;  1VZ6 A;  4MGZ E;  3RPF C;  2R4E A;  2B76 B;  1MHH E;  2N0S B;  4BOU A;  4NL4 H;  4X64 M;  3GQ5 A;  1QOG A;  4DV6 M;  1G3I A;  4KGT A;  1ORY B;  4ZRQ A;  2E6X A;  3PRP A;  1Z5B A;  1YJJ A;  1HZ6 A;  1I4X A;  1JWU D;  2RGH A;  3J80 S;  3EGR A;  4FVM A;  4MGK E;  2W82 A;  4YWG G;  1I7H A;  3V05 A;  1YZB A;  5FK9 C;  5ITR A;  2CV1 A;  3TL4 X;  1RM6 C;  1X37 A;  1NI3 A;  3SMS A;  5F3W A;  1HXY D;  5KQ8 A;  5GXG B;  4D8I A;  4RNA A;  1N75 A;  4OZC A;  2J7Q A;  1SB3 C;  1D5X C;  1FD6 A;  5EP2 A;  2UXC M;  1L2D A;  3U4E G;  4DXG A;  1XF5 L;  4YSX B;  2G5G X;  2WXR A;  3U2S C;  4X66 M;  3GRU A;  4IBB A;  2BYT A;  3HHY A;  1K52 A;  3GS2 A;  4NAM A;  2FOI C;  2C99 A;  5ITQ A;  4JYA M;  4QOZ C;  4JI4 M;  1YN5 A;  4JX1 C;  4DV4 M;  4DR1 M;  1OQQ A;  1NY6 A;  4NOO B;  3KOW E;  2KRK A;  4X62 M;  1N62 A;  4XZX A;  4TQ1 A;  1FM0 D;  1JCK B;  1HQY E;  4XGI A;  3T1H M;  3U6E A;  2D5G A;  1YUB A;  4AKH A;  3IG8 A;  3TPZ A;  2M56 B;  2JTC A;  4MGY E;  3UK6 A;  2G8L A;  4A90 A;  4D8E A;  3BK2 A;  2DWZ B;  8CAT A;  4HL4 A;  1TS2 A;  1PYW D;  3GLG B;  4N59 A;  3MJ5 A;  4G4R A;  5HI1 A;  4GRI A;  4WWM A;  3BOS A;  5FLX S;  4Z6Y A;  1SEB D;  3FTC A;  2Y21 A;  5IWA M;  1HQR D;  1SE2 A;  3T38 A;  4M9X A;  4DR3 M;  2WS3 B;  1QAM A;  3NVZ A;  3J81 S;  4L16 A;  4L2Y A;  1QLB B;  2LNH C;  1L0Y B;  1TS4 A;  5H37 D;  3MP2 A;  2V1C A;  1NSF A;  1IQP A;  1GL7 A;  5ITU A;  1NHG C;  2QIL A;  2ON8 A;  1RFK A;  3ZCB B;  1F77 A;  5AUK A;  2K22 A;  2QJL A;  2RDG A;  1STE A;  4AZF A;  2QIE B;  2DWL A;  4MT5 A;  3U6C A;  5IT9 S;  1R2Y A;  1XHB A;  2PVG C;  1C77 A;  5JXV A;  2BS4 B;  4I81 A;  2XGN A;  4S12 A;  3N9Y C;  1DOI A;  3R2T A;  1I4G A;  3DWM A;  1E10 A;  3NS1 A;  4NXM M;  3HU2 A;  4DUY M;  2JA2 A;  1Z5C A;  3L2A A;  3L27 A;  3AE3 B;  5EQT A;  4YXD B;  1NJG A;  3L25 A;  3SC3 A;  4MM3 B;  4DV1 M;  1TZO A;  3KOZ E;  3FYC A;  1IBX B;  3PT2 A;  4OZB A;  4B3S M;  1F2R C;  2J53 A;  1J09 A;  2KXE A;  3EA6 A;  1GVN A;  4O1N A;  3FTF A;  1FMA D;  5EXT A;  1DOY A;  1V1P B;  1TKY A;  1JWA D;  1HT1 E;  5FTM A;  3Q8A A;  2Y5C A;  3KFU G;  1J7K A;  4LJ5 A;  1KLG D;  1FCC C;  4A3V B;  3I57 A;  3R2I A;  3MHZ A;  3NVV A;  4IBG A;  1MI0 A;  3SHG B;  3D8L A;  1UWX A;  3AEF B;  2WNM A;  2BW2 A;  1JR3 A;  1N78 A;  1FO4 A;  2ERC A;  1GOZ A;  1T3T A;  3TEW A;  2J7O A;  3HWS A;  3A46 A;  2XH9 A;  4LTU A;  4G6Z A;  2KDM A;  3WHK A;  1TYG B;  2W3S A;  4TMA B;  4LZZ A;  1TS3 A;  2KZU A;  4W5W A;  1ZDV A;  4NXN M;  4MGH A;  1FRD A;  5JI2 E;  4GH9 A;  4IBF A;  2D7E A;  2QEN A;  3U6O A;  2IDY A;  2ZBK B;  5D7G A;  1JQJ C;  3T3N A;  4J3O D;  4JPS A;  2PW9 A;  4LRS A;  2LXE A;  1ZOY B;  4ZRP A;  1XLP A;  5ITX E;  1ZQ9 A;  3B2F A;  4XBO A;  5EE9 A;  2MJE A;  4FWG A;  2HTM E;  4Z8X A;  3GLF B;  2ACZ B;  5KPZ A;  2X8A A;  3SAW A;  1NYR A;  3ZQ4 A;  2BNK A;  4FCT A;  1XMO M;  4CQN A;  2XSZ A;  1V1O A;  5FTN A;  5BYQ A;  2DVW B;  3KWL A;  1I4H A;  3PHW A;  2WXL A;  4OVZ B;  4HJG E;  4M9S A;  2F5O A;  1SE3 A;  4IOI E;  2LHE A;  2HCB A;  1W5T A;  1KYI A;  1WSP A;  2DBY A;  5BYS A;  3BY4 A;  2XNA C;  1ACC A;  3PFI A;  1DYQ A;  2UUA M;  2Y5P A;  4DV2 M;  3SYK A;  3TRK A;  1N61 A;  4A5U A;  1TS5 A;  1PGA A;  3KW6 A;  4BB9 A;  4LRT A;  3AE1 B;  3JR5 A;  2K47 A;  3ZJU A;  3KOX E;  1E32 A;  3U5Z A;  5EP4 A;  2WDV B;  1GLN A;  2UZJ A;  1VLB A;  4RGT A;  3CTW B;  1VRA B;  1PJJ A;  4YT0 B;  1SXJ C;  1ESF A;  2R61 A;  5KPR A;  1IUE A;  5HG2 A;  3FTE A;  1BUI C;  1GL6 A;  3FUU A;  1PVJ A;  3VRA B;  5KPT A;  4Q2J A;  4YTN B;  2BBC A;  1XXH B;  3VQI A;  3GO8 A;  4L8R C;  5EE0 A;  2JRI A;  2I7N A;  1QQR A;  3WHL A;  1QAN A;  3T3O A;  4GMQ A;  3K8Z A;  2Z4S A;  1SSN A;  3IT4 B;  4LZJ A;  2N9L A;  4JI0 M;  1OFH A;  2QPA A;  1TH3 A;  1YNT E;  4TSS A;  2K0P A;  1VDV A;  4C80 A;  3AEC B;  3H8H A;  1QT9 A;  4PT5 A;  2H89 B;  2H1R A;  1L6V A;  3NVY A;  4NRV A;  1MVK A;  4KGS A;  3QWL A;  1VDD A;  4R7G A;  5A2Q S;  1WGK A;  1H6U A;  4LJ9 A;  1QKZ A;  2GB1 A;  4WQM A;  5EXX A;  4C7Z A;  2IGH A;  7CAT A;  4IP3 A;  1JAL A;  1FIQ A;  2FNA A;  3KS8 A;  4REZ A;  3NZ3 A;  1VZ7 A;  2WXQ A;  3LYY A;  4TQ0 A;  1XWI A;  3C0R A;  1D6E C;  3W9C B;  2BTW A;  4L4U A;  3W5V B;  2CV0 A;  1S3S A;  1EU4 A;  1ZP0 B;  4HKZ E;  1IBX A;  1FXA A;  3OTO M;  1SXJ A;  2HL7 A;  5IZ7 D;  5BPV A;  2Z7J A;  1CJE A;  3URY A;  1YE9 A;  2J7Q C;  1IXZ A;  4IBC A;  4A55 A;  1RYJ A;  1V1P A;  4GKK M;  1CZP A;  3AOG A;  2W55 A;  3AE6 B;  3MK6 A;  1SIJ A;  1IGD A;  1TDZ A;  4IBK A;  1GB4 A;  2IJ0 A;  3BB7 A;  2BB5 A;  4GKJ M;  1XXG A;  4HEA 1;  3AE5 B;  1ET9 A;  2L52 A;  2G1E A;  1EWY C;  2CFO A;  3FC4 A;  4YTP B;  1N32 M;  3KP0 E;  3E4R A;  4B3R M;  2WQY B;  3W0L B;  4USA A;  2GRI A;  1NVI D;  4G4N A;  3KVW A;  1XLN A;  4LG2 A;  1DO2 A;  2EUC A;  4JI7 M;  1R6B X;  3BBA A;  2EO2 A;  1C4C A;  5DNY A;  2C96 A;  2CV2 A;  4WW0 A;  2OPF A;  5LMU M;  5BYR A;  4JI1 M;  2R18 A;  5EXS A;  2WXK A;  1I4W A;  3J7A S;  1E0Z A;  1HR0 M;  3TE6 A;  2UUC M;  3HHX A;  3SAV A;  2WU2 B;  1TY2 A;  4IIW A;  2Y3A A;  1PGX A;  1N60 A;  3BVZ A;  2C9O A;  1MHX A;  1N5X A;  3K92 A;  2EEL A;  2M0A A;  2J7N A;  3GLF A;  1J7B A;  3P4P B;  3J7B A;  3HKP A;  2HKJ A;  4FWH A;  2TSS A;  2ZW0 A;  3AE8 B;  1NJF A;  2X4A A;  2R4J A;  2AX5 A;  2WU5 B;  3AJI B;  1XMQ M;  2ZM6 M;  1I4R A;  4OVZ A;  3VR8 B;  3KWV A;  1L2C A;  5C1B A;  2MJD A;  2LUM A;  2JQR B;  4KHP M;  1T6B X;  3GPP A;  1B1Z A;  2LGI A;  1Q3C A;  3SYL A;  1WWT A;  3FKE A;  3PXG A;  5JI3 E;  3P4Q B;  3LB8 C;  5IRE B;  2XN9 C;  1QOA A;  2J52 A;  2C9C A;  3U6S A;  3P1M A;  4L15 A;  3IT6 B;  4MH0 E;  3P4R B;  4L78 A;  1FFU A;  2F5S A;  4ZPX A;  3B9J A;  4JV5 M;  3GPY A;  2J42 A;  3VK8 A;  2M60 A;  4FXC A;  4L1B A;  2F4V M;  2RMM A;  4DQO C;  3OWE B;  3TSS A;  3U5Z B;  4KKI A;  4RH6 A;  1FJG M;  1LO5 D;  4DR2 M;  3AV8 A;  4RGM A;  2IGD A;  1L5P A;  1KFY B;  4US9 A;  3O65 A;  4YY3 M;  1DGJ A;  2WXF A;  4GIT A;  2XFS A;  1XXH A;  1QQW A;  4IJE A;  4PDG A;  2Y0T A;  4RF0 A;  3ETR A;  4D8B A;  2V6Z M;  2BS2 B;  3HUI A;  2E5L M;  3VKG A;  1KLU D;  2Q5W D;  4D80 A;  2BT6 A;  1PJI A;  1PUT A;  4G4O A;  2INN E;  3ZC7 B;  1IXR C;  1JRO A;  3TEX A;  1P7E A;  1V97 A;  3I4Y A;  1DGH A;  3U6L A;  4TUW A;  5TSS A;  3TEY A;  3HHZ A;  3Q69 A;  3LQR A;  2DHR A;  2HWK A;  2VZK B;  2QMT A;  2Y0Q A;  1UM8 A;  3M0E A;  1KF6 B;  1OFI A;  1JWS D;  1OFF A;  2JXT A;  3THG A;  2HDE A;  2DOS A;  1DO0 A;  1EU3 A;  1DOX A;  1JR3 D;  1C4P A;  5EXP A;  3Q8E A;  1JML A;  4AQ7 A;  3LXF A;  1YJI A;  4FWD A;  1PDX A;  1E7P B;  1C4A A;  4P16 A;  1QOB A;  2BTW B;  3JAM S;  1P7F A;  1E9M A;  2BS3 B;  2ZAN A;  4B08 A;  1C1K A;  1GAQ B;  1SXJ B;  5C3J B;  1R7R A;  1IN6 A;  3U61 B;  1TDH A;  3CF6 E;  3Q8C A;  3AOE A;  4D2K A;  2R46 A;  3AED B;  1HT2 E;  2FE8 A;  4DR7 M;  3UZU A;  2WXH A;  1GB1 A;  4D81 A;  3PZ7 A;  3SAT A;  3L4P A;  1C76 A;  3ZH9 B;  1L0V B;  2PTL A;  1M4V A;  3ZJV A;  5EE3 A;  1HZ5 A;  2JYE A;  4B7F A;  2DLB A;  1HQC A;  2BB6 A;  1C78 A;  4M9Z A;  4IBI A;  1EWC A;  1XCT L;  1SJE D;  4D82 A;  2LHD A;  2INP E;  2L7I A;  3DOA A;  4WH4 A;  5BMG A;  1ROE A;  1QAQ A;  2LEK A;  2PKO A;  1MX0 A;  2XSZ D;  1K51 A;  3KDS E;  2X38 A;  5KO3 A;  4K0K M;  1IY0 A;  1JRP A;  2RPV A;  2X49 A;  5H92 C;  3AV0 A;  4JE3 B;  2WLB A;  1DGF A;  4WIP A;  3SAS A;  1AWD A;  5FSW A;  1PGB A;  2YR0 A;  1NY5 A;  3VDP A;  1T3Q A;  4LJ4 A;  2KEB A;  1NYQ A;  3HJQ A;  2VII A;  1UNS A;  1QIL A;  4AG5 A;  2ZW1 A;  3B2G A;  4II7 A;  3CF2 A;  1PFD A;  2QEJ C;  4LY6 A;  5AUI A;  2DZN B;  3AN1 A;  2KZS A;  2F5N A;  1K82 A;  4MI7 A;  2Z8L A;  3B9P A;  1ZE3 D;  3TWL A;  4H2A A;  3SEB A;  4IBD A;  4HRO A;  4YTM B;  4JI5 M;  2Z84 A;  1J5E M;  4NJC A;  2HHH M;  3EUB 2;  4CHT B;  4BOS A;  5KQD A;  4ITQ A;  1NHW C;  1L0X B;  2BU3 A;  4JWU C;  2CU3 A;  4QNR A;  3CWI A;  2UXD M;  2EA0 A;  1IN8 A;  3SAR A;  5EZQ A;  3A42 A;  4ZOH C;  4AQY M;  3BYY B;  1N77 A;  1TKG A;  2AQ3 B;  3H4M A;  3AB5 A;  1IY2 A;  1R7S A;  5I4D A;  1R2Z A;  4LJA A;  3SAU A;  3W30 A;  3GB1 A;  2GI9 A;  4ARI A;  4AKI A;  4RFB A;  1F0Z A;  2WXI A;  1HNW M;  3A98 B;  3A45 A;  4MGI E;  1TH2 A;  1N34 M;  5EJC A;  4AG6 A;  4IBJ A;  3AEA B;  5FR3 A;  5GKN A;  3K1J A;  4M0W A;  4PCZ A;  3MC0 B;  2C98 A;  5FTK A;  3TEZ A;  4ZHO A;  3VLF B;  1K3X A;  2Z4R A;  3HJS A;  3HJ8 A;  4DV3 M;  1AW7 A;  1EM7 A;  1Q3B A;  3TUO A;  4I4L A;  4HXD B;  1ZPS A;  3MP9 A;  3DA1 A;  4ZHP A;  3AFH A;  2BTE A;  5EP3 A;  2V1U A;  4OW0 A;  1SXJ D;  3U52 E;  2MEK A;  3CIR B;  2V0G A;  1K53 A;  4B3M M;  2L83 A;  3SFZ A;  4GHL A;  5DYG A;  2KW0 A;  2KA6 B;  1ZUD 2;  1L8Q A;  4DV0 M;  3ZGZ A;  2MJ3 A;  4B0M A;  2Z3X A;  1C79 A;  3RGS A;  1DGH B;  4RGO S;  1KTK A;  1E9S A;  4GUA A;  1JQ4 A;  1EE8 A;  1QYR A;  3DFZ A;  1JWM D;  3RFW A;  5MPO A;  3LVV A;  5G5G A;  2XFT A;  3KSJ A;  5FTL A;  3ILK A;  1FNN A;  4JI8 M;  1QF6 A;  3C8Y A;  4KO8 A;  1YQ3 B;  2AHM A;  4BOZ A;  5ITX A;  3AKZ A;  4LF7 M;  2YNM D;  4JN6 A;  1I4Q A;  2O5R A;  2Y20 A;  3SR6 A;  1TY0 A;  1Q10 A;  2NQ8 C;  4EIW A;  3AEB B;  3U61 A;  2XLJ A;  2QCU A;  3VDU A;  2SEB D;  2ONQ A;  3SFD B;  2N7J A;  3HGI A;  3GLH A;  2G9H D;  1FEH A;  2DZO B;  3KOY E;  4DR5 M;  1IM2 A;  3Q8X A;  2DWM A;  3GPX A;  2UXB M;  4C56 C;  1FNU A;  5HFY A;  3FUW A;  1SE4 A;  2NTS A;  3GLI A;  3PRM A;  2OQ4 A;  1D5M C;  3BII D;  3U6Q A;  1KSF X;  3L29 A;  1XEE A;  1IXS B;  3BVG A;  2L32 A;  3PO0 A;  1L4D B;  1K50 A;  2KMM A;  2DWQ A;  2WXN A;  4ZYS A;  1NEK B;  5LMN M;  4OX9 M;  4IUM A;  4LF6 M;  3DWG C;  2KAC A;  3U7Z A;  4IDI A;  3PHX A;  1N36 M;  2YEP B;  2AGA A;  3PNV A;  4I5S A;  1FCL A;  2WDQ B;  3AEG B;  2YQZ A;  2F5P A;  2CEA A;  4XDD A;  1I94 M;  3J2P B;  2CJN A;  3HVZ A;  3I51 A;  3AE2 B;  4JI6 M;  4B7G A;  1VJK A;  4AS1 A;  3KP1 E;  4A6Q A;  3GRV A;  5T8I A;  2W3R A;  5E26 A;  2UUB M;  3W2D A;  4LCB A;  2RGO A;  2JYT A;  1E6E B;  4QHS A;  1V8C A;  4FW9 A;  1J7C A;  3GPU A;  3V3X A;  2WXP A;  3PZ8 A;  4AW4 A;  3T1Y M;  1D2N A;  3ZNH A;  3L26 A;  1WRI A;  3IAM 1;  4HLQ A;  1HEZ E;  3EIE A;  3AMZ A;  2WXM A;  3SMP A;  1YN4 A;  3K2L A;  1TH4 A;  3FUX A;  2LFI A;  1KH0 A;  1TJE A;  3AM9 A;  4GC5 A;  3MTV A;  5C18 A;  1JWB D;  4NZL B;  2IGG A;  2M19 A;  4M0D A;  3W1S A;  1SBB B;  1K3W A;  1FXI A;  4BLC A;  3LMM A;  3IFU A;  3UJN A;  4A8X C;  1G59 A;  4EE2 A;  3PSE A;  4GDL B;  2L1A A;  2QSD A;  5ITT A;  1JW9 D;  3ABV B;  1RWS A;  4DUZ M;  4IKG A;  2R45 A;  3NWL A;  1YN3 A;  1DGB A;  3HRD D;  3KQ4 A;  1OQR A;  3U60 A;  1L1Z A;  2WP9 B;  3EIH A;  3RNV A;  3NBI A;  4LF4 M;  2DXI A;  2XF3 A;  1G41 A;  4KLN A;  1Z59 A;  5BR8 M;  3HU1 A;  3JR4 A;  2A5Y B;  1B9R A;  3PHU A;  1L4Z B;  1NVM A;  5LNK 1;  3U6M A;  3R8F A;  3SBJ A;  4XE0 A;  2FBW B;  3KS4 A;  2QP9 X;  1UGJ A;  3BVM A;  4L23 A;  3TQS A;  4QNM A;  1ET6 A;  1UKF A;  4FCV A;  5D3I B;  2I38 A;  3AE9 B;  2PIA A;  4XDC A;  1FNW A;  3QAU A;  4CIS A;  5FKA C;  1WYG A;  4JI3 M;  3MFG A;  1G8P A;  4N6E B;  3AOE C;  2E3T A;  4KX6 B;  1DGG A;  2K5P A;  4MB7 A;  2CHG A;  3TMP A;  1IN5 A;  2L7H A;  4P6V F;  2C5R A;  4OU7 A;  2QBY A;  3O13 A;  3J9C A;  3GQ4 A;  1L6U A;  4X65 M;  2XEP A;  2CHQ A;  1IBM M;  4IBE A;  4LJ7 A;  1I4P A;  3NVW A;  3WCQ A;  3C58 A;  5EE1 A;  2NMQ A;  2K3U A;  3RFZ B;  5ITY A;  3HVD A;  3UI3 A;  2CUZ A;  4LFC M;  1HA5 A;  3TWK A;  2YEP F;  3RE8 A;  1ZDX A;  1N33 M;  1FNV A;  4RKX A;  4JI2 M;  4NAW B;  1J7A A;  4DV5 M;  1YQ4 B;  3E56 A;  3M6A A;  3UMM A;  2KWD A;  4DXF A;  1A70 A;  1SF0 A;  1KFV A;  1GKI A;  1MPE A;  2LWX A;  2P5T A;  5JZE A;  3SFE B;  2R65 A;  2L6O A;  2M5Z A;  2KQ4 X;  3KXE C;  2D7G A;  1ZXH A;  3FIL A;  3U6D A;  4LF5 M;  1UWM A;  3GLH B;  3LVW A;  3IG5 A;  1W5S A;  5BMI A;  1L2B A;  4NRW A;  1E9R A;  4KGR A;  1KRH A;  2JSV X;  2KN4 A;  3GLI B;  2BJW A;  1VZ8 A;  3BWU D;  1VR9 A;  1XC8 A;  1CQV A;  2RDH A;  1D5Z C;  4NSR A;  3GP1 A;  2LH0 A;  3GP7 A;  2I7P A;  3W5U B;  4US8 A;  2MH7 A;  3J27 B;  1QAO A;  2KAJ A;  5C2T B;  4I8O A;  2D7H A;  1SXT A;  1XLQ A;  3NRZ A;  1BML C;  3B21 A;  3W31 A;  3OQC A;  1YMH E;  3CF0 A;  3DZD A;  1AN8 A;  3P42 A;  1XNR M;  1MU5 A;  1HNX M;  1Z5A A;  3ZYY X;  2JZP A;  2KRU A;  2JWU A;  4GHA A;  2WXJ A;  2YFQ A;  3GQ3 A;  2W54 A;  3E9S A;  2JU6 X;  1FRR A;  1G4A E;  4A9A A;  2N9K A;  3FYD A;  1N63 A;  2I2Y A;  5EZS A;  3M7G A;  4LJ6 A;  4JWS C;  3R8B A;  5EP1 A;  1ENF A;  3VFD A;  3R9X B;  3GRY A;  4GC9 A;  2AQ1 B;  2QZ4 A;  2WDR B;  2FUG 1;  3FAH A;  4G4Q A;  1PM5 A;  3HU3 A;  4C7Y A;  3P4S B;  3PNY A;  3AH7 A;  4ITK A;  4AKG A;  1SXJ E;  2ICI A;  2IPK D;  5D3D A;  4AI6 A;  2VQF M;  2PMV A;  4LGM A;  1C9F A;  1NEN B;  4XWW A;  1CK1 A;  3VR9 B;  4LGY A;  2OHF A;  2NTT A;  3MHV C;  4QHT A;  4KOD A;  4YSY B;  1T5X D;  1IBL M;  2ZAO A;  2CE7 A;  4FD2 A;  1IY1 A;  5BMH A;  4DV7 M;  1Y56 A;  4N58 A;  4HKQ A;  4YHH M;  3BK1 A;  2LJI A;  5G5H A;  3TWM A;  1ZXI A;  3RGP A;  1D4B A;  3U60 B;  1Z6T A;  2H88 B;  2V3N A;  3AL0 C;  2VZK D;  1QZM A;  3AE4 B;  2R62 A;  3I4V A;  3FUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...