4RNAA

Crystal structure of plpro from middle east respiratory syndrome (mers) coronavirus
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
321
structure length
319
Chain Sequence
LTIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVDKVRSLKLSDNNYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSDCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords papain-like protease
publication title Inhibitor Recognition Specificity of MERS-CoV Papain-like Protease May Differ from That of SARS-CoV.
pubmed doi rcsb
source organism Human betacoronavirus 2c emc/2012
molecule tags Hydrolase
total genus 92
structure length 319
sequence length 321
ec nomenclature ec 3.4.22.-:
pdb deposition date 2014-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4rnaA02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rnaA01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4rnaA03
4MM3B 4REZA 4OVZA 3MP2A 4OVZB 3MJ5A 3E9SA 4P16A 2FE8A 4RF0A 4M0WA 4RNAA 4WURA 4PT5A 5KO3A 4OW0A 4R3DA 4RF1A 5E6JA
chains in the Genus database with same CATH superfamily
4FWDA 2INDC 4FD2A 2N35A 3GLFE 2DVWB 1P7FA 2KFKA 2DHYA 2XEWA 1QXPA 4I05A 1TH3A 5HI1A 1CB5A 2CIOA 4HJGE 1XC8A 1UH6A 4LNIA 1D4BA 1QOBA 3H8BA 4DV4M 4AOFA 3HUIA 1D0LA 1BUIC 1GB1A 1QMYA 3L27A 3NJTA 4AG5A 3ZUAA 2BS2B 4X64M 3DOAA 4DR6M 3DBHI 1DGGA 1PFDA 3H6SA 2RDGA 3DVGY 1Y8GA 2QHOB 2FNAA 2WX0A 3DBHB 1L2NA 4ANUA 2AL3A 3CH2X 4IBBA 1KFXL 4B08A 4BBNC 4DHJB 1VLBA 2J5YA 3ZLZA 2W3RA 2Y5BB 2QZ4A 2LGXA 3HX3A 3EGRA 4IDIA 2Y21A 3JYUA 1E5WA 1ZXHA 4C56C 4QRGA 2QJLA 2P86A 2KZUA 5FSWA 3U6OA 4NJ7A 2PNSA 3CTWB 4N59A 1T0QC 2BJWA 3V61A 3QJZA 5KO3A 3M7GA 1FRRA 2V1YA 4D82A 2AYNA 3P5VA 2DCBA 4X6HA 2WP9B 2KNAA 4LCBA 4M9SA 1NYRA 3T1YM 4Z6YA 2FH0A 2YJ9A 4RGNA 4YHHM 3Q8XA 2NQIA 1GJTA 1CUKA 3RVXA 3L25A 1E6EB 2OHFA 3WXEA 3GPPA 5EE0A 4QRVA 3M0EA 1E9MA 1WE6A 3TMPA 4NXMM 2L3ZA 2MSED 3AI8A 2HTME 2WXGA 1TY2A 3EIHA 1STFE 4YT0B 2CHGA 1WJ7A 2V3SA 4P6GA 2JU6X 2KW0A 3ETRA 4RCOA 4JX1C 3TE6A 3H9DA 2BVCA 4IOIE 4G4NA 3R7RA 3U6PA 1WI0A 3QJ3A 3TWLA 2K8HA 4J3OD 3PRZA 2Y0TA 2M0XA 3AE5B 1IN8A 1UWXA 2AWTA 2UWQA 4OHJA 3RI7C 3R3MA 1YD8U 2ZBKB 3MHSD 3PZDA 3N20C 4D2KA 3EUB2 5J94A 2R9NA 3BOSA 3VDZA 3LMMA 1MJDA 4AI6A 3VH3B 3ZIMA 3GQ4A 3RNAC 3V05A 1SP4B 5EZQA 1NY6A 2MGWA 3T6PA 2K22A 2JY5A 4HRSA 1V33A 3K9OB 2AGAA 3OLMD 3LJ3A 3MHSA 3EIEA 2UUBM 2LGSA 3L54A 4BS6A 3W0FA 3VDUA 3UGJA 3SHQA 4OVZA 3FTEA 2R9MA 5FR6A 3AECB 1QT9A 1SJHD 2IPPB 2FS1A 3R8BA 1XB2B 1F1HA 3DWMA 2VHSA 4QNRA 1UNSA 5BO4B 3SHFA 1S4VA 2DZIA 2Z59B 3K92A 4MGHA 1UGJA 2WXHA 2NPTA 3PT2A 1YVBA 3T8MA 2AL6A 2AQ1B 2BT6A 3A1QB 3ZTDA 2NR2A 2DKLA 2EKFA 1J8CA 2SAKA 3QARA 2LASA 2CHVA 1JWAD 4BB9A 3ALBA 1PPDA 4YWGG 5G5GA 2VZKB 2TSSA 3T3NA 4I6NB 2QNJA 2UU9M 1TZOA 2C0YA 1TS2A 5H37D 3JR4A 1EWCA 3VAWA 3K8ZA 1FJGM 2WWZA 3DVNU 4PD2A 2XF3A 1MN3A 4YTPB 2V0GA 1KTKA 1WZ0A 2MQJA 1MVKA 3V3XA 4MGYE 2ACZB 3FRIA 2V9HA 3LDZE 4G0NB 3LVWA 1XLPA 2ZNVB 3UK6A 4C00A 5MPOA 1IWDA 3AOGA 5ITXE 1IGDA 4DDID 3BBAA 4HPLB 1PJTA 5L8RF 2CHQA 1OIZA 4I5SA 3VTUA 2Y0QA 1GC6A 4P7IA 2BJVA 3HHYA 3GO8A 1Q02A 2W55A 2DWNA 3SASA 5FTNA 2DWMA 1Y56A 1D2NA 2PTLA 1SXJE 1P98A 4HKQA 3QYBA 4K7UA 3CSTA 1ZXIA 4DQOC 2RMMA 2QHOA 3OTOM 1RYJA 1YJ1A 4TSSA 4KDIC 1MJGM 2YFQA 4MDKE 1AYVA 2G4DB 3SYLA 3CBKA 4OZCA 4JI6M 5AZHA 3HIZA 4IBFA 1WRIA 3ZJVA 2AUXA 1G59A 1R4MB 2B1NA 2Y5BA 1SF0A 4PADA 4ARCA 1LM8B 3DHGC 5EF4A 4NOOB 4CHTB 3H7DA 1NO1A 1PGBA 3DHHC 4QHTA 2AVWA 5EP4A 1C1KA 1DGFA 1IQPA 3N1YC 1BVSA 2K47A 3APCA 3E9SA 2MHJA 4DWFA 3N32A 2WXMA 1V9JA 1H4RA 5C23A 2N9EB 3IG3A 4RNAA 2VRRB 1ZE3D 3PRPB 5BMHA 2KEBA 1YOVB 4JPSA 2DZNB 3HJ8A 3QK0A 4JI4M 1ZMWA 4K1RB 2DYMA 2F4VM 1ET6A 1ME4A 2XGNA 5BMGA 3P1MA 3VUYA 3KUDB 1PRBA 2WDVB 1J7BA 1L7YA 3PHXA 2VIIA 4ANWA 4AQ7A 3RNFC 2WS3B 1QILA 2JY8A 5HG2A 3RPFC 3AEFB 1VQ1A 4ZPXA 2HE7A 4EIWA 4GLSC 4II2B 4MSMB 1TZ1A 3B9JA 1NI2A 3DDCB 1I4HA 4L15A 3ZC7B 5EZSA 2BWFA 4RGOS 5BR8M 4C4VA 3N30A 4LGMA 3OISA 2L0FA 2FRQA 1C4AA 2N9XA 3GS2A 3HVDA 3SHGB 3X0WA 2KDBA 1ISNA 4YYSA 2Z84A 3RMKC 4M01A 3I01M 1XMQM 3DBLB 2NVUI 1EWOA 5FKAC 2I7PA 1NB3A 1GPXA 2KKCA 4AW4A 1TR8A 4FXCA 1NSFA 1N62A 2WU5B 1UWMA 2RGFA 2LHCA 3Q3MC 1MU5A 2F5QA 4XX5A 2ZEQA 1YN5A 3C19A 4F2LA 4AKGA 2G5GX 1TU6A 1XF5L 3LCUA 3K9OA 3RNCC 2AQ2B 1N75A 4B95A 2O2VB 1KH0A 1V92A 4DR3M 2J0JA 3QWZB 5FTKA 3MP9A 1QZEA 4XR7A 1C9FA 3QYEA 4KGRA 1XLQA 4I81A 1KLGD 1VZ7A 3OWEB 3V6CA 2BWBA 2J52A 2I1JA 1F2RC 2KA6B 4PS7A 1IPGA 2IGHA 3U2SC 4IWOA 3UQBA 2R9FA 4DR4M 3E46A 2K8CA 4DMYA 2MH8A 1UBIA 2G3QB 1IBXB 1D5ZC 1HR0M 4DDGD 2XK5B 1AN8A 2JWZA 1UD7A 1LQBA 4HXDB 3TSSA 5EDSA 3NRZA 3F75A 2G8LA 8PCHA 3DA1A 3LXFA 4AKIA 1I94M 1TS4A 2PE9A 4A3VB 4BOZA 2WQYB 1TF0B 1CQDA 1IY1A 4HEOA 1MEMA 2LVQA 1YALA 2XZUA 3AOEC 2EKIA 2GI9A 4JE3B 5DFLA 2BB5A 1JROA 3N1XC 4ICUA 2YQZA 2ZW0A 1KOTA 1N34M 2UZJA 3NBXX 2K8BA 2KANA 1HNXM 1QUSA 3LYYA 2WGSA 3KSJA 3FKYA 5JXVA 4M0WA 3WHLA 1R2ZA 1WXAA 2ZANA 4LJAA 3EECA 4A8XC 1MFWA 4W9CA 1EWLA 4BKSD 5JHBA 2R6NA 2WSFF 1NQCA 1YLAA 4TUUA 1LO5D 3V60A 1I4RA 4B0EA 1L4DB 3VUWA 4YY3M 3AULA 5EE1A 1MG4A 2HCBA 4K3CA 2Z3XA 2KMCA 3FRHA 1CZPA 1GB4A 3VTWA 3FUXA 4J6IA 4BKSA 4Y28F 2L76A 1WJ4A 4GMVA 1L5PA 2D3BA 1UUPA 1L6VA 4XDDA 5C3JB 2L83A 4L6V6 5I4DA 1L1ZA 5L95C 1D5MC 3T15A 1ZDVA 3NVYA 4JQWC 1K8RB 2V4IB 1J7KA 2WYQA 1V34A 3SBJA 4FJZA 3O65B 5EXSA 3AXCA 1OFFA 4GKKM 2J7OA 1B9RA 3L0WB 2L4FA 5C2TB 2E6XA 3KUZA 3O13A 4W9IA 2CKHB 3HM3A 5C1ZA 1HNZM 2HH5A 3ERVA 4IJEA 3TPZA 4R71A 3SATA 5EP2A 2R2QA 4NZLB 4RKUF 4LF9M 3FAHA 2DNAA 4GSWA 2J4XA 3ZDTA 3OVZA 2JZ3B 3HZJA 4B7FA 1PUTA 3KP1E 3J27B 3KOYE 1N63A 2QCUA 5IWAM 1GG3A 2PEAA 1GJSA 3J80S 1LTMA 5FR3A 3GE3C 1G4AE 5DCNA 4ZHPA 1IYFA 3BYTB 3F5VA 2KMAA 1WH3A 2RPQA 5CX3A 1CV8A 4DHZE 3P5XA 3DF0A 2MW5A 4ICVA 2LHGA 1WE7A 1QOLA 1F77A 4RM8A 5D94A 3LFYA 3B7ZA 4BBAA 2CHZA 2HTHA 4IUMA 3E1ZB 2MH7A 1C78A 2JYTA 3V76A 2BTWA 2LXEA 4P17A 1VG5A 3IBEA 3P4PB 2CB5A 4BOSA 5BPVA 1BY8A 2PREA 1V8CA 1YJIA 2KYWA 4RMAA 5CTRC 1DO2A 4X6JA 1AWDA 3QWLA 2KACA 3B79A 3PV1A 2F7DA 1E9SA 1PGAA 2G9HD 4K7WA 4JLCA 3HHMA 4WA6A 3JR5A 2JNHA 2KDMA 4XYCA 1Z5CA 2JY6A 1UBQA 4ZOHC 1Y08A 1FFVA 4NC6A 4HJKA 3C58A 1NBFC 3VKHA 1ITOA 1BP4A 1VCBA 2KFKB 1I42A 1DOIA 4LF7M 2JY7A 2NBUA 4ZYNA 2O2VA 2ZNVC 2V3PA 2ZVNA 4G6ZA 4OVUA 1G41A 3B7QA 3TWKA 3PHUA 4M00A 2HAKA 4B3RM 1OFIA 2IYDB 4XWTA 3AMZA 2KNZA 2W82A 1AECA 4FIPA 1ZAEA 1KYIA 2K0BX 2Y20A 2KWUB 1DEUA 3D8LA 3USVA 1IXSA 4AJWA 2KTFA 5IP4D 4OZBA 2G3QA 5E6OA 1BMLC 1KHPA 2E00A 2XK5A 2JXXA 3L29A 1C4CA 1UELA 4HXDA 4B7GA 2PVGC 3Q3FA 4RH6A 4NSRA 2C5LC 4HL4A 4F1IA 3KVWA 1IBMM 2GRIA 4GU2A 2OULA 3L4PA 4ASWC 1SG9A 2HL7A 1IY2A 1PCIA 2C98A 3ZXVA 1STEA 1QQRA 4LZZA 2YEPF 2X4AA 3SARA 2HDEA 2DZKA 5CHFA 2L4EA 2GFOA 2LWPA 3RUIB 2BGFA 3HU1A 1DOXA 2H89B 2L09A 1JR3D 1QDQA 1EIJA 3MHZA 3W1SC 5E6NA 2I38A 2D11A 2WXFA 4PYUA 2JXTA 1VEKA 3P63A 1GLOA 3TEYA 2VHFA 3TUOA 2GNOA 3LW5F 3W2DA 1OIPA 2G6DA 5ITUA 5IO9A 2E02A 2BW2A 1FRDA 4G4RA 4D81A 3RNVA 3KX1A 2VF8A 1ORYB 4RKXA 4GH9A 1UGMA 3TMPB 4AS1A 4XUIA 4L2YA 4C80A 2LVOC 2AU1A 1R7SA 1SE2A 3GOEA 3W30A 2MP2B 4MH0E 2IO1B 2WBFX 2MBHA 1L2CA 1P1AA 1KHQA 5D3IB 3KSXA 4GIVA 1MI0A 3RULA 1V1PA 3THGA 2LUEA 5CVOB 1U9XA 3WHKA 3L26A 2M60A 1MHHE 2UXDM 1XCTL 2BPSA 3KLSX 1P9DU 2LVPA 1HUCB 1NY5A 3O65A 3MORA 3HU3A 1MPEA 3PVLA 1THEA 2DZZA 2ZM6M 1T3TA 1R4GA 3BZDB 2E01A 1WXSA 4RF1A 2JUJA 4AG6A 3ZGZA 3HM6X 3IHPA 2BKFA 2F1GA 1FCCC 4RGTA 1R7RA 4MJSA 5AUKA 2HKJA 4LRTA 2BWEA 1IBLM 3MHVC 4DK5A 1D0KA 1T0RC 4LTUA 3DBSA 3GLGA 4YSZB 4DUYM 4EKUA 2AUZA 1WHCA 2MR9A 1ET9A 1PPPA 3VR8B 3I9V1 2YNMD 2JWUA 4HWIB 1Q10A 3I3TA 4DV1M 3VK8A 3P4RB 2QPAA 2APLA 2ARYA 1AUAA 2WZJA 4FW9A 1NEKB 2AX5A 2NPTB 3PT2B 1VDVA 1V86A 1DKIA 3ZNHA 3VDPA 4EZKA 3PZ8A 4W5BA 4BPVA 2M17A 2IO0B 2B1MA 2N1VA 3X23A 4EZJA 3D6SA 5DNYA 1ZW7A 1IXRC 1FFUA 1JQPA 4DBGA 3FYCA 1SXJC 2PBHA 1QAQA 4P1BC 4XGAB 4CZWA 1W5TA 1OTRB 2INCC 3IAS1 2PVOD 4FWHA 2YJ2A 4GN1A 1PADA 1NL6A 5CHVA 3SMPA 1X1MA 4PS8A 2GBMA 4W9LA 5LMNM 2Y5CA 3E21A 3C0RB 3QCAA 2RD0A 1EFUB 2W54A 4IC7B 4MH8A 4X62M 5FPWA 2IO2B 3CIRB 4II3B 2RDBC 5TR5A 1TKEA 2HWKA 4AQYM 4XDCA 1U4AA 4XZ4A 3GQ5A 2DZMA 1HZ6A 4ZRQA 1ZUD2 2FOIC 1N61A 2CUZA 4MACA 1S1QB 2X38A 4QHSA 1LFDA 4WAFA 2E5LM 1WSPA 3MP2A 3RFZB 1SEBD 4MELA 1CSBB 1ZDXA 4BSQA 2WSCF 4FHJA 2GBRA 1RWSA 2LMCA 3T3OA 3FUTA 2J7QB 3KXEC 2NTSA 1K82A 1VSNA 4F1SA 4HDQA 3KW6A 3B21A 4H2AA 3RE8A 4B3SM 2JRIA 4N79A 2Y5PA 1TKGA 3ML8A 1OEYA 5JZEA 2KLGA 1TT5B 1K3WA 1GO5A 3CSFA 3OQCA 1IN6A 1WGNA 3IFWB 1Y8RC 3KUCB 2B3TA 3QIJA 3SU8X 5IZ7D 3H6NA 4JGHB 3TEWA 4BOQA 1UF0A 4XE0A 4W4UA 3T1HM 1RAXA 1PE6A 2JZPA 3HU2A 4Q7JA 4W9GA 1W5SA 2PLPA 3BVMA 1F4IA 3KW5B 3MC9A 2XU1A 2FQ9A 1N77A 2YJBA 1VRAB 2NQDB 5BYRA 3ABVB 3APDA 1QAMA 2IO3B 2BNKA 1WX7A 2MA9B 4N9F4 2HD5A 2A4ZA 3BK2A 2A5YB 4ZRPA 3N1ZC 2C9OA 4BFRA 1FXTB 3HD3A 3U6LA 3AE2B 2KZSA 3BVGA 2R45A 1KRHA 1FIQA 3KKUA 4WW0A 4DR5M 2IZVB 2DZOB 1M4VA 2KK8A 2KWDA 3H1UA 3PHXB 4LF8M 3B0AA 2JA2A 5EXXA 4KKIA 1JB0F 1QKZA 3RYTA 4AJYB 4LJ6A 4M8MA 1F2AA 4BQVA 2GBKA 3TL5A 2MP2A 3IFUA 2HXZA 2R62A 2K1FA 1D5XC 5LLIA 3ZJTA 2DCCA 3CBJA 2DAIA 4JIOU 4C4VB 4KZ0A 1WWTA 3R66C 4AP4C 1E7PB 4MGZE 2DC9A 1HTOA 3GB1A 3N3GA 4KGSA 2NQGA 3GLHA 3CH3X 5A24A 1E32A 2D3GA 1KJTA 2C5RA 1Q39A 2WX1A 4L4UA 3LB8C 4K81A 1DOYA 2LBCA 2DAGA 3ZJUA 3MC8A 1GOZA 1PPNA 3A4SC 4IIWA 4DV3M 4S17A 2LJIA 2O6VD 4LJOB 3OF9A 4LJ7A 2ZTDA 5GMVA 3FUWA 2KQ4X 1TGUA 2GLSA 4IBJA 4WJNA 2XN9C 2N1WA 4OU7A 2AS8A 2O5RA 1FO4A 1PGXA 2DWQA 3AE4B 4FJVB 1UKFA 1R6BX 3PHWB 2QSDA 2N7EA 1F9JA 2KWCA 1XWIA 2X49A 2O25A 3ZRCA 5LXHA 3IV2A 3KOXE 2XLJA 5EGWA 1FNVA 2PPHA 2UU7A 2ZVOA 3IT6B 3LXSA 3QC8B 5A2QS 2FCSA 2BYVE 2Z4SA 3Q8BA 1DO0A 1UM8A 1U9QX 3QA8A 2VQEM 3V6CB 4AXLA 2L2DA 4LDTD 3WXGA 4ANRA 3EA6A 1E7VA 2ICIA 2JRHA 2DCDA 4JI7M 1WX9A 4EE2A 2YR0A 3VFKA 2D7EA 4UDUC 1V2YA 3H4JA 1P7EA 4ANXA 3WXFA 1OTRA 4ZRKA 4B3MM 4JL9A 4GMQA 1I4GA 3MMPA 2DZLA 4GDKA 2P0RA 3L08A 4BOZB 3A42A 1KSFX 2KDIA 3P2BA 3C0RA 3BPMA 3KP0E 2M19A 4DR1M 1T6OA 2R6FA 5H92C 1AYWA 1BXTA 1JWUD 2FUG1 2UXBM 2WXKA 3U6DA 2RR9A 4M0WB 4QNMA 4GHLA 1GNUA 3AEDB 3C3DA 2REXA 2GQFA 4L16A 2WXPA 4N58A 3N3KA 4W5CA 2CJOA 4TQ0A 4HEA1 3D8BA 1YE9A 3HHAA 1KXRA 1YQ3B 4UN2B 4R7GA 1UFZA 2J7QA 4G54A 2JT4B 3VXWA 2RGHA 2WHIA 2FCQA 3AE1B 4WQOB 3U52E 2KVZA 3H7SA 4KKJA 2N7JA 3BVZA 3VFDA 2KJRA 1XD3B 1HE8A 2LHDA 1J19A 2YJCA 2INPE 3ZRFA 5D2MB 1CPJA 1NV8A 4YVAA 4DV6M 5J18A 3IMAA 2DHRA 4BOPA 3V62A 4ANVA 2K9DA 3W68A 2MBEA 3S3RA 3ZDMC 3IXSA 8CATA 3PREA 1XKGA 2R18A 4A3PA 3DHIC 1C79A 1FNUA 1E8ZA 5FTMA 1MG8A 2YVCA 4A90A 4KT0F 2JZZA 2LRWA 2IY1B 2MJDA 4IM0A 3IUTA 1WJ6A 2HWJA 3BC3A 4FADA 2QP9X 4EZLA 3P42A 4IBGA 2Q2EB 1JWMD 3SR6A 4PS3A 2MEKA 1XNQM 4D8IA 2BB6A 4YTMB 4MT5A 3UJNA 4GRIA 3URYA 2SEBD 2MX2A 1ZIVA 5EP3A 2DZYA 3B08A 5F3WA 3AEAB 1QQWA 4IUMB 4GIPA 1OQRA 2BTWB 4DR2M 5DYIA 4YXDB 4C7ZA 1BGOA 3ONSA 4JN6A 2AQ3B 4JI3M 2CWBA 2ZPNA 4NQKE 1KFVA 2LZ6A 1I4WA 4G3XB 5KHOA 5HFYA 1GJZA 5IOIA 2FFJA 3AU5A 1JRUA 3K24A 4ZHOA 1X9YA 3GLGE 2G1EA 2WDRB 4X6IA 2JY6B 1SIFA 2KX3A 4P1CC 1ZCMA 2WXOA 3PHWA 3NVWA 4BZAA 1RFKA 3HRDD 2D07B 1ME3A 2KLCA 1DGBA 3EFUA 3CGWA 1WMHA 3R8FA 1WFYA 1U5IA 1DYQA 1I35A 2ON8A 4HLQA 3IOQA 2LVAA 1C77A 2XNAC 3HHZA 1WGLA 4XZXA 4JI8M 2KT7A 2XEPA 3QHTA 2N9PC 4NAWA 1IN5A 5HKHA 3QSDA 1T0YA 1YSYA 3H89A 1IXSB 1QF6A 1ZKHA 1WGDA 3BOWA 3MTNA 4MSQB 4LFCM 4WIPA 4X65M 4AKHA 3U6QA 1GVNA 2CP8A 4QH6A 4BKTA 5DYGA 2A5UA 2RPVA 1YNTE 5FTLA 4LNFA 1Q6KA 2WXIA 3R7QA 3UZUA 4LLGM 2LTUA 4XGIA 3TQSA 1G8PA 3T38A 2HHHM 3AL0C 2GOWA 1XHBA 3ZCBB 1XNRM 3A9KA 3GZNI 2ONQA 4WWPA 1G6JA 4TV3A 4A9AA 4YYVA 1F0ZA 1RLFA 2KJHB 3ZW3A 3V6EA 2K39A 3NWLA 3VR9B 1I4XA 1TS3A 2LGIA 1FEHA 2HJ8A 2BYFA 1PQSA 1SXTA 1CJEA 4LJPB 4Q2JA 4RM9A 2MBOA 1FCLA 3R2TA 3NG0A 2J0KA 1T0SC 1EM7A 3RZWC 2ZAMA 3U30A 2FCMA 1CMXB 2UYZB 1RFAA 2KN4A 2C60A 2L52A 1NDDA 4WWMA 1OEYJ 4I6LB 1V1PB 1C3TA 1J7AA 2LFIA 3GRRA 1CS8A 1IM2A 2QENA 2YJ8A 1VZ6A 5GXGB 2CV0A 2OJWA 1K53A 2NMQA 2YLMA 3GPUA 2E3TA 2AYOA 1WGKA 1FNWA 2DENA 2V3NA 2OO9A 2FO5A 3IG8A 2MJ3A 3KS4A 4LNOA 4NXNM 4K3BA 4MJSB 2L05A 2BQQA 2UUAM 1F2BA 2Z7JA 4HDOA 2AIMA 4YYWA 4DMXA 3GLGB 4RFBA 4G50A 2QIEB 1KF6B 1S3SA 3UGBB 5JI2E 3L13A 1E9RA 3TWMA 2D10A 2K5PA 4NPNA 3TJPA 2K6DB 2BBCA 3DCGA 3I3TB 1XCQL 4PP1A 1ZV1A 1HNWM 2Z8LA 4G11A 3CWIA 3ZNHB 1E0ZA 3FD9A 3IG5A 1YN3A 4YTNB 3DFZA 3GLHE 2ZAOA 1YUBA 5FK9C 1PIPA 4YYUA 2LVNC 4TKNA 3H7PA 4OELA 1F52A 2FIDA 2DC6A 4Q8HA 1V49A 4DBGB 1YX5B 3UIPB 1VJVA 3JAMS 1XMOM 2QCZA 2N7DA 3N4CA 2BU3A 4R3DA 5D3DA 1E8YA 2GBJA 1GLNA 1NNJA 1GUAB 2EKKA 4MB7A 2G7YA 2BDLA 3MC0B 3I4YA 1NV9A 1PYWD 2KFJA 1QOGA 2NBVB 5J17A 2EELA 1WRDB 1J09A 1WF9A 3HJQA 2GB1A 2JWSA 1PJQA 5BMIA 3C3EA 3K2LA 1Q5WB 2PADA 3FE3A 4PK1A 2D7HA 3VTVA 2K0PA 2NS5A 3W9CB 5IN7A 2O6XA 3O0UA 4D8BA 1FNNA 1KFYB 3QQ8B 3TCAA 3IAM1 4NL4H 1XXGA 4ZRIA 3OJ4B 3NHEA 1TH4A 2FBWB 4IM3A 3FKEA 1FMAD 3RVWA 3KWVA 3W0LB 3A9JB 1MDWA 3UIOB 4K7CA 4LNKA 3NBIA 4ZTBA 4GUAA 2I1KA 5E26A 1TGZB 2JRIB 2KC1A 4EUTA 4LZJA 1ZOYB 2CHWA 4X57B 2EJSA 1R4NI 1YMHE 4W9HA 5JZEB 4P6EA 2L00B 1XXHB 2LUMA 1AU2A 3HWNA 4M9ZA 4TQ1A 2LGDA 4GEWA 1CK1A 3UMMA 3HHIA 2BF8B 4B0MA 3PNYA 3PO0A 1QAOA 4MEMA 2R4EA 1SXJD 2INNE 1I4QA 1R2YA 4WP2A 4WJOA 5IREB 4WQMA 1YQBA 3KS8A 1NENB 2OOBA 3ZQ4A 3A4RA 2QQ8A 1TH2A 5FTJA 2R65A 1WM3A 4M02A 2X8AA 1NNUC 1HEZE 1J5EM 2CU3A 2N9LA 1SGHA 1E10A 1MX0A 3OJ3A 2Z0DB 3P5WA 2UUCM 2HD5B 1AYUA 3NVZA 4BOUA 3Q3NC 3HHXA 4EEWA 3FILA 3FYDA 2LD9A 3N9YC 1TIFA 1RU3A 3M99A 3L17A 2M5ZA 3W31A 1JR3A 1JWSD 5CVNB 4CISA 2V1CA 4DUZM 1G71A 3PLVA 3U6EA 5PADA 4PDGA 3VHTC 1L0VB 4D80A 2VH2A 1ICFA 1TTNA 1K3BB 1IN4A 4MGIE 3NVVA 3M6AA 3WAOA 2BYEA 4AWJA 1GCBA 1TTEA 4HROA 2FCNA 3GLHB 1T6BX 3W5UB 3BY4B 3RD2A 1N33M 5G55A 2KDEB 1ZMUA 1SE4A 2DJFB 4LK0M 4AZFA 4BOSC 4IBEA 3MFGA 4GB9A 3TEZA 3TRKA 4E3CA 2KNVA 2FRAA 4W9JA 5ITTA 5EP1A 2L7RA 3B89A 4X66M 5CHTA 3GP1A 3RCZA 5KHQA 2WDTB 4S0RA 5BYSA 4B3TM 3OG5A 1O0EA 4XWWA 4QOSA 2KHHA 3BB7A 3KDSE 2M56B 2W3SA 3FC4A 4HPPA 1V6EA 4DR7M 5LXIB 2DZJA 3UINB 3VUXA 2YEPB 3ML9A 4PCZA 1WJUA 1JRPA 2CV1A 2JSVX 4HKZE 3QX1A 4CYEA 4L8RC 4ITQA 5G5HA 3C9EA 4JXJA 1YZBA 5AEKB 1XLNA 1AU0A 2O01F 2DC8A 3CF2A 3TEXA 4KSLC 2WXLA 3ENEA 3PSEA 1LV7A 1QYRA 5ITYA 3AE6B 1CTEA 1K50A 4LNNA 5CHWA 1JCKB 2R9CA 2XSZD 2IJ0A 4LDTB 1XT9B 3ZVVA 2PKOA 3AH7A 2M8SA 3JW0X 1V97A 2UXCM 4GDKB 1ACCA 1CVZA 2KQ7A 2XU5A 2KJ6A 2B76B 1TJEA 4MM3A 1XQQA 2DWZB 2R4JA 3Q8GA 1N32M 3ZNZB 2JQRB 3DBRI 4PI3A 3U60A 3PS6A 4NSOB 1L2BA 3FUUA 1Z5SB 3SMSA 4REZA 2ASQA 2WSEF 2AHMA 2RRUA 1VEJA 4FWGA 4KO8A 2PE6B 2F5SA 3Q8CA 4WWNA 3KWZA 3N3KB 2C7HA 3KYDD 2BS3B 2BWES 1HXYD 4IM2A 1UZXB 2JX5A 4DV5M 5D6JB 3AE7B 1U9WA 1GABA 1X37A 3A9JA 3J9CA 2NTTA 3R9XB 3K1JA 1WZ3A 3AB5A 4MZSA 3ECIA 1N5XA 2RKOA 2I7NA 4FHKA 3I63C 4BLCA 4YL8A 2B3AA 2K25A 1XXHA 3U5ZB 2Z4RA 2JQFR 4HPMB 4C7YA 4WJQA 3VRBB 2QSFX 2K9XA 2KXJA 2N4FA 2X8XX 4NJ6A 1E90A 3H8HA 1F2RI 3C9PA 4N6EB 2LHEA 4WH4A 1TLOA 1Z59A 1D0MA 3PXGA 2LI5A 4KSKC 2DLBA 4KIKA 3Q3OC 4DV7M 1YT7A 2QC8A 2QEJC 1PJSA 4IBKA 2LVPC 4PT5A 3Q3JA 2L6OA 3WALA 2KNBA 2WXNA 1PGYA 3ZKJC 1KM7A 4A5UA 1TKYA 1MHWA 3RGSA 3KH0A 3KFQA 2KDFB 3IHPC 3Q14C 3UF8A 2KDLA 1OFHA 3I57A 3BWUD 1TBEA 3J7AS 1MHXA 5C1BA 1OGWA 4PYZA 2BTEA 3JSVB 1PDXA 3L2AA 3M95A 1TDZA 3VK7A 1ZGUB 1NHWC 1XO3A 4LGYA 2RSUA 4L23A 2Y3AA 4FCWA 5FLXS 1A5TA 3DOWA 1N6ZA 4CQNA 4KDLB 5LMUM 1HJPA 2FTDA 2MJ5B 4N8WA 1DGHB 2OPFA 2QBYB 2LNHC 2DBYA 2KMMA 1EWPA 1IUEA 2R46A 4LJ4A 3GP7A 4G4QA 4XC2A 2N9KA 3CMMB 1CJLA 3ILKA 2ERCA 3F92A 4FBJB 1OQYA 2KHWB 3BY4A 2K6BA 2OP3A 1HA5A 3AN1A 4A20A 4LJ9A 4KHPM 5JA7A 2MBQA 3IECA 2R9OA 1YX6B 4CDEB 4ZYSA 3A98B 1WXVA 1POPA 1WR1A 1E8WA 5CHVC 3R2IA 1NVID 2JZ0A 1WR6E 2CU1A 3QAQA 4N4ZA 2R44A 4LFBM 2XH9A 3KOWE 1I4PA 3ZXRA 4MZOA 4S12A 1SE9A 4HVBA 2J0MA 3AE8B 1HTQA 3NUHB 2L8JA 2CS4A 2O6VA 5GKNA 4URKA 4US9A 3K9PA 4KLBA 2LEKA 3MJWA 1WMHB 2Z8YM 3NOBA 1YK8A 1HZ5A 3SAVA 3QT4A 2XU3A 1LXDA 2M0AA 4OEMA 4L1BA 4YSXB 9PAPA 4MI7A 1NI3A 4G4OA 5DPRA 1VDLA 1C76A 1A6RA 4NAWB 3SEBA 3VQIA 4DV2M 1BT0A 1L2DA 4JWUC 5C18A 3FTDA 2JQGR 3MTNB 2V6ZM 4FN2A 4GDLB 3PW3A 4B9KA 2FNJB 4M0DA 3VLFB 3GLFB 2DHZA 4IWQA 4W9FA 4ACFA 1M6DA 3PRMA 2KAJA 5CVMA 2QDFA 4M8NA 2NQ8C 3GLIA 3DQVA 1HQYE 3U4EG 1FXAA 2LXAA 1S3SG 2JTCA 4NNJB 3KYCD 1Q3CA 2DAJA 1Z6TA 4MSXA 1N5WA 1N78A 4BKGA 1NPZA 1WGGA 1OKSA 2DAMA 4JV5M 4XBOA 3A9KB 3I06A 2N0SB 3QAUA 3AV0A 3UI3A 4JYAM 5D7GA 1EE8A 1JQJC 2DYBA 1IP9A 3ZUNA 3U7ZA 3V6EB 3T9LA 2QILA 2OQ4A 1DF0A 2KTRA 3LQRA 3PLUA 1EU4A 4M9XA 5IAAC 3HVZA 3OVXA 1BQIA 3RFWA 1WGYA 5KPRA 2NBWB 4RF0A 2VQFM 1N36M 1SNKA 2NCNA 2OEDA 4LF6M 2D5GA 2MBBB 3E56A 4OZAA 4P6VF 5G2NA 3U5ZA 2MLBA 1WJNA 3BYYB 1E94E 4LG2A 1Z2MA 4KZCA 3U61B 2C7NB 3SC3A 1I7HA 4YSYB 2CHXA 5H8YE 3UQAA 3L28A 4DHJD 4K7SA 1GKIA 2AYOB 2KOXA 1FM0D 3J7BA 2DC7A 2DENB 4FJCA 1ZQ9A 3U6CA 2L7IA 4AXMA 2FE8A 2VDBB 4G3OA 4YV8A 1C7YA 1R4MI 2Q5WD 2VF7A 3JVZX 1GL7A 1EU3A 4WURA 4FULA 4OW0A 1JR3E 4GKJM 2QMTA 3P4SB 3M62B 4AUQC 5F02A 4IBDA 1U9VA 3AOEA 2G4SA 4ZUXU 1ATKA 1T3QA 3NZUA 2P5TA 2W9NA 3JSVA 5JHAA 2DAFA 3OAWA 4W9DA 1QANA 3ZTCA 3S3QA 5IT9S 2WXQA 3TNXA 3B9PA 3DWGC 3EHVA 4FCTA 3TL4X 5KQDA 3GPXA 2GMIC 3HHWA 1Z5AA 3J2PB 1PJIA 2F5PA 2MJEA 1DGHA 2LH0A 2QBYA 1VR9A 2KC2A 3H7PB 3DZDA 1QVRA 1TDHA 1K3XA 5EE9A 3KQ4A 2P7UA 3LQQA 3RN9C 2PIAA 4NRVA 4IKGA 3H4MA 3RNEC 3BPFA 2KO3A 1WY8A 2FT2A 1P3QU 2DOSA 1AIPC 3SD5A 4CDCB 2G8EA 1AW7A 3U8EA 4QRXA 2ZTCA 3W5VB 3W67A 3MTVA 3NS8A 4RGMA 1PJJA 1JW9D 3KWBX 3O1GA 5T8IA 1WIVA 3A45A 2D3CA 4GC9A 1Q1OA 1N60A 4NJCA 5BYQA 3ZYYX 4HLEA 5DPWA 3AE9B 4WJPA 3DBLI 3BINA 4YYRA 7CATA 1RRBA 2EMTA 2G45B 3CF6E 3WAPA 2EMSA 2JF5A 2IY0B 2KZRA 3K9MA 3PNVA 1KLVA 3NHEB 1YQ4B 2C7MB 2MROB 3WAMA 4II7A 4ITKA 3A46A 5ITRA 3BWKA 1LGRA 2JZ1A 2DYOA 1WXMA 2WDQB 2JUOA 4BBNF 5L83A 3HGIA 4CO7A 2J7QC 1QDRA 2DX5B 4B7HA 1VZ8A 3DPDA 2WU2B 4ZRJA 1JQ4A 1T5XD 4GDLA 3GLFA 2J53A 6PADA 4FJYA 2GBNA 4EFOA 4F7ZA 3RNGC 1Y4HA 3SFZA 1B1ZA 3FUVA 1WX8A 3I4VA 4HCPB 2BYTA 2OOBB 2VZKD 3AKZA 1L0YB 1L6UA 3A1QA 1QZMA 2CRUA 3E4RA 3B2FA 5EJCA 2G8JA 3HKPA 4LJ8A 4BAXA 1SXJB 4IBCA 4P16A 3AE3B 3DVNV 1HT1E 4OVVA 4CDFB 1WYWB 4Q8GA 3FILB 1SJED 3OF8A 2LVQD 2JP7A 4A55A 1EWMA 3GRYA 4PDIA 3L10B 3BK1A 3RNBC 3GZNB 2KD0A 5KPZA 4DXGA 2DXIA 2PJHA 4KODA 5AZGA 3WA0A 2DJGB 2FUDA 1PVJA 3TBLD 5AZFA 3RT3B 1J7CA 3TIXA 3PPAA 1OQQA 1XXHE 5J2RA 2EUCA 5AUIA 2CE7A 4D8EA 4GOCA 4LY6A 1HT2E 2CFOA 2R0IA 3VVWB 4RY2A 4LF4M 2H1RA 3U8ZA 3CF0A 2Z0EB 2J42A 3PZ7A 3AFHA 1E8XA 1RM6C 3U61A 3P4QB 4F8CB 3HK0A 2L32A 2K6QA 3Q8AA 1M94A 4LRSA 5HHDG 1P3QQ 3HY5A 5EXTA 4BVUC 1R5LA 4LCDE 2JPHA 5IKCM 5EE3A 1AU4A 4JWSC 1JWBD 4QOZC 3SFDB 1P0RA 2L7HA 4PP2E 7PCKA 3FTFA 2ZCBA 5JH3A 1HQCA 3LVVA 4QBBA 3I51A 1QDTA 2KQSA 2ZZPB 4LJ5A 2C9CA 1ENFA 2HJ1A 2LXCA 4I07A 2F5NA 1WYGA 4I04A 2MRPA 4JI1M 3AI5A 1JMLA 4W5WA 1GC7A 3W1SA 1AIMA 1Q0WB 2IGDA 2JYEA 2Y6EA 3KVFB 2OJRA 2IBIB 2BS4B 3MHHA 1DGJA 2HHNA 3AEEB 2XBBC 3PRPA 3S2AA 1L8QA 4FK5A 1PBHA 3AM9A 3PSEB 1TYGB 1WGHA 3ZNGC 4HCNB 1QOFA 3VRAB 2LVOA 1F2CA 1GL6A 5E6JA 4DXAB 2EKEC 3U6SA 4TMAB 4W9KA 2CEAA 1VEGA 4JI2M 2RGOA 1CQVA 4A6QA 4LFAM 2D3AA 3ZNID 4MM3B 3IEJA 4QAYA 3GRVA 2WXJA 3FTCA 5E6PA 1D3ZA 3U60B 3KFUG 2ZCCA 1MS6A 4I6PA 3B2GA 3BBZA 5JI3E 3EFCA 1EUVB 4KX6B 2DI0A 1NHGC 2IPKD 1H6UA 2WNMA 2RDHA 3APFA 4NAMA 2MCNB 4EOYA 2KXEA 3AEBB 1FPYA 4IP3A 3AU4A 1F29A 3PBHA 1YJJA 5KPTA 3U6MA 3Q69A 1EF5A 1OJLA 4BS5A 2XZFA 3RZFA 2M4NA 1FXIA 1WIAA 1VD2A 2OOAA 3BXWA 2F5OA 3A33B 1YIWA 2LJ5A 1PXVA 4L78A 2GHUA 5DPSA 1IFYA 4FLHA 1NB5A 1AU3A 1QOAA 2OZ2A 2L0TA 4IG7B 2LGYA 3PTFC 1A70A 3MK6A 1EF7A 3GLIE 1NJFA 2DWLA 2FUHB 3AEGB 1A5RA 3ZQJA 1Z5BA 3P5UA 3ZO5B 3NS1A 1R4NB 3HJSA 3NY5A 5ITXA 3B74A 1AARA 1FH0A 1V5TA 1MIRA 2IDYA 5IA7A 2I2YA 4GC5A 4KIKB 2M1MA 1XEEA 1HQRD 3M3JA 3Q6BA 4DV0M 4GHAA 1NJGA 3K8UA 3D32A 1WGRA 3PDFA 2E03A 1Q3BA 1K51A 3AV8A 3L16A 4E71A 5KQ8A 1SIJA 4HK2A 3KW9A 1KFUL 2C96A 2ACTA 2C99A 4O1NA 3J81S 1SXJA 1OAIA 1EO6A 3GRUA 5LNK1 1V5OA 4IWPA 1SBBB 1IBXA 1FD6A 2FAZA 3BIID 1H8CA 1V1OA 2DCAA 3PVSA 3GE8C 2XFSA 1V80A 5TSSA 3NZ3A 1C1YB 1QLBB 4W9EA 3I04M 3RVVA 5EQTA 3SDLC 3PFIA 1ROEA 2JXNA 2LRUA 1OAOC 2KWVB 2WXRA 1SE3A 1V81A 3IVFA 2J7NA 1ESFA 2PMVA 2R2OA 1WM2A 1NLJA 4DXFA 4WAAA 2ATOA 4I8OA 4HWYA 1L0XB 4KLNA 3NZSA 1GECE 1AYFA 4OX9M 3MJ5A 1YN4A 1IXZA 3GPYA 4ARIA 1SSNA 4YYQA 4KGTA 1EWYC 1DV0A 2BDZA 2JVCA 1VJKA 2AEHA 2DAKA 3VKGA 4CHKA 2FIFA 3KOZE 1WR1B 3C8YA 2H7JA 3Q8FA 4DHZB 3PNRA 4CIZA 2ZJDA 4K0KM 3DVGX 3WCQA 2C9WB 1IGCA 1GAQB 2BKRB 5DPTA 3SFEB 3Q2AC 2O6VB 3LCVB 4NQLB 1D6EC 3SAWA 3EC8A 2KRUA 4FVMA 3IT4B 3K9PB 3PGEA 4B6WA 1JALA 1ZP0B 2LWXA 1G3IA 1NYQA 1XLOA 3B7NA 1PPOA 1YK7A 2EA0A 4TUWA 4WWOA 4FA6A 2PW9A 3U7DA 4XK8F 3KSEA 4USAA 2IBIA 2IGGA 3H8CA 4ZDVA 2KX0A 4GXBA 4A3OA 4JI5M 2ZPYA 4JI0M 2ZW1A 4I4LA 4IJFA 1SB3C 3B1LX 1C4PA 2MWSB 3SYKA 1EF1A 3KWLA 1MEGA 4CJ6A 2V1UA 2L1AA 1ZMVA 3HWSA 1E7UA 4OVZB 2VH1A 3PRMB 1K52A 2CJNA 2WLBA 2D2QA 4Z8XA 3GLIB 1GMYA 1ZPSA 2EO2A 1NVMA 2CR5A 3AJIB 4IW0A 2D7GA 1L1TA 1TL9A 1KLUD 3GQ3A 1QUTA 2XSZA 4FCVA 5EXPA 2R61A 1J0GA 1T43A 4IBIA 2FYEA 4CDDB 2CV2A 2H88B 1IY0A 4GITA 3Q8EA 4GGQA 4KVGB 4E74A 3VH4B 3W1YA 2XFTA 4MGKE 4LF5M 2DNFA 3M63B 1WXQA 2KVRA 3DBRB 1IBKM 1TS5A 3WANA 3ZH9B 4NY0A 3GCBA 3WIMA 2KRKA 3SAUA 3RGPA 3BCNA 1IN7A 2KTRB 5K16A 4US8A 3I5JC 2XU4A 5ITQA 1VDDA 5JH5C 1TY0A 2DAEA 4KV2A 2NQAA 1L4ZB 1PM5A 2K3UA 4CGYB 4NRWA 2H5XA 2KN5A 2V4LA
chains in the Genus database with same CATH topology
4FWDA 4FD2A 2DVWB 1P7FA 1TH3A 5HI1A 4HJGE 1XC8A 1D4BA 1QOBA 4DV4M 3HUIA 1GB1A 1BUIC 3L27A 4AG5A 2BS2B 4X64M 3DOAA 4DR6M 1DGGA 1PFDA 2RDGA 2FNAA 4IBBA 4B08A 1VLBA 2W3RA 2QZ4A 3EGRA 4IDIA 2Y21A 1ZXHA 4C56C 2QJLA 2KZUA 5FSWA 3U6OA 3CTWB 4N59A 2BJWA 5KO3A 3M7GA 1FRRA 4D82A 2WP9B 4LCBA 4M9SA 1NYRA 3T1YM 4Z6YA 4RGNA 4YHHM 3Q8XA 3L25A 1E6EB 2OHFA 3GPPA 5EE0A 3M0EA 1E9MA 3TMPA 4NXMM 2HTME 2WXGA 1TY2A 3EIHA 4YT0B 2CHGA 2JU6X 2KW0A 3ETRA 4RCOA 4JX1C 3TE6A 4IOIE 4G4NA 3U6PA 3TWLA 4J3OD 2Y0TA 3AE5B 1IN8A 1UWXA 4OHJA 2ZBKB 4D2KA 3EUB2 3BOSA 3LMMA 4AI6A 5EZQA 3GQ4A 3V05A 1NY6A 2K22A 4HRSA 2AGAA 3EIEA 2UUBM 3W0FA 3VDUA 3UGJA 4OVZA 3FTEA 3AECB 1QT9A 1SJHD 3R8BA 3DWMA 4QNRA 1UNSA 3SHFA 3K92A 4MGHA 1UGJA 2WXHA 3PT2A 2AQ1B 2BT6A 2SAKA 2CHVA 1JWAD 4BB9A 4YWGG 5G5GA 2VZKB 2TSSA 3T3NA 2UU9M 1TZOA 1TS2A 5H37D 3JR4A 1EWCA 3K8ZA 1FJGM 4PD2A 2XF3A 4YTPB 2V0GA 1KTKA 1MVKA 3V3XA 4MGYE 2ACZB 3LVWA 1XLPA 3UK6A 5MPOA 3AOGA 5ITXE 1IGDA 3BBAA 2CHQA 4I5SA 2Y0QA 2BJVA 3HHYA 3GO8A 2W55A 2DWNA 3SASA 5FTNA 2DWMA 1Y56A 1D2NA 2PTLA 1SXJE 4HKQA 1ZXIA 4DQOC 2RMMA 3OTOM 1RYJA 4TSSA 2YFQA 3SYLA 4OZCA 4JI6M 4IBFA 1WRIA 3ZJVA 1G59A 1SF0A 4ARCA 4NOOB 4CHTB 1PGBA 4QHTA 5EP4A 1C1KA 1DGFA 1IQPA 2K47A 3E9SA 2WXMA 4RNAA 1ZE3D 5BMHA 2KEBA 4JPSA 2DZNB 3HJ8A 4JI4M 2DYMA 2F4VM 1ET6A 2XGNA 5BMGA 3P1MA 2WDVB 1J7BA 3PHXA 2VIIA 4AQ7A 2WS3B 1QILA 5HG2A 3RPFC 3AEFB 4ZPXA 4EIWA 4GLSC 3B9JA 1I4HA 4L15A 3ZC7B 5EZSA 4RGOS 5BR8M 4LGMA 1C4AA 3GS2A 3HVDA 3SHGB 2Z84A 1XMQM 5FKAC 2I7PA 1GPXA 4AW4A 4FXCA 1NSFA 1N62A 2WU5B 1UWMA 1MU5A 2F5QA 1YN5A 4AKGA 2G5GX 1XF5L 2AQ2B 1N75A 1KH0A 4DR3M 5FTKA 3MP9A 1C9FA 4KGRA 1XLQA 4I81A 1KLGD 1VZ7A 3OWEB 2J52A 1F2RC 2KA6B 2IGHA 3U2SC 4DR4M 1IBXB 1D5ZC 1HR0M 1AN8A 4HXDB 3TSSA 3NRZA 2G8LA 3DA1A 3LXFA 4AKIA 1I94M 1TS4A 4BOZA 4A3VB 2WQYB 1IY1A 2XZUA 3AOEC 2EKIA 2GI9A 4JE3B 2BB5A 1JROA 2YQZA 2ZW0A 1N34M 2UZJA 1HNXM 3LYYA 3KSJA 5JXVA 4M0WA 3WHLA 1R2ZA 2ZANA 4LJAA 4A8XC 1LO5D 1I4RA 4B0EA 1L4DB 4YY3M 5EE1A 2HCBA 2Z3XA 1CZPA 1GB4A 3FUXA 1L5PA 1UUPA 1L6VA 4XDDA 5C3JB 2L83A 5I4DA 1L1ZA 1D5MC 3T15A 1ZDVA 3NVYA 2V4IB 1J7KA 3SBJA 5EXSA 1OFFA 4GKKM 2J7OA 1B9RA 5C2TB 2E6XA 3O13A 1HNZM 4IJEA 3TPZA 3SATA 5EP2A 4NZLB 4LF9M 3FAHA 2J4XA 4B7FA 1PUTA 3KP1E 3J27B 3KOYE 1N63A 2QCUA 5IWAM 3J80S 5FR3A 1G4AE 4ZHPA 3BYTB 1F77A 4BBAA 4IUMA 2MH7A 1C78A 2JYTA 2BTWA 2LXEA 3P4PB 4BOSA 5BPVA 1V8CA 1YJIA 1DO2A 1AWDA 3QWLA 2KACA 1E9SA 1PGAA 2G9HD 3JR5A 2KDMA 1Z5CA 4ZOHC 1FFVA 3C58A 3VKHA 1DOIA 4LF7M 2V3PA 4G6ZA 1G41A 3TWKA 3PHUA 4B3RM 1OFIA 4XWTA 3AMZA 2W82A 1ZAEA 1KYIA 2Y20A 3D8LA 4OZBA 1BMLC 3L29A 1C4CA 4B7GA 2PVGC 4RH6A 4NSRA 4HL4A 3KVWA 1IBMM 2GRIA 3L4PA 2HL7A 1IY2A 2C98A 1STEA 1QQRA 4LZZA 2YEPF 2X4AA 3SARA 2HDEA 1DOXA 3HU1A 2H89B 2L09A 1JR3D 3MHZA 2I38A 2WXFA 2JXTA 3P63A 3TEYA 3TUOA 3W2DA 5ITUA 2BW2A 1FRDA 4G4RA 4D81A 3RNVA 1ORYB 4RKXA 4GH9A 4AS1A 4L2YA 4C80A 1R7SA 1SE2A 3W30A 4MH0E 1L2CA 5D3IB 3KSXA 1MI0A 1V1PA 3THGA 3WHKA 3L26A 2M60A 1MHHE 2UXDM 1XCTL 3KLSX 3O65A 1NY5A 3HU3A 1MPEA 2ZM6M 1T3TA 3BZDB 4RF1A 4AG6A 3ZGZA 1FCCC 4RGTA 1R7RA 5AUKA 2HKJA 4LRTA 1IBLM 3MHVC 4LTUA 4YSZB 3GLGA 4DUYM 1ET9A 3VR8B 3I9V1 2YNMD 2JWUA 1Q10A 4DV1M 3VK8A 3P4RB 2QPAA 3ZNHA 4FW9A 1NEKB 2AX5A 1VDVA 1DKIA 3VDPA 3PZ8A 5DNYA 1IXRC 1FFUA 3FYCA 1SXJC 1QAQA 1W5TA 3IAS1 2PVOD 4FWHA 3SMPA 5LMNM 2Y5CA 2W54A 4MH8A 4X62M 3CIRB 2HWKA 1TKEA 4AQYM 4XDCA 3GQ5A 1HZ6A 4ZRQA 1ZUD2 2FOIC 1N61A 2CUZA 4MACA 2X38A 3MP2A 4QHSA 4WAFA 2E5LM 1WSPA 3RFZB 1SEBD 1ZDXA 1RWSA 2LMCA 3T3OA 3FUTA 3KXEC 2NTSA 1K82A 3KW6A 3B21A 4H2AA 3RE8A 4B3SM 2JRIA 2Y5PA 1TKGA 5JZEA 1K3WA 3OQCA 1IN6A 5IZ7D 3TEWA 4BOQA 4XE0A 3T1HM 2JZPA 3HU2A 1W5SA 2PLPA 3BVMA 1N77A 1VRAB 5BYRA 3ABVB 1QAMA 2BNKA 3BK2A 2A5YB 4ZRPA 2C9OA 3U6LA 3AE2B 2KZSA 3BVGA 2R45A 1KRHA 1FIQA 4WW0A 4DR5M 2DZOB 1M4VA 2KWDA 4LF8M 2JA2A 5EXXA 4KKIA 1QKZA 4LJ6A 3IFUA 2R62A 1D5XC 3ZJTA 1WWTA 1E7PB 4MGZE 3GB1A 4KGSA 3GLHA 1E32A 2C5RA 1Q39A 4L4UA 3LB8C 1DOYA 3ZJUA 1GOZA 4IIWA 4DV3M 2LJIA 4LJ7A 3FUWA 2KQ4X 1TGUA 4IBJA 2XN9C 4OU7A 2O5RA 1FO4A 1PGXA 2DWQA 3AE4B 1UKFA 1R6BX 2QSDA 1XWIA 2X49A 3KOXE 2XLJA 1FNVA 3IT6B 5A2QS 2Z4SA 3Q8BA 1DO0A 1UM8A 2VQEM 3EA6A 2ICIA 4JI7M 4EE2A 2YR0A 2D7EA 4UDUC 1P7EA 4B3MM 4GMQA 1I4GA 3A42A 1KSFX 3C0RA 3KP0E 2M19A 4DR1M 5H92C 1BXTA 1JWUD 2FUG1 2UXBM 2WXKA 3U6DA 4QNMA 4GHLA 3AEDB 4N58A 4L16A 2WXPA 2CJOA 4TQ0A 4HEA1 3D8BA 1YE9A 1YQ3B 4R7GA 2J7QA 2RGHA 3AE1B 3U52E 4KKJA 2N7JA 3BVZA 3VFDA 2LHDA 2INPE 4DV6M 2DHRA 4BOPA 3IXSA 8CATA 2R18A 1C79A 1FNUA 5FTMA 4A90A 2MJDA 2QP9X 3P42A 4IBGA 2Q2EB 1JWMD 3SR6A 2MEKA 1XNQM 4D8IA 2BB6A 4YTMB 4MT5A 3UJNA 4GRIA 3URYA 2SEBD 5EP3A 5F3WA 3AEAB 1QQWA 4GIPA 1OQRA 2BTWB 4DR2M 5DYIA 4YXDB 4C7ZA 4JN6A 2AQ3B 4JI3M 1KFVA 1I4WA 5HFYA 2FFJA 4ZHOA 2G1EA 2WDRB 2WXOA 3PHWA 3NVWA 1RFKA 3HRDD 1DGBA 3R8FA 1DYQA 2ON8A 4HLQA 1C77A 2XNAC 3HHZA 4XZXA 4JI8M 2XEPA 1IN5A 1YSYA 1IXSB 1QF6A 4LFCM 4WIPA 4X65M 4AKHA 3U6QA 1GVNA 5DYGA 2RPVA 1YNTE 5FTLA 2WXIA 3UZUA 4LLGM 4XGIA 3TQSA 1G8PA 3T38A 2HHHM 3AL0C 1XHBA 3ZCBB 1XNRM 2ONQA 4A9AA 1F0ZA 3NWLA 3VR9B 1I4XA 1TS3A 2LGIA 1FEHA 1SXTA 4Q2JA 1CJEA 1FCLA 3R2TA 1EM7A 2ZAMA 2KN4A 2L52A 4WWMA 1V1PB 1J7AA 2LFIA 3GRRA 1IM2A 2QENA 1VZ6A 5GXGB 2CV0A 1K53A 2NMQA 3GPUA 2E3TA 1WGKA 1FNWA 2V3NA 3IG8A 2MJ3A 3KS4A 4NXNM 2UUAM 2Z7JA 3GLGB 4RFBA 2QIEB 1KF6B 1S3SA 5JI2E 1E9RA 3TWMA 2K5PA 2BBCA 1XCQL 1HNWM 2Z8LA 3CWIA 1E0ZA 3FD9A 3IG5A 1YN3A 4YTNB 3DFZA 2ZAOA 1YUBA 5FK9C 3JAMS 1XMOM 2BU3A 4R3DA 5D3DA 1GLNA 1NNJA 4MB7A 3MC0B 3I4YA 1PYWD 1QOGA 2EELA 1J09A 3HJQA 2GB1A 5BMIA 3K2LA 2D7HA 3W9CB 2K0PA 4D8BA 1FNNA 1KFYB 3IAM1 4NL4H 1XXGA 1TH4A 2FBWB 3FKEA 1FMAD 3KWVA 3W0LB 3NBIA 4ZTBA 4GUAA 5E26A 4LZJA 1ZOYB 1YMHE 1XXHB 2LUMA 4M9ZA 4TQ1A 1CK1A 3UMMA 4B0MA 3PNYA 3PO0A 1QAOA 2R4EA 1SXJD 2INNE 1I4QA 1R2YA 4WQMA 5IREB 3KS8A 1NENB 3ZQ4A 1TH2A 5FTJA 2R65A 2X8AA 1NNUC 1HEZE 1J5EM 2CU3A 2N9LA 1E10A 1MX0A 2UUCM 3NVZA 4BOUA 3HHXA 3FILA 3FYDA 3N9YC 2M5ZA 3W31A 1JR3A 1JWSD 4CISA 2V1CA 4DUZM 3U6EA 4PDGA 1L0VB 4D80A 1IN4A 4MGIE 3NVVA 3M6AA 4HROA 3GLHB 1T6BX 3W5UB 1N33M 1SE4A 4LK0M 4AZFA 4IBEA 3MFGA 3TEZA 3TRKA 5ITTA 5EP1A 4X66M 3GP1A 5BYSA 4B3TM 4XWWA 4QOSA 3BB7A 3KDSE 2M56B 2W3SA 3FC4A 4DR7M 2YEPB 4PCZA 1JRPA 2CV1A 2JSVX 4HKZE 4L8RC 4ITQA 5G5HA 4JXJA 1YZBA 1XLNA 3CF2A 3TEXA 2WXLA 3PSEA 1LV7A 1QYRA 5ITYA 3AE6B 1K50A 1JCKB 2XSZD 2IJ0A 2PKOA 3AH7A 1V97A 2UXCM 4GDKB 1ACCA 2B76B 1TJEA 2DWZB 2R4JA 1N32M 2JQRB 3U60A 4NSOB 1L2BA 3FUUA 3SMSA 4REZA 2AHMA 4FWGA 4KO8A 3Q8CA 2F5SA 2BS3B 1HXYD 2JX5A 4DV5M 3AE7B 1X37A 3J9CA 2NTTA 3R9XB 3K1JA 3AB5A 1N5XA 2RKOA 2I7NA 4BLCA 1XXHA 3U5ZB 2Z4RA 4C7YA 3VRBB 2K9XA 3H8HA 1F2RI 4N6EB 2LHEA 4WH4A 1Z59A 3PXGA 2DLBA 4DV7M 2QEJC 4IBKA 4PT5A 2L6OA 2WXNA 4A5UA 1TKYA 3RGSA 1OFHA 3I57A 3BWUD 3J7AS 1MHXA 5C1BA 2BTEA 1PDXA 3L2AA 1TDZA 3VK7A 1NHWC 1XO3A 4LGYA 4L23A 2Y3AA 4FCWA 5FLXS 4CQNA 5LMUM 1DGHB 2OPFA 2QBYB 2LNHC 2DBYA 2KMMA 1IUEA 2R46A 4LJ4A 3GP7A 4G4QA 2N9KA 3ILKA 2ERCA 3BY4A 3AN1A 1HA5A 4LJ9A 4KHPM 4ZYSA 3A98B 3R2IA 1NVID 4LFBM 2XH9A 3KOWE 1I4PA 4S12A 3AE8B 3NUHB 5GKNA 4US9A 2LEKA 1HZ5A 3SAVA 2M0AA 4L1BA 4YSXB 4MI7A 1NI3A 4G4OA 1C76A 4NAWB 3SEBA 3VQIA 4DV2M 1L2DA 4JWUC 5C18A 3FTDA 2V6ZM 4GDLB 4M0DA 3VLFB 3GLFB 3PRMA 2KAJA 2NQ8C 3GLIA 1HQYE 3U4EG 1FXAA 2JTCA 1Q3CA 1Z6TA 1N5WA 1N78A 4JV5M 4XBOA 2N0SB 3QAUA 3AV0A 3UI3A 4JYAM 5D7GA 1EE8A 1JQJC 3U7ZA 2QILA 2OQ4A 3LQRA 1EU4A 4M9XA 3HVZA 3RFWA 5KPRA 4RF0A 2VQFM 1N36M 2OEDA 4LF6M 2D5GA 3E56A 4OZAA 4P6VF 3U5ZA 3BYYB 1E94E 4LG2A 3U61B 3SC3A 1I7HA 4YSYB 5H8YE 3L28A 1GKIA 1FM0D 3J7BA 1ZQ9A 3U6CA 2L7IA 2FE8A 2Q5WD 1GL7A 1EU3A 4WURA 4OW0A 4GKJM 3P4SB 2QMTA 4IBDA 3AOEA 1T3QA 2P5TA 1QANA 5IT9S 2WXQA 3B9PA 3DWGC 4FCTA 3TL4X 5KQDA 3GPXA 3HHWA 1Z5AA 3J2PB 1PJIA 2F5PA 2MJEA 1DGHA 2LH0A 2QBYA 1VR9A 3DZDA 1QVRA 1TDHA 1K3XA 5EE9A 3KQ4A 3LQQA 2PIAA 4NRVA 4IKGA 3H4MA 2DOSA 1AW7A 3W5VB 3MTVA 4RGMA 1PJJA 1JW9D 5T8IA 3A45A 4GC9A 1N60A 4NJCA 5BYQA 3ZYYX 3AE9B 7CATA 3CF6E 3PNVA 1YQ4B 4II7A 4ITKA 3A46A 5ITRA 2DYOA 2WDQB 3HGIA 2J7QC 4B7HA 1VZ8A 1JQ4A 2WU2B 1T5XD 3GLFA 2J53A 3SFZA 1B1ZA 3FUVA 3I4VA 2BYTA 2VZKD 3AKZA 1L0YB 1L6UA 1QZMA 3E4RA 3B2FA 5EJCA 3HKPA 4LJ8A 1SXJB 4IBCA 4P16A 3AE3B 1HT1E 3FILB 1SJED 4A55A 3GRYA 4PDIA 3BK1A 5KPZA 4DXGA 2DXIA 4KODA 1PVJA 1J7CA 1OQQA 2EUCA 5AUIA 2CE7A 4D8EA 4LY6A 1HT2E 2CFOA 4LF4M 2H1RA 3CF0A 2J42A 3PZ7A 3AFHA 1RM6C 3U61A 3P4QB 2L32A 3Q8AA 4LRSA 5HHDG 5EXTA 5EE3A 4JWSC 1JWBD 4QOZC 3SFDB 2L7HA 3FTFA 1HQCA 3LVVA 3I51A 4LJ5A 2C9CA 1ENFA 2F5NA 1WYGA 4JI1M 1JMLA 4W5WA 3W1SA 2IGDA 2JYEA 2BS4B 1DGJA 3AEEB 3PRPA 1L8QA 3AM9A 1TYGB 1QOFA 3VRAB 1GL6A 5E6JA 3U6SA 4TMAB 2CEAA 4JI2M 2RGOA 1CQVA 4A6QA 4LFAM 4MM3B 3GRVA 2WXJA 3FTCA 3U60B 3KFUG 3B2GA 5JI3E 4KX6B 1NHGC 2IPKD 1H6UA 2WNMA 2RDHA 4NAMA 2KXEA 3AEBB 4IP3A 1YJJA 5KPTA 3U6MA 3Q69A 1OJLA 2XZFA 1FXIA 2F5OA 4L78A 1QOAA 1A70A 3MK6A 1NJFA 2DWLA 3AEGB 1Z5BA 3NS1A 3HJSA 5ITXA 2IDYA 2I2YA 4GC5A 1XEEA 1HQRD 4DV0M 4GHAA 1NJGA 1Q3BA 1K51A 3AV8A 5KQ8A 1SIJA 2C96A 2C99A 4O1NA 3J81S 1SXJA 5LNK1 3GRUA 1SBBB 1IBXA 1FD6A 3BIID 1V1OA 3PVSA 2XFSA 5TSSA 3NZ3A 1QLBB 5EQTA 3PFIA 1ROEA 2WXRA 1SE3A 2J7NA 1ESFA 2PMVA 4DXFA 4I8OA 1L0XB 4KLNA 1AYFA 4OX9M 3MJ5A 1YN4A 1IXZA 3GPYA 4ARIA 1SSNA 4KGTA 1EWYC 1VJKA 3VKGA 3KOZE 3C8YA 3Q8FA 4K0KM 3WCQA 1IGCA 1GAQB 3SFEB 1D6EC 3SAWA 2KRUA 4FVMA 3IT4B 1JALA 1ZP0B 2LWXA 1G3IA 1NYQA 1XLOA 2EA0A 4TUWA 2PW9A 4USAA 2IGGA 4JI5M 4JI0M 2ZW1A 4I4LA 4IJFA 1SB3C 1C4PA 3SYKA 3KWLA 2V1UA 2L1AA 3HWSA 4OVZB 1K52A 2CJNA 2WLBA 4Z8XA 3GLIB 1ZPSA 2EO2A 1NVMA 3AJIB 2D7GA 1L1TA 1KLUD 3GQ3A 2XSZA 4FCVA 5EXPA 2R61A 4IBIA 2CV2A 2H88B 1IY0A 4GITA 3Q8EA 2XFTA 4MGKE 4LF5M 1WXQA 1IBKM 1TS5A 3ZH9B 2KRKA 3SAUA 3RGPA 1IN7A 4US8A 5ITQA 1VDDA 1TY0A 1L4ZB 1PM5A 2K3UA 4CGYB 4NRWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MM3 B;  4REZ A;  4OVZ A;  3MP2 A;  4OVZ B;  3MJ5 A;  3E9S A;  4P16 A;  2FE8 A;  4RF0 A;  4M0W A;  4RNA A;  4WUR A;  4PT5 A;  5KO3 A;  4OW0 A;  4R3D A;  4RF1 A;  5E6J A; 
#chains in the Genus database with same CATH topology
 4FWD A;  2IND C;  4FD2 A;  2N35 A;  3GLF E;  2DVW B;  1P7F A;  2KFK A;  2DHY A;  2XEW A;  1QXP A;  4I05 A;  1TH3 A;  5HI1 A;  1CB5 A;  2CIO A;  4HJG E;  1XC8 A;  1UH6 A;  4LNI A;  1D4B A;  1QOB A;  3H8B A;  4DV4 M;  4AOF A;  3HUI A;  1D0L A;  1BUI C;  1GB1 A;  1QMY A;  3L27 A;  3NJT A;  4AG5 A;  3ZUA A;  2BS2 B;  4X64 M;  3DOA A;  4DR6 M;  3DBH I;  1DGG A;  1PFD A;  3H6S A;  2RDG A;  3DVG Y;  1Y8G A;  2QHO B;  2FNA A;  2WX0 A;  3DBH B;  1L2N A;  4ANU A;  2AL3 A;  3CH2 X;  4IBB A;  1KFX L;  4B08 A;  4BBN C;  4DHJ B;  1VLB A;  2J5Y A;  3ZLZ A;  2W3R A;  2Y5B B;  2QZ4 A;  2LGX A;  3HX3 A;  3EGR A;  4IDI A;  2Y21 A;  3JYU A;  1E5W A;  1ZXH A;  4C56 C;  4QRG A;  2QJL A;  2P86 A;  2KZU A;  5FSW A;  3U6O A;  4NJ7 A;  2PNS A;  3CTW B;  4N59 A;  1T0Q C;  2BJW A;  3V61 A;  3QJZ A;  5KO3 A;  3M7G A;  1FRR A;  2V1Y A;  4D82 A;  2AYN A;  3P5V A;  2DCB A;  4X6H A;  2WP9 B;  2KNA A;  4LCB A;  4M9S A;  1NYR A;  3T1Y M;  4Z6Y A;  2FH0 A;  2YJ9 A;  4RGN A;  4YHH M;  3Q8X A;  2NQI A;  1GJT A;  1CUK A;  3RVX A;  3L25 A;  1E6E B;  2OHF A;  3WXE A;  3GPP A;  5EE0 A;  4QRV A;  3M0E A;  1E9M A;  1WE6 A;  3TMP A;  4NXM M;  2L3Z A;  2MSE D;  3AI8 A;  2HTM E;  2WXG A;  1TY2 A;  3EIH A;  1STF E;  4YT0 B;  2CHG A;  1WJ7 A;  2V3S A;  4P6G A;  2JU6 X;  2KW0 A;  3ETR A;  4RCO A;  4JX1 C;  3TE6 A;  3H9D A;  2BVC A;  4IOI E;  4G4N A;  3R7R A;  3U6P A;  1WI0 A;  3QJ3 A;  3TWL A;  2K8H A;  4J3O D;  3PRZ A;  2Y0T A;  2M0X A;  3AE5 B;  1IN8 A;  1UWX A;  2AWT A;  2UWQ A;  4OHJ A;  3RI7 C;  3R3M A;  1YD8 U;  2ZBK B;  3MHS D;  3PZD A;  3N20 C;  4D2K A;  3EUB 2;  5J94 A;  2R9N A;  3BOS A;  3VDZ A;  3LMM A;  1MJD A;  4AI6 A;  3VH3 B;  3ZIM A;  3GQ4 A;  3RNA C;  3V05 A;  1SP4 B;  5EZQ A;  1NY6 A;  2MGW A;  3T6P A;  2K22 A;  2JY5 A;  4HRS A;  1V33 A;  3K9O B;  2AGA A;  3OLM D;  3LJ3 A;  3MHS A;  3EIE A;  2UUB M;  2LGS A;  3L54 A;  4BS6 A;  3W0F A;  3VDU A;  3UGJ A;  3SHQ A;  4OVZ A;  3FTE A;  2R9M A;  5FR6 A;  3AEC B;  1QT9 A;  1SJH D;  2IPP B;  2FS1 A;  3R8B A;  1XB2 B;  1F1H A;  3DWM A;  2VHS A;  4QNR A;  1UNS A;  5BO4 B;  3SHF A;  1S4V A;  2DZI A;  2Z59 B;  3K92 A;  4MGH A;  1UGJ A;  2WXH A;  2NPT A;  3PT2 A;  1YVB A;  3T8M A;  2AL6 A;  2AQ1 B;  2BT6 A;  3A1Q B;  3ZTD A;  2NR2 A;  2DKL A;  2EKF A;  1J8C A;  2SAK A;  3QAR A;  2LAS A;  2CHV A;  1JWA D;  4BB9 A;  3ALB A;  1PPD A;  4YWG G;  5G5G A;  2VZK B;  2TSS A;  3T3N A;  4I6N B;  2QNJ A;  2UU9 M;  1TZO A;  2C0Y A;  1TS2 A;  5H37 D;  3JR4 A;  1EWC A;  3VAW A;  3K8Z A;  1FJG M;  2WWZ A;  3DVN U;  4PD2 A;  2XF3 A;  1MN3 A;  4YTP B;  2V0G A;  1KTK A;  1WZ0 A;  2MQJ A;  1MVK A;  3V3X A;  4MGY E;  2ACZ B;  3FRI A;  2V9H A;  3LDZ E;  4G0N B;  3LVW A;  1XLP A;  2ZNV B;  3UK6 A;  4C00 A;  5MPO A;  1IWD A;  3AOG A;  5ITX E;  1IGD A;  4DDI D;  3BBA A;  4HPL B;  1PJT A;  5L8R F;  2CHQ A;  1OIZ A;  4I5S A;  3VTU A;  2Y0Q A;  1GC6 A;  4P7I A;  2BJV A;  3HHY A;  3GO8 A;  1Q02 A;  2W55 A;  2DWN A;  3SAS A;  5FTN A;  2DWM A;  1Y56 A;  1D2N A;  2PTL A;  1SXJ E;  1P98 A;  4HKQ A;  3QYB A;  4K7U A;  3CST A;  1ZXI A;  4DQO C;  2RMM A;  2QHO A;  3OTO M;  1RYJ A;  1YJ1 A;  4TSS A;  4KDI C;  1MJG M;  2YFQ A;  4MDK E;  1AYV A;  2G4D B;  3SYL A;  3CBK A;  4OZC A;  4JI6 M;  5AZH A;  3HIZ A;  4IBF A;  1WRI A;  3ZJV A;  2AUX A;  1G59 A;  1R4M B;  2B1N A;  2Y5B A;  1SF0 A;  4PAD A;  4ARC A;  1LM8 B;  3DHG C;  5EF4 A;  4NOO B;  4CHT B;  3H7D A;  1NO1 A;  1PGB A;  3DHH C;  4QHT A;  2AVW A;  5EP4 A;  1C1K A;  1DGF A;  1IQP A;  3N1Y C;  1BVS A;  2K47 A;  3APC A;  3E9S A;  2MHJ A;  4DWF A;  3N32 A;  2WXM A;  1V9J A;  1H4R A;  5C23 A;  2N9E B;  3IG3 A;  4RNA A;  2VRR B;  1ZE3 D;  3PRP B;  5BMH A;  2KEB A;  1YOV B;  4JPS A;  2DZN B;  3HJ8 A;  3QK0 A;  4JI4 M;  1ZMW A;  4K1R B;  2DYM A;  2F4V M;  1ET6 A;  1ME4 A;  2XGN A;  5BMG A;  3P1M A;  3VUY A;  3KUD B;  1PRB A;  2WDV B;  1J7B A;  1L7Y A;  3PHX A;  2VII A;  4ANW A;  4AQ7 A;  3RNF C;  2WS3 B;  1QIL A;  2JY8 A;  5HG2 A;  3RPF C;  3AEF B;  1VQ1 A;  4ZPX A;  2HE7 A;  4EIW A;  4GLS C;  4II2 B;  4MSM B;  1TZ1 A;  3B9J A;  1NI2 A;  3DDC B;  1I4H A;  4L15 A;  3ZC7 B;  5EZS A;  2BWF A;  4RGO S;  5BR8 M;  4C4V A;  3N30 A;  4LGM A;  3OIS A;  2L0F A;  2FRQ A;  1C4A A;  2N9X A;  3GS2 A;  3HVD A;  3SHG B;  3X0W A;  2KDB A;  1ISN A;  4YYS A;  2Z84 A;  3RMK C;  4M01 A;  3I01 M;  1XMQ M;  3DBL B;  2NVU I;  1EWO A;  5FKA C;  2I7P A;  1NB3 A;  1GPX A;  2KKC A;  4AW4 A;  1TR8 A;  4FXC A;  1NSF A;  1N62 A;  2WU5 B;  1UWM A;  2RGF A;  2LHC A;  3Q3M C;  1MU5 A;  2F5Q A;  4XX5 A;  2ZEQ A;  1YN5 A;  3C19 A;  4F2L A;  4AKG A;  2G5G X;  1TU6 A;  1XF5 L;  3LCU A;  3K9O A;  3RNC C;  2AQ2 B;  1N75 A;  4B95 A;  2O2V B;  1KH0 A;  1V92 A;  4DR3 M;  2J0J A;  3QWZ B;  5FTK A;  3MP9 A;  1QZE A;  4XR7 A;  1C9F A;  3QYE A;  4KGR A;  1XLQ A;  4I81 A;  1KLG D;  1VZ7 A;  3OWE B;  3V6C A;  2BWB A;  2J52 A;  2I1J A;  1F2R C;  2KA6 B;  4PS7 A;  1IPG A;  2IGH A;  3U2S C;  4IWO A;  3UQB A;  2R9F A;  4DR4 M;  3E46 A;  2K8C A;  4DMY A;  2MH8 A;  1UBI A;  2G3Q B;  1IBX B;  1D5Z C;  1HR0 M;  4DDG D;  2XK5 B;  1AN8 A;  2JWZ A;  1UD7 A;  1LQB A;  4HXD B;  3TSS A;  5EDS A;  3NRZ A;  3F75 A;  2G8L A;  8PCH A;  3DA1 A;  3LXF A;  4AKI A;  1I94 M;  1TS4 A;  2PE9 A;  4A3V B;  4BOZ A;  2WQY B;  1TF0 B;  1CQD A;  1IY1 A;  4HEO A;  1MEM A;  2LVQ A;  1YAL A;  2XZU A;  3AOE C;  2EKI A;  2GI9 A;  4JE3 B;  5DFL A;  2BB5 A;  1JRO A;  3N1X C;  4ICU A;  2YQZ A;  2ZW0 A;  1KOT A;  1N34 M;  2UZJ A;  3NBX X;  2K8B A;  2KAN A;  1HNX M;  1QUS A;  3LYY A;  2WGS A;  3KSJ A;  3FKY A;  5JXV A;  4M0W A;  3WHL A;  1R2Z A;  1WXA A;  2ZAN A;  4LJA A;  3EEC A;  4A8X C;  1MFW A;  4W9C A;  1EWL A;  4BKS D;  5JHB A;  2R6N A;  2WSF F;  1NQC A;  1YLA A;  4TUU A;  1LO5 D;  3V60 A;  1I4R A;  4B0E A;  1L4D B;  3VUW A;  4YY3 M;  3AUL A;  5EE1 A;  1MG4 A;  2HCB A;  4K3C A;  2Z3X A;  2KMC A;  3FRH A;  1CZP A;  1GB4 A;  3VTW A;  3FUX A;  4J6I A;  4BKS A;  4Y28 F;  2L76 A;  1WJ4 A;  4GMV A;  1L5P A;  2D3B A;  1UUP A;  1L6V A;  4XDD A;  5C3J B;  2L83 A;  4L6V 6;  5I4D A;  1L1Z A;  5L95 C;  1D5M C;  3T15 A;  1ZDV A;  3NVY A;  4JQW C;  1K8R B;  2V4I B;  1J7K A;  2WYQ A;  1V34 A;  3SBJ A;  4FJZ A;  3O65 B;  5EXS A;  3AXC A;  1OFF A;  4GKK M;  2J7O A;  1B9R A;  3L0W B;  2L4F A;  5C2T B;  2E6X A;  3KUZ A;  3O13 A;  4W9I A;  2CKH B;  3HM3 A;  5C1Z A;  1HNZ M;  2HH5 A;  3ERV A;  4IJE A;  3TPZ A;  4R71 A;  3SAT A;  5EP2 A;  2R2Q A;  4NZL B;  4RKU F;  4LF9 M;  3FAH A;  2DNA A;  4GSW A;  2J4X A;  3ZDT A;  3OVZ A;  2JZ3 B;  3HZJ A;  4B7F A;  1PUT A;  3KP1 E;  3J27 B;  3KOY E;  1N63 A;  2QCU A;  5IWA M;  1GG3 A;  2PEA A;  1GJS A;  3J80 S;  1LTM A;  5FR3 A;  3GE3 C;  1G4A E;  5DCN A;  4ZHP A;  1IYF A;  3BYT B;  3F5V A;  2KMA A;  1WH3 A;  2RPQ A;  5CX3 A;  1CV8 A;  4DHZ E;  3P5X A;  3DF0 A;  2MW5 A;  4ICV A;  2LHG A;  1WE7 A;  1QOL A;  1F77 A;  4RM8 A;  5D94 A;  3LFY A;  3B7Z A;  4BBA A;  2CHZ A;  2HTH A;  4IUM A;  3E1Z B;  2MH7 A;  1C78 A;  2JYT A;  3V76 A;  2BTW A;  2LXE A;  4P17 A;  1VG5 A;  3IBE A;  3P4P B;  2CB5 A;  4BOS A;  5BPV A;  1BY8 A;  2PRE A;  1V8C A;  1YJI A;  2KYW A;  4RMA A;  5CTR C;  1DO2 A;  4X6J A;  1AWD A;  3QWL A;  2KAC A;  3B79 A;  3PV1 A;  2F7D A;  1E9S A;  1PGA A;  2G9H D;  4K7W A;  4JLC A;  3HHM A;  4WA6 A;  3JR5 A;  2JNH A;  2KDM A;  4XYC A;  1Z5C A;  2JY6 A;  1UBQ A;  4ZOH C;  1Y08 A;  1FFV A;  4NC6 A;  4HJK A;  3C58 A;  1NBF C;  3VKH A;  1ITO A;  1BP4 A;  1VCB A;  2KFK B;  1I42 A;  1DOI A;  4LF7 M;  2JY7 A;  2NBU A;  4ZYN A;  2O2V A;  2ZNV C;  2V3P A;  2ZVN A;  4G6Z A;  4OVU A;  1G41 A;  3B7Q A;  3TWK A;  3PHU A;  4M00 A;  2HAK A;  4B3R M;  1OFI A;  2IYD B;  4XWT A;  3AMZ A;  2KNZ A;  2W82 A;  1AEC A;  4FIP A;  1ZAE A;  1KYI A;  2K0B X;  2Y20 A;  2KWU B;  1DEU A;  3D8L A;  3USV A;  1IXS A;  4AJW A;  2KTF A;  5IP4 D;  4OZB A;  2G3Q A;  5E6O A;  1BML C;  1KHP A;  2E00 A;  2XK5 A;  2JXX A;  3L29 A;  1C4C A;  1UEL A;  4HXD A;  4B7G A;  2PVG C;  3Q3F A;  4RH6 A;  4NSR A;  2C5L C;  4HL4 A;  4F1I A;  3KVW A;  1IBM M;  2GRI A;  4GU2 A;  2OUL A;  3L4P A;  4ASW C;  1SG9 A;  2HL7 A;  1IY2 A;  1PCI A;  2C98 A;  3ZXV A;  1STE A;  1QQR A;  4LZZ A;  2YEP F;  2X4A A;  3SAR A;  2HDE A;  2DZK A;  5CHF A;  2L4E A;  2GFO A;  2LWP A;  3RUI B;  2BGF A;  3HU1 A;  1DOX A;  2H89 B;  2L09 A;  1JR3 D;  1QDQ A;  1EIJ A;  3MHZ A;  3W1S C;  5E6N A;  2I38 A;  2D11 A;  2WXF A;  4PYU A;  2JXT A;  1VEK A;  3P63 A;  1GLO A;  3TEY A;  2VHF A;  3TUO A;  2GNO A;  3LW5 F;  3W2D A;  1OIP A;  2G6D A;  5ITU A;  5IO9 A;  2E02 A;  2BW2 A;  1FRD A;  4G4R A;  4D81 A;  3RNV A;  3KX1 A;  2VF8 A;  1ORY B;  4RKX A;  4GH9 A;  1UGM A;  3TMP B;  4AS1 A;  4XUI A;  4L2Y A;  4C80 A;  2LVO C;  2AU1 A;  1R7S A;  1SE2 A;  3GOE A;  3W30 A;  2MP2 B;  4MH0 E;  2IO1 B;  2WBF X;  2MBH A;  1L2C A;  1P1A A;  1KHQ A;  5D3I B;  3KSX A;  4GIV A;  1MI0 A;  3RUL A;  1V1P A;  3THG A;  2LUE A;  5CVO B;  1U9X A;  3WHK A;  3L26 A;  2M60 A;  1MHH E;  2UXD M;  1XCT L;  2BPS A;  3KLS X;  1P9D U;  2LVP A;  1HUC B;  1NY5 A;  3O65 A;  3MOR A;  3HU3 A;  1MPE A;  3PVL A;  1THE A;  2DZZ A;  2ZM6 M;  1T3T A;  1R4G A;  3BZD B;  2E01 A;  1WXS A;  4RF1 A;  2JUJ A;  4AG6 A;  3ZGZ A;  3HM6 X;  3IHP A;  2BKF A;  2F1G A;  1FCC C;  4RGT A;  1R7R A;  4MJS A;  5AUK A;  2HKJ A;  4LRT A;  2BWE A;  1IBL M;  3MHV C;  4DK5 A;  1D0K A;  1T0R C;  4LTU A;  3DBS A;  3GLG A;  4YSZ B;  4DUY M;  4EKU A;  2AUZ A;  1WHC A;  2MR9 A;  1ET9 A;  1PPP A;  3VR8 B;  3I9V 1;  2YNM D;  2JWU A;  4HWI B;  1Q10 A;  3I3T A;  4DV1 M;  3VK8 A;  3P4R B;  2QPA A;  2APL A;  2ARY A;  1AUA A;  2WZJ A;  4FW9 A;  1NEK B;  2AX5 A;  2NPT B;  3PT2 B;  1VDV A;  1V86 A;  1DKI A;  3ZNH A;  3VDP A;  4EZK A;  3PZ8 A;  4W5B A;  4BPV A;  2M17 A;  2IO0 B;  2B1M A;  2N1V A;  3X23 A;  4EZJ A;  3D6S A;  5DNY A;  1ZW7 A;  1IXR C;  1FFU A;  1JQP A;  4DBG A;  3FYC A;  1SXJ C;  2PBH A;  1QAQ A;  4P1B C;  4XGA B;  4CZW A;  1W5T A;  1OTR B;  2INC C;  3IAS 1;  2PVO D;  4FWH A;  2YJ2 A;  4GN1 A;  1PAD A;  1NL6 A;  5CHV A;  3SMP A;  1X1M A;  4PS8 A;  2GBM A;  4W9L A;  5LMN M;  2Y5C A;  3E21 A;  3C0R B;  3QCA A;  2RD0 A;  1EFU B;  2W54 A;  4IC7 B;  4MH8 A;  4X62 M;  5FPW A;  2IO2 B;  3CIR B;  4II3 B;  2RDB C;  5TR5 A;  1TKE A;  2HWK A;  4AQY M;  4XDC A;  1U4A A;  4XZ4 A;  3GQ5 A;  2DZM A;  1HZ6 A;  4ZRQ A;  1ZUD 2;  2FOI C;  1N61 A;  2CUZ A;  4MAC A;  1S1Q B;  2X38 A;  4QHS A;  1LFD A;  4WAF A;  2E5L M;  1WSP A;  3MP2 A;  3RFZ B;  1SEB D;  4MEL A;  1CSB B;  1ZDX A;  4BSQ A;  2WSC F;  4FHJ A;  2GBR A;  1RWS A;  2LMC A;  3T3O A;  3FUT A;  2J7Q B;  3KXE C;  2NTS A;  1K82 A;  1VSN A;  4F1S A;  4HDQ A;  3KW6 A;  3B21 A;  4H2A A;  3RE8 A;  4B3S M;  2JRI A;  4N79 A;  2Y5P A;  1TKG A;  3ML8 A;  1OEY A;  5JZE A;  2KLG A;  1TT5 B;  1K3W A;  1GO5 A;  3CSF A;  3OQC A;  1IN6 A;  1WGN A;  3IFW B;  1Y8R C;  3KUC B;  2B3T A;  3QIJ A;  3SU8 X;  5IZ7 D;  3H6N A;  4JGH B;  3TEW A;  4BOQ A;  1UF0 A;  4XE0 A;  4W4U A;  3T1H M;  1RAX A;  1PE6 A;  2JZP A;  3HU2 A;  4Q7J A;  4W9G A;  1W5S A;  2PLP A;  3BVM A;  1F4I A;  3KW5 B;  3MC9 A;  2XU1 A;  2FQ9 A;  1N77 A;  2YJB A;  1VRA B;  2NQD B;  5BYR A;  3ABV B;  3APD A;  1QAM A;  2IO3 B;  2BNK A;  1WX7 A;  2MA9 B;  4N9F 4;  2HD5 A;  2A4Z A;  3BK2 A;  2A5Y B;  4ZRP A;  3N1Z C;  2C9O A;  4BFR A;  1FXT B;  3HD3 A;  3U6L A;  3AE2 B;  2KZS A;  3BVG A;  2R45 A;  1KRH A;  1FIQ A;  3KKU A;  4WW0 A;  4DR5 M;  2IZV B;  2DZO B;  1M4V A;  2KK8 A;  2KWD A;  3H1U A;  3PHX B;  4LF8 M;  3B0A A;  2JA2 A;  5EXX A;  4KKI A;  1JB0 F;  1QKZ A;  3RYT A;  4AJY B;  4LJ6 A;  4M8M A;  1F2A A;  4BQV A;  2GBK A;  3TL5 A;  2MP2 A;  3IFU A;  2HXZ A;  2R62 A;  2K1F A;  1D5X C;  5LLI A;  3ZJT A;  2DCC A;  3CBJ A;  2DAI A;  4JIO U;  4C4V B;  4KZ0 A;  1WWT A;  3R66 C;  4AP4 C;  1E7P B;  4MGZ E;  2DC9 A;  1HTO A;  3GB1 A;  3N3G A;  4KGS A;  2NQG A;  3GLH A;  3CH3 X;  5A24 A;  1E32 A;  2D3G A;  1KJT A;  2C5R A;  1Q39 A;  2WX1 A;  4L4U A;  3LB8 C;  4K81 A;  1DOY A;  2LBC A;  2DAG A;  3ZJU A;  3MC8 A;  1GOZ A;  1PPN A;  3A4S C;  4IIW A;  4DV3 M;  4S17 A;  2LJI A;  2O6V D;  4LJO B;  3OF9 A;  4LJ7 A;  2ZTD A;  5GMV A;  3FUW A;  2KQ4 X;  1TGU A;  2GLS A;  4IBJ A;  4WJN A;  2XN9 C;  2N1W A;  4OU7 A;  2AS8 A;  2O5R A;  1FO4 A;  1PGX A;  2DWQ A;  3AE4 B;  4FJV B;  1UKF A;  1R6B X;  3PHW B;  2QSD A;  2N7E A;  1F9J A;  2KWC A;  1XWI A;  2X49 A;  2O25 A;  3ZRC A;  5LXH A;  3IV2 A;  3KOX E;  2XLJ A;  5EGW A;  1FNV A;  2PPH A;  2UU7 A;  2ZVO A;  3IT6 B;  3LXS A;  3QC8 B;  5A2Q S;  2FCS A;  2BYV E;  2Z4S A;  3Q8B A;  1DO0 A;  1UM8 A;  1U9Q X;  3QA8 A;  2VQE M;  3V6C B;  4AXL A;  2L2D A;  4LDT D;  3WXG A;  4ANR A;  3EA6 A;  1E7V A;  2ICI A;  2JRH A;  2DCD A;  4JI7 M;  1WX9 A;  4EE2 A;  2YR0 A;  3VFK A;  2D7E A;  4UDU C;  1V2Y A;  3H4J A;  1P7E A;  4ANX A;  3WXF A;  1OTR A;  4ZRK A;  4B3M M;  4JL9 A;  4GMQ A;  1I4G A;  3MMP A;  2DZL A;  4GDK A;  2P0R A;  3L08 A;  4BOZ B;  3A42 A;  1KSF X;  2KDI A;  3P2B A;  3C0R A;  3BPM A;  3KP0 E;  2M19 A;  4DR1 M;  1T6O A;  2R6F A;  5H92 C;  1AYW A;  1BXT A;  1JWU D;  2FUG 1;  2UXB M;  2WXK A;  3U6D A;  2RR9 A;  4M0W B;  4QNM A;  4GHL A;  1GNU A;  3AED B;  3C3D A;  2REX A;  2GQF A;  4L16 A;  2WXP A;  4N58 A;  3N3K A;  4W5C A;  2CJO A;  4TQ0 A;  4HEA 1;  3D8B A;  1YE9 A;  3HHA A;  1KXR A;  1YQ3 B;  4UN2 B;  4R7G A;  1UFZ A;  2J7Q A;  4G54 A;  2JT4 B;  3VXW A;  2RGH A;  2WHI A;  2FCQ A;  3AE1 B;  4WQO B;  3U52 E;  2KVZ A;  3H7S A;  4KKJ A;  2N7J A;  3BVZ A;  3VFD A;  2KJR A;  1XD3 B;  1HE8 A;  2LHD A;  1J19 A;  2YJC A;  2INP E;  3ZRF A;  5D2M B;  1CPJ A;  1NV8 A;  4YVA A;  4DV6 M;  5J18 A;  3IMA A;  2DHR A;  4BOP A;  3V62 A;  4ANV A;  2K9D A;  3W68 A;  2MBE A;  3S3R A;  3ZDM C;  3IXS A;  8CAT A;  3PRE A;  1XKG A;  2R18 A;  4A3P A;  3DHI C;  1C79 A;  1FNU A;  1E8Z A;  5FTM A;  1MG8 A;  2YVC A;  4A90 A;  4KT0 F;  2JZZ A;  2LRW A;  2IY1 B;  2MJD A;  4IM0 A;  3IUT A;  1WJ6 A;  2HWJ A;  3BC3 A;  4FAD A;  2QP9 X;  4EZL A;  3P42 A;  4IBG A;  2Q2E B;  1JWM D;  3SR6 A;  4PS3 A;  2MEK A;  1XNQ M;  4D8I A;  2BB6 A;  4YTM B;  4MT5 A;  3UJN A;  4GRI A;  3URY A;  2SEB D;  2MX2 A;  1ZIV A;  5EP3 A;  2DZY A;  3B08 A;  5F3W A;  3AEA B;  1QQW A;  4IUM B;  4GIP A;  1OQR A;  2BTW B;  4DR2 M;  5DYI A;  4YXD B;  4C7Z A;  1BGO A;  3ONS A;  4JN6 A;  2AQ3 B;  4JI3 M;  2CWB A;  2ZPN A;  4NQK E;  1KFV A;  2LZ6 A;  1I4W A;  4G3X B;  5KHO A;  5HFY A;  1GJZ A;  5IOI A;  2FFJ A;  3AU5 A;  1JRU A;  3K24 A;  4ZHO A;  1X9Y A;  3GLG E;  2G1E A;  2WDR B;  4X6I A;  2JY6 B;  1SIF A;  2KX3 A;  4P1C C;  1ZCM A;  2WXO A;  3PHW A;  3NVW A;  4BZA A;  1RFK A;  3HRD D;  2D07 B;  1ME3 A;  2KLC A;  1DGB A;  3EFU A;  3CGW A;  1WMH A;  3R8F A;  1WFY A;  1U5I A;  1DYQ A;  1I35 A;  2ON8 A;  4HLQ A;  3IOQ A;  2LVA A;  1C77 A;  2XNA C;  3HHZ A;  1WGL A;  4XZX A;  4JI8 M;  2KT7 A;  2XEP A;  3QHT A;  2N9P C;  4NAW A;  1IN5 A;  5HKH A;  3QSD A;  1T0Y A;  1YSY A;  3H89 A;  1IXS B;  1QF6 A;  1ZKH A;  1WGD A;  3BOW A;  3MTN A;  4MSQ B;  4LFC M;  4WIP A;  4X65 M;  4AKH A;  3U6Q A;  1GVN A;  2CP8 A;  4QH6 A;  4BKT A;  5DYG A;  2A5U A;  2RPV A;  1YNT E;  5FTL A;  4LNF A;  1Q6K A;  2WXI A;  3R7Q A;  3UZU A;  4LLG M;  2LTU A;  4XGI A;  3TQS A;  1G8P A;  3T38 A;  2HHH M;  3AL0 C;  2GOW A;  1XHB A;  3ZCB B;  1XNR M;  3A9K A;  3GZN I;  2ONQ A;  4WWP A;  1G6J A;  4TV3 A;  4A9A A;  4YYV A;  1F0Z A;  1RLF A;  2KJH B;  3ZW3 A;  3V6E A;  2K39 A;  3NWL A;  3VR9 B;  1I4X A;  1TS3 A;  2LGI A;  1FEH A;  2HJ8 A;  2BYF A;  1PQS A;  1SXT A;  1CJE A;  4LJP B;  4Q2J A;  4RM9 A;  2MBO A;  1FCL A;  3R2T A;  3NG0 A;  2J0K A;  1T0S C;  1EM7 A;  3RZW C;  2ZAM A;  3U30 A;  2FCM A;  1CMX B;  2UYZ B;  1RFA A;  2KN4 A;  2C60 A;  2L52 A;  1NDD A;  4WWM A;  1OEY J;  4I6L B;  1V1P B;  1C3T A;  1J7A A;  2LFI A;  3GRR A;  1CS8 A;  1IM2 A;  2QEN A;  2YJ8 A;  1VZ6 A;  5GXG B;  2CV0 A;  2OJW A;  1K53 A;  2NMQ A;  2YLM A;  3GPU A;  2E3T A;  2AYO A;  1WGK A;  1FNW A;  2DEN A;  2V3N A;  2OO9 A;  2FO5 A;  3IG8 A;  2MJ3 A;  3KS4 A;  4LNO A;  4NXN M;  4K3B A;  4MJS B;  2L05 A;  2BQQ A;  2UUA M;  1F2B A;  2Z7J A;  4HDO A;  2AIM A;  4YYW A;  4DMX A;  3GLG B;  4RFB A;  4G50 A;  2QIE B;  1KF6 B;  1S3S A;  3UGB B;  5JI2 E;  3L13 A;  1E9R A;  3TWM A;  2D10 A;  2K5P A;  4NPN A;  3TJP A;  2K6D B;  2BBC A;  3DCG A;  3I3T B;  1XCQ L;  4PP1 A;  1ZV1 A;  1HNW M;  2Z8L A;  4G11 A;  3CWI A;  3ZNH B;  1E0Z A;  3FD9 A;  3IG5 A;  1YN3 A;  4YTN B;  3DFZ A;  3GLH E;  2ZAO A;  1YUB A;  5FK9 C;  1PIP A;  4YYU A;  2LVN C;  4TKN A;  3H7P A;  4OEL A;  1F52 A;  2FID A;  2DC6 A;  4Q8H A;  1V49 A;  4DBG B;  1YX5 B;  3UIP B;  1VJV A;  3JAM S;  1XMO M;  2QCZ A;  2N7D A;  3N4C A;  2BU3 A;  4R3D A;  5D3D A;  1E8Y A;  2GBJ A;  1GLN A;  1NNJ A;  1GUA B;  2EKK A;  4MB7 A;  2G7Y A;  2BDL A;  3MC0 B;  3I4Y A;  1NV9 A;  1PYW D;  2KFJ A;  1QOG A;  2NBV B;  5J17 A;  2EEL A;  1WRD B;  1J09 A;  1WF9 A;  3HJQ A;  2GB1 A;  2JWS A;  1PJQ A;  5BMI A;  3C3E A;  3K2L A;  1Q5W B;  2PAD A;  3FE3 A;  4PK1 A;  2D7H A;  3VTV A;  2K0P A;  2NS5 A;  3W9C B;  5IN7 A;  2O6X A;  3O0U A;  4D8B A;  1FNN A;  1KFY B;  3QQ8 B;  3TCA A;  3IAM 1;  4NL4 H;  1XXG A;  4ZRI A;  3OJ4 B;  3NHE A;  1TH4 A;  2FBW B;  4IM3 A;  3FKE A;  1FMA D;  3RVW A;  3KWV A;  3W0L B;  3A9J B;  1MDW A;  3UIO B;  4K7C A;  4LNK A;  3NBI A;  4ZTB A;  4GUA A;  2I1K A;  5E26 A;  1TGZ B;  2JRI B;  2KC1 A;  4EUT A;  4LZJ A;  1ZOY B;  2CHW A;  4X57 B;  2EJS A;  1R4N I;  1YMH E;  4W9H A;  5JZE B;  4P6E A;  2L00 B;  1XXH B;  2LUM A;  1AU2 A;  3HWN A;  4M9Z A;  4TQ1 A;  2LGD A;  4GEW A;  1CK1 A;  3UMM A;  3HHI A;  2BF8 B;  4B0M A;  3PNY A;  3PO0 A;  1QAO A;  4MEM A;  2R4E A;  1SXJ D;  2INN E;  1I4Q A;  1R2Y A;  4WP2 A;  4WJO A;  5IRE B;  4WQM A;  1YQB A;  3KS8 A;  1NEN B;  2OOB A;  3ZQ4 A;  3A4R A;  2QQ8 A;  1TH2 A;  5FTJ A;  2R65 A;  1WM3 A;  4M02 A;  2X8A A;  1NNU C;  1HEZ E;  1J5E M;  2CU3 A;  2N9L A;  1SGH A;  1E10 A;  1MX0 A;  3OJ3 A;  2Z0D B;  3P5W A;  2UUC M;  2HD5 B;  1AYU A;  3NVZ A;  4BOU A;  3Q3N C;  3HHX A;  4EEW A;  3FIL A;  3FYD A;  2LD9 A;  3N9Y C;  1TIF A;  1RU3 A;  3M99 A;  3L17 A;  2M5Z A;  3W31 A;  1JR3 A;  1JWS D;  5CVN B;  4CIS A;  2V1C A;  4DUZ M;  1G71 A;  3PLV A;  3U6E A;  5PAD A;  4PDG A;  3VHT C;  1L0V B;  4D80 A;  2VH2 A;  1ICF A;  1TTN A;  1K3B B;  1IN4 A;  4MGI E;  3NVV A;  3M6A A;  3WAO A;  2BYE A;  4AWJ A;  1GCB A;  1TTE A;  4HRO A;  2FCN A;  3GLH B;  1T6B X;  3W5U B;  3BY4 B;  3RD2 A;  1N33 M;  5G55 A;  2KDE B;  1ZMU A;  1SE4 A;  2DJF B;  4LK0 M;  4AZF A;  4BOS C;  4IBE A;  3MFG A;  4GB9 A;  3TEZ A;  3TRK A;  4E3C A;  2KNV A;  2FRA A;  4W9J A;  5ITT A;  5EP1 A;  2L7R A;  3B89 A;  4X66 M;  5CHT A;  3GP1 A;  3RCZ A;  5KHQ A;  2WDT B;  4S0R A;  5BYS A;  4B3T M;  3OG5 A;  1O0E A;  4XWW A;  4QOS A;  2KHH A;  3BB7 A;  3KDS E;  2M56 B;  2W3S A;  3FC4 A;  4HPP A;  1V6E A;  4DR7 M;  5LXI B;  2DZJ A;  3UIN B;  3VUX A;  2YEP B;  3ML9 A;  4PCZ A;  1WJU A;  1JRP A;  2CV1 A;  2JSV X;  4HKZ E;  3QX1 A;  4CYE A;  4L8R C;  4ITQ A;  5G5H A;  3C9E A;  4JXJ A;  1YZB A;  5AEK B;  1XLN A;  1AU0 A;  2O01 F;  2DC8 A;  3CF2 A;  3TEX A;  4KSL C;  2WXL A;  3ENE A;  3PSE A;  1LV7 A;  1QYR A;  5ITY A;  3AE6 B;  1CTE A;  1K50 A;  4LNN A;  5CHW A;  1JCK B;  2R9C A;  2XSZ D;  2IJ0 A;  4LDT B;  1XT9 B;  3ZVV A;  2PKO A;  3AH7 A;  2M8S A;  3JW0 X;  1V97 A;  2UXC M;  4GDK B;  1ACC A;  1CVZ A;  2KQ7 A;  2XU5 A;  2KJ6 A;  2B76 B;  1TJE A;  4MM3 A;  1XQQ A;  2DWZ B;  2R4J A;  3Q8G A;  1N32 M;  3ZNZ B;  2JQR B;  3DBR I;  4PI3 A;  3U60 A;  3PS6 A;  4NSO B;  1L2B A;  3FUU A;  1Z5S B;  3SMS A;  4REZ A;  2ASQ A;  2WSE F;  2AHM A;  2RRU A;  1VEJ A;  4FWG A;  4KO8 A;  2PE6 B;  2F5S A;  3Q8C A;  4WWN A;  3KWZ A;  3N3K B;  2C7H A;  3KYD D;  2BS3 B;  2BWE S;  1HXY D;  4IM2 A;  1UZX B;  2JX5 A;  4DV5 M;  5D6J B;  3AE7 B;  1U9W A;  1GAB A;  1X37 A;  3A9J A;  3J9C A;  2NTT A;  3R9X B;  3K1J A;  1WZ3 A;  3AB5 A;  4MZS A;  3ECI A;  1N5X A;  2RKO A;  2I7N A;  4FHK A;  3I63 C;  4BLC A;  4YL8 A;  2B3A A;  2K25 A;  1XXH A;  3U5Z B;  2Z4R A;  2JQF R;  4HPM B;  4C7Y A;  4WJQ A;  3VRB B;  2QSF X;  2K9X A;  2KXJ A;  2N4F A;  2X8X X;  4NJ6 A;  1E90 A;  3H8H A;  1F2R I;  3C9P A;  4N6E B;  2LHE A;  4WH4 A;  1TLO A;  1Z59 A;  1D0M A;  3PXG A;  2LI5 A;  4KSK C;  2DLB A;  4KIK A;  3Q3O C;  4DV7 M;  1YT7 A;  2QC8 A;  2QEJ C;  1PJS A;  4IBK A;  2LVP C;  4PT5 A;  3Q3J A;  2L6O A;  3WAL A;  2KNB A;  2WXN A;  1PGY A;  3ZKJ C;  1KM7 A;  4A5U A;  1TKY A;  1MHW A;  3RGS A;  3KH0 A;  3KFQ A;  2KDF B;  3IHP C;  3Q14 C;  3UF8 A;  2KDL A;  1OFH A;  3I57 A;  3BWU D;  1TBE A;  3J7A S;  1MHX A;  5C1B A;  1OGW A;  4PYZ A;  2BTE A;  3JSV B;  1PDX A;  3L2A A;  3M95 A;  1TDZ A;  3VK7 A;  1ZGU B;  1NHW C;  1XO3 A;  4LGY A;  2RSU A;  4L23 A;  2Y3A A;  4FCW A;  5FLX S;  1A5T A;  3DOW A;  1N6Z A;  4CQN A;  4KDL B;  5LMU M;  1HJP A;  2FTD A;  2MJ5 B;  4N8W A;  1DGH B;  2OPF A;  2QBY B;  2LNH C;  2DBY A;  2KMM A;  1EWP A;  1IUE A;  2R46 A;  4LJ4 A;  3GP7 A;  4G4Q A;  4XC2 A;  2N9K A;  3CMM B;  1CJL A;  3ILK A;  2ERC A;  3F92 A;  4FBJ B;  1OQY A;  2KHW B;  3BY4 A;  2K6B A;  2OP3 A;  1HA5 A;  3AN1 A;  4A20 A;  4LJ9 A;  4KHP M;  5JA7 A;  2MBQ A;  3IEC A;  2R9O A;  1YX6 B;  4CDE B;  4ZYS A;  3A98 B;  1WXV A;  1POP A;  1WR1 A;  1E8W A;  5CHV C;  3R2I A;  1NVI D;  2JZ0 A;  1WR6 E;  2CU1 A;  3QAQ A;  4N4Z A;  2R44 A;  4LFB M;  2XH9 A;  3KOW E;  1I4P A;  3ZXR A;  4MZO A;  4S12 A;  1SE9 A;  4HVB A;  2J0M A;  3AE8 B;  1HTQ A;  3NUH B;  2L8J A;  2CS4 A;  2O6V A;  5GKN A;  4URK A;  4US9 A;  3K9P A;  4KLB A;  2LEK A;  3MJW A;  1WMH B;  2Z8Y M;  3NOB A;  1YK8 A;  1HZ5 A;  3SAV A;  3QT4 A;  2XU3 A;  1LXD A;  2M0A A;  4OEM A;  4L1B A;  4YSX B;  9PAP A;  4MI7 A;  1NI3 A;  4G4O A;  5DPR A;  1VDL A;  1C76 A;  1A6R A;  4NAW B;  3SEB A;  3VQI A;  4DV2 M;  1BT0 A;  1L2D A;  4JWU C;  5C18 A;  3FTD A;  2JQG R;  3MTN B;  2V6Z M;  4FN2 A;  4GDL B;  3PW3 A;  4B9K A;  2FNJ B;  4M0D A;  3VLF B;  3GLF B;  2DHZ A;  4IWQ A;  4W9F A;  4ACF A;  1M6D A;  3PRM A;  2KAJ A;  5CVM A;  2QDF A;  4M8N A;  2NQ8 C;  3GLI A;  3DQV A;  1HQY E;  3U4E G;  1FXA A;  2LXA A;  1S3S G;  2JTC A;  4NNJ B;  3KYC D;  1Q3C A;  2DAJ A;  1Z6T A;  4MSX A;  1N5W A;  1N78 A;  4BKG A;  1NPZ A;  1WGG A;  1OKS A;  2DAM A;  4JV5 M;  4XBO A;  3A9K B;  3I06 A;  2N0S B;  3QAU A;  3AV0 A;  3UI3 A;  4JYA M;  5D7G A;  1EE8 A;  1JQJ C;  2DYB A;  1IP9 A;  3ZUN A;  3U7Z A;  3V6E B;  3T9L A;  2QIL A;  2OQ4 A;  1DF0 A;  2KTR A;  3LQR A;  3PLU A;  1EU4 A;  4M9X A;  5IAA C;  3HVZ A;  3OVX A;  1BQI A;  3RFW A;  1WGY A;  5KPR A;  2NBW B;  4RF0 A;  2VQF M;  1N36 M;  1SNK A;  2NCN A;  2OED A;  4LF6 M;  2D5G A;  2MBB B;  3E56 A;  4OZA A;  4P6V F;  5G2N A;  3U5Z A;  2MLB A;  1WJN A;  3BYY B;  1E94 E;  4LG2 A;  1Z2M A;  4KZC A;  3U61 B;  2C7N B;  3SC3 A;  1I7H A;  4YSY B;  2CHX A;  5H8Y E;  3UQA A;  3L28 A;  4DHJ D;  4K7S A;  1GKI A;  2AYO B;  2KOX A;  1FM0 D;  3J7B A;  2DC7 A;  2DEN B;  4FJC A;  1ZQ9 A;  3U6C A;  2L7I A;  4AXM A;  2FE8 A;  2VDB B;  4G3O A;  4YV8 A;  1C7Y A;  1R4M I;  2Q5W D;  2VF7 A;  3JVZ X;  1GL7 A;  1EU3 A;  4WUR A;  4FUL A;  4OW0 A;  1JR3 E;  4GKJ M;  2QMT A;  3P4S B;  3M62 B;  4AUQ C;  5F02 A;  4IBD A;  1U9V A;  3AOE A;  2G4S A;  4ZUX U;  1ATK A;  1T3Q A;  3NZU A;  2P5T A;  2W9N A;  3JSV A;  5JHA A;  2DAF A;  3OAW A;  4W9D A;  1QAN A;  3ZTC A;  3S3Q A;  5IT9 S;  2WXQ A;  3TNX A;  3B9P A;  3DWG C;  3EHV A;  4FCT A;  3TL4 X;  5KQD A;  3GPX A;  2GMI C;  3HHW A;  1Z5A A;  3J2P B;  1PJI A;  2F5P A;  2MJE A;  1DGH A;  2LH0 A;  2QBY A;  1VR9 A;  2KC2 A;  3H7P B;  3DZD A;  1QVR A;  1TDH A;  1K3X A;  5EE9 A;  3KQ4 A;  2P7U A;  3LQQ A;  3RN9 C;  2PIA A;  4NRV A;  4IKG A;  3H4M A;  3RNE C;  3BPF A;  2KO3 A;  1WY8 A;  2FT2 A;  1P3Q U;  2DOS A;  1AIP C;  3SD5 A;  4CDC B;  2G8E A;  1AW7 A;  3U8E A;  4QRX A;  2ZTC A;  3W5V B;  3W67 A;  3MTV A;  3NS8 A;  4RGM A;  1PJJ A;  1JW9 D;  3KWB X;  3O1G A;  5T8I A;  1WIV A;  3A45 A;  2D3C A;  4GC9 A;  1Q1O A;  1N60 A;  4NJC A;  5BYQ A;  3ZYY X;  4HLE A;  5DPW A;  3AE9 B;  4WJP A;  3DBL I;  3BIN A;  4YYR A;  7CAT A;  1RRB A;  2EMT A;  2G45 B;  3CF6 E;  3WAP A;  2EMS A;  2JF5 A;  2IY0 B;  2KZR A;  3K9M A;  3PNV A;  1KLV A;  3NHE B;  1YQ4 B;  2C7M B;  2MRO B;  3WAM A;  4II7 A;  4ITK A;  3A46 A;  5ITR A;  3BWK A;  1LGR A;  2JZ1 A;  2DYO A;  1WXM A;  2WDQ B;  2JUO A;  4BBN F;  5L83 A;  3HGI A;  4CO7 A;  2J7Q C;  1QDR A;  2DX5 B;  4B7H A;  1VZ8 A;  3DPD A;  2WU2 B;  4ZRJ A;  1JQ4 A;  1T5X D;  4GDL A;  3GLF A;  2J53 A;  6PAD A;  4FJY A;  2GBN A;  4EFO A;  4F7Z A;  3RNG C;  1Y4H A;  3SFZ A;  1B1Z A;  3FUV A;  1WX8 A;  3I4V A;  4HCP B;  2BYT A;  2OOB B;  2VZK D;  3AKZ A;  1L0Y B;  1L6U A;  3A1Q A;  1QZM A;  2CRU A;  3E4R A;  3B2F A;  5EJC A;  2G8J A;  3HKP A;  4LJ8 A;  4BAX A;  1SXJ B;  4IBC A;  4P16 A;  3AE3 B;  3DVN V;  1HT1 E;  4OVV A;  4CDF B;  1WYW B;  4Q8G A;  3FIL B;  1SJE D;  3OF8 A;  2LVQ D;  2JP7 A;  4A55 A;  1EWM A;  3GRY A;  4PDI A;  3L10 B;  3BK1 A;  3RNB C;  3GZN B;  2KD0 A;  5KPZ A;  4DXG A;  2DXI A;  2PJH A;  4KOD A;  5AZG A;  3WA0 A;  2DJG B;  2FUD A;  1PVJ A;  3TBL D;  5AZF A;  3RT3 B;  1J7C A;  3TIX A;  3PPA A;  1OQQ A;  1XXH E;  5J2R A;  2EUC A;  5AUI A;  2CE7 A;  4D8E A;  4GOC A;  4LY6 A;  1HT2 E;  2CFO A;  2R0I A;  3VVW B;  4RY2 A;  4LF4 M;  2H1R A;  3U8Z A;  3CF0 A;  2Z0E B;  2J42 A;  3PZ7 A;  3AFH A;  1E8X A;  1RM6 C;  3U61 A;  3P4Q B;  4F8C B;  3HK0 A;  2L32 A;  2K6Q A;  3Q8A A;  1M94 A;  4LRS A;  5HHD G;  1P3Q Q;  3HY5 A;  5EXT A;  4BVU C;  1R5L A;  4LCD E;  2JPH A;  5IKC M;  5EE3 A;  1AU4 A;  4JWS C;  1JWB D;  4QOZ C;  3SFD B;  1P0R A;  2L7H A;  4PP2 E;  7PCK A;  3FTF A;  2ZCB A;  5JH3 A;  1HQC A;  3LVV A;  4QBB A;  3I51 A;  1QDT A;  2KQS A;  2ZZP B;  4LJ5 A;  2C9C A;  1ENF A;  2HJ1 A;  2LXC A;  4I07 A;  2F5N A;  1WYG A;  4I04 A;  2MRP A;  4JI1 M;  3AI5 A;  1JML A;  4W5W A;  1GC7 A;  3W1S A;  1AIM A;  1Q0W B;  2IGD A;  2JYE A;  2Y6E A;  3KVF B;  2OJR A;  2IBI B;  2BS4 B;  3MHH A;  1DGJ A;  2HHN A;  3AEE B;  2XBB C;  3PRP A;  3S2A A;  1L8Q A;  4FK5 A;  1PBH A;  3AM9 A;  3PSE B;  1TYG B;  1WGH A;  3ZNG C;  4HCN B;  1QOF A;  3VRA B;  2LVO A;  1F2C A;  1GL6 A;  5E6J A;  4DXA B;  2EKE C;  3U6S A;  4TMA B;  4W9K A;  2CEA A;  1VEG A;  4JI2 M;  2RGO A;  1CQV A;  4A6Q A;  4LFA M;  2D3A A;  3ZNI D;  4MM3 B;  3IEJ A;  4QAY A;  3GRV A;  2WXJ A;  3FTC A;  5E6P A;  1D3Z A;  3U60 B;  3KFU G;  2ZCC A;  1MS6 A;  4I6P A;  3B2G A;  3BBZ A;  5JI3 E;  3EFC A;  1EUV B;  4KX6 B;  2DI0 A;  1NHG C;  2IPK D;  1H6U A;  2WNM A;  2RDH A;  3APF A;  4NAM A;  2MCN B;  4EOY A;  2KXE A;  3AEB B;  1FPY A;  4IP3 A;  3AU4 A;  1F29 A;  3PBH A;  1YJJ A;  5KPT A;  3U6M A;  3Q69 A;  1EF5 A;  1OJL A;  4BS5 A;  2XZF A;  3RZF A;  2M4N A;  1FXI A;  1WIA A;  1VD2 A;  2OOA A;  3BXW A;  2F5O A;  3A33 B;  1YIW A;  2LJ5 A;  1PXV A;  4L78 A;  2GHU A;  5DPS A;  1IFY A;  4FLH A;  1NB5 A;  1AU3 A;  1QOA A;  2OZ2 A;  2L0T A;  4IG7 B;  2LGY A;  3PTF C;  1A70 A;  3MK6 A;  1EF7 A;  3GLI E;  1NJF A;  2DWL A;  2FUH B;  3AEG B;  1A5R A;  3ZQJ A;  1Z5B A;  3P5U A;  3ZO5 B;  3NS1 A;  1R4N B;  3HJS A;  3NY5 A;  5ITX A;  3B74 A;  1AAR A;  1FH0 A;  1V5T A;  1MIR A;  2IDY A;  5IA7 A;  2I2Y A;  4GC5 A;  4KIK B;  2M1M A;  1XEE A;  1HQR D;  3M3J A;  3Q6B A;  4DV0 M;  4GHA A;  1NJG A;  3K8U A;  3D32 A;  1WGR A;  3PDF A;  2E03 A;  1Q3B A;  1K51 A;  3AV8 A;  3L16 A;  4E71 A;  5KQ8 A;  1SIJ A;  4HK2 A;  3KW9 A;  1KFU L;  2C96 A;  2ACT A;  2C99 A;  4O1N A;  3J81 S;  1SXJ A;  1OAI A;  1EO6 A;  3GRU A;  5LNK 1;  1V5O A;  4IWP A;  1SBB B;  1IBX A;  1FD6 A;  2FAZ A;  3BII D;  1H8C A;  1V1O A;  2DCA A;  3PVS A;  3GE8 C;  2XFS A;  1V80 A;  5TSS A;  3NZ3 A;  1C1Y B;  1QLB B;  4W9E A;  3I04 M;  3RVV A;  5EQT A;  3SDL C;  3PFI A;  1ROE A;  2JXN A;  2LRU A;  1OAO C;  2KWV B;  2WXR A;  1SE3 A;  1V81 A;  3IVF A;  2J7N A;  1ESF A;  2PMV A;  2R2O A;  1WM2 A;  1NLJ A;  4DXF A;  4WAA A;  2ATO A;  4I8O A;  4HWY A;  1L0X B;  4KLN A;  3NZS A;  1GEC E;  1AYF A;  4OX9 M;  3MJ5 A;  1YN4 A;  1IXZ A;  3GPY A;  4ARI A;  1SSN A;  4YYQ A;  4KGT A;  1EWY C;  1DV0 A;  2BDZ A;  2JVC A;  1VJK A;  2AEH A;  2DAK A;  3VKG A;  4CHK A;  2FIF A;  3KOZ E;  1WR1 B;  3C8Y A;  2H7J A;  3Q8F A;  4DHZ B;  3PNR A;  4CIZ A;  2ZJD A;  4K0K M;  3DVG X;  3WCQ A;  2C9W B;  1IGC A;  1GAQ B;  2BKR B;  5DPT A;  3SFE B;  3Q2A C;  2O6V B;  3LCV B;  4NQL B;  1D6E C;  3SAW A;  3EC8 A;  2KRU A;  4FVM A;  3IT4 B;  3K9P B;  3PGE A;  4B6W A;  1JAL A;  1ZP0 B;  2LWX A;  1G3I A;  1NYQ A;  1XLO A;  3B7N A;  1PPO A;  1YK7 A;  2EA0 A;  4TUW A;  4WWO A;  4FA6 A;  2PW9 A;  3U7D A;  4XK8 F;  3KSE A;  4USA A;  2IBI A;  2IGG A;  3H8C A;  4ZDV A;  2KX0 A;  4GXB A;  4A3O A;  4JI5 M;  2ZPY A;  4JI0 M;  2ZW1 A;  4I4L A;  4IJF A;  1SB3 C;  3B1L X;  1C4P A;  2MWS B;  3SYK A;  1EF1 A;  3KWL A;  1MEG A;  4CJ6 A;  2V1U A;  2L1A A;  1ZMV A;  3HWS A;  1E7U A;  4OVZ B;  2VH1 A;  3PRM B;  1K52 A;  2CJN A;  2WLB A;  2D2Q A;  4Z8X A;  3GLI B;  1GMY A;  1ZPS A;  2EO2 A;  1NVM A;  2CR5 A;  3AJI B;  4IW0 A;  2D7G A;  1L1T A;  1TL9 A;  1KLU D;  3GQ3 A;  1QUT A;  2XSZ A;  4FCV A;  5EXP A;  2R61 A;  1J0G A;  1T43 A;  4IBI A;  2FYE A;  4CDD B;  2CV2 A;  2H88 B;  1IY0 A;  4GIT A;  3Q8E A;  4GGQ A;  4KVG B;  4E74 A;  3VH4 B;  3W1Y A;  2XFT A;  4MGK E;  4LF5 M;  2DNF A;  3M63 B;  1WXQ A;  2KVR A;  3DBR B;  1IBK M;  1TS5 A;  3WAN A;  3ZH9 B;  4NY0 A;  3GCB A;  3WIM A;  2KRK A;  3SAU A;  3RGP A;  3BCN A;  1IN7 A;  2KTR B;  5K16 A;  4US8 A;  3I5J C;  2XU4 A;  5ITQ A;  1VDD A;  5JH5 C;  1TY0 A;  2DAE A;  4KV2 A;  2NQA A;  1L4Z B;  1PM5 A;  2K3U A;  4CGY B;  4NRW A;  2H5X A;  2KN5 A;  2V4L A; 
#chains in the Genus database with same CATH homology
 4FWD A;  4FD2 A;  2DVW B;  1P7F A;  1TH3 A;  5HI1 A;  4HJG E;  1XC8 A;  1D4B A;  1QOB A;  4DV4 M;  3HUI A;  1GB1 A;  1BUI C;  3L27 A;  4AG5 A;  2BS2 B;  4X64 M;  3DOA A;  4DR6 M;  1DGG A;  1PFD A;  2RDG A;  2FNA A;  4IBB A;  4B08 A;  1VLB A;  2W3R A;  2QZ4 A;  3EGR A;  4IDI A;  2Y21 A;  1ZXH A;  4C56 C;  2QJL A;  2KZU A;  5FSW A;  3U6O A;  3CTW B;  4N59 A;  2BJW A;  5KO3 A;  3M7G A;  1FRR A;  4D82 A;  2WP9 B;  4LCB A;  4M9S A;  1NYR A;  3T1Y M;  4Z6Y A;  4RGN A;  4YHH M;  3Q8X A;  3L25 A;  1E6E B;  2OHF A;  3GPP A;  5EE0 A;  3M0E A;  1E9M A;  3TMP A;  4NXM M;  2HTM E;  2WXG A;  1TY2 A;  3EIH A;  4YT0 B;  2CHG A;  2JU6 X;  2KW0 A;  3ETR A;  4RCO A;  4JX1 C;  3TE6 A;  4IOI E;  4G4N A;  3U6P A;  3TWL A;  4J3O D;  2Y0T A;  3AE5 B;  1IN8 A;  1UWX A;  4OHJ A;  2ZBK B;  4D2K A;  3EUB 2;  3BOS A;  3LMM A;  4AI6 A;  5EZQ A;  3GQ4 A;  3V05 A;  1NY6 A;  2K22 A;  4HRS A;  2AGA A;  3EIE A;  2UUB M;  3W0F A;  3VDU A;  3UGJ A;  4OVZ A;  3FTE A;  3AEC B;  1QT9 A;  1SJH D;  3R8B A;  3DWM A;  4QNR A;  1UNS A;  3SHF A;  3K92 A;  4MGH A;  1UGJ A;  2WXH A;  3PT2 A;  2AQ1 B;  2BT6 A;  2SAK A;  2CHV A;  1JWA D;  4BB9 A;  4YWG G;  5G5G A;  2VZK B;  2TSS A;  3T3N A;  2UU9 M;  1TZO A;  1TS2 A;  5H37 D;  3JR4 A;  1EWC A;  3K8Z A;  1FJG M;  4PD2 A;  2XF3 A;  4YTP B;  2V0G A;  1KTK A;  1MVK A;  3V3X A;  4MGY E;  2ACZ B;  3LVW A;  1XLP A;  3UK6 A;  5MPO A;  3AOG A;  5ITX E;  1IGD A;  3BBA A;  2CHQ A;  4I5S A;  2Y0Q A;  2BJV A;  3HHY A;  3GO8 A;  2W55 A;  2DWN A;  3SAS A;  5FTN A;  2DWM A;  1Y56 A;  1D2N A;  2PTL A;  1SXJ E;  4HKQ A;  1ZXI A;  4DQO C;  2RMM A;  3OTO M;  1RYJ A;  4TSS A;  2YFQ A;  3SYL A;  4OZC A;  4JI6 M;  4IBF A;  1WRI A;  3ZJV A;  1G59 A;  1SF0 A;  4ARC A;  4NOO B;  4CHT B;  1PGB A;  4QHT A;  5EP4 A;  1C1K A;  1DGF A;  1IQP A;  2K47 A;  3E9S A;  2WXM A;  4RNA A;  1ZE3 D;  5BMH A;  2KEB A;  4JPS A;  2DZN B;  3HJ8 A;  4JI4 M;  2DYM A;  2F4V M;  1ET6 A;  2XGN A;  5BMG A;  3P1M A;  2WDV B;  1J7B A;  3PHX A;  2VII A;  4AQ7 A;  2WS3 B;  1QIL A;  5HG2 A;  3RPF C;  3AEF B;  4ZPX A;  4EIW A;  4GLS C;  3B9J A;  1I4H A;  4L15 A;  3ZC7 B;  5EZS A;  4RGO S;  5BR8 M;  4LGM A;  1C4A A;  3GS2 A;  3HVD A;  3SHG B;  2Z84 A;  1XMQ M;  5FKA C;  2I7P A;  1GPX A;  4AW4 A;  4FXC A;  1NSF A;  1N62 A;  2WU5 B;  1UWM A;  1MU5 A;  2F5Q A;  1YN5 A;  4AKG A;  2G5G X;  1XF5 L;  2AQ2 B;  1N75 A;  1KH0 A;  4DR3 M;  5FTK A;  3MP9 A;  1C9F A;  4KGR A;  1XLQ A;  4I81 A;  1KLG D;  1VZ7 A;  3OWE B;  2J52 A;  1F2R C;  2KA6 B;  2IGH A;  3U2S C;  4DR4 M;  1IBX B;  1D5Z C;  1HR0 M;  1AN8 A;  4HXD B;  3TSS A;  3NRZ A;  2G8L A;  3DA1 A;  3LXF A;  4AKI A;  1I94 M;  1TS4 A;  4BOZ A;  4A3V B;  2WQY B;  1IY1 A;  2XZU A;  3AOE C;  2EKI A;  2GI9 A;  4JE3 B;  2BB5 A;  1JRO A;  2YQZ A;  2ZW0 A;  1N34 M;  2UZJ A;  1HNX M;  3LYY A;  3KSJ A;  5JXV A;  4M0W A;  3WHL A;  1R2Z A;  2ZAN A;  4LJA A;  4A8X C;  1LO5 D;  1I4R A;  4B0E A;  1L4D B;  4YY3 M;  5EE1 A;  2HCB A;  2Z3X A;  1CZP A;  1GB4 A;  3FUX A;  1L5P A;  1UUP A;  1L6V A;  4XDD A;  5C3J B;  2L83 A;  5I4D A;  1L1Z A;  1D5M C;  3T15 A;  1ZDV A;  3NVY A;  2V4I B;  1J7K A;  3SBJ A;  5EXS A;  1OFF A;  4GKK M;  2J7O A;  1B9R A;  5C2T B;  2E6X A;  3O13 A;  1HNZ M;  4IJE A;  3TPZ A;  3SAT A;  5EP2 A;  4NZL B;  4LF9 M;  3FAH A;  2J4X A;  4B7F A;  1PUT A;  3KP1 E;  3J27 B;  3KOY E;  1N63 A;  2QCU A;  5IWA M;  3J80 S;  5FR3 A;  1G4A E;  4ZHP A;  3BYT B;  1F77 A;  4BBA A;  4IUM A;  2MH7 A;  1C78 A;  2JYT A;  2BTW A;  2LXE A;  3P4P B;  4BOS A;  5BPV A;  1V8C A;  1YJI A;  1DO2 A;  1AWD A;  3QWL A;  2KAC A;  1E9S A;  1PGA A;  2G9H D;  3JR5 A;  2KDM A;  1Z5C A;  4ZOH C;  1FFV A;  3C58 A;  3VKH A;  1DOI A;  4LF7 M;  2V3P A;  4G6Z A;  1G41 A;  3TWK A;  3PHU A;  4B3R M;  1OFI A;  4XWT A;  3AMZ A;  2W82 A;  1ZAE A;  1KYI A;  2Y20 A;  3D8L A;  4OZB A;  1BML C;  3L29 A;  1C4C A;  4B7G A;  2PVG C;  4RH6 A;  4NSR A;  4HL4 A;  3KVW A;  1IBM M;  2GRI A;  3L4P A;  2HL7 A;  1IY2 A;  2C98 A;  1STE A;  1QQR A;  4LZZ A;  2YEP F;  2X4A A;  3SAR A;  2HDE A;  1DOX A;  3HU1 A;  2H89 B;  2L09 A;  1JR3 D;  3MHZ A;  2I38 A;  2WXF A;  2JXT A;  3P63 A;  3TEY A;  3TUO A;  3W2D A;  5ITU A;  2BW2 A;  1FRD A;  4G4R A;  4D81 A;  3RNV A;  1ORY B;  4RKX A;  4GH9 A;  4AS1 A;  4L2Y A;  4C80 A;  1R7S A;  1SE2 A;  3W30 A;  4MH0 E;  1L2C A;  5D3I B;  3KSX A;  1MI0 A;  1V1P A;  3THG A;  3WHK A;  3L26 A;  2M60 A;  1MHH E;  2UXD M;  1XCT L;  3KLS X;  3O65 A;  1NY5 A;  3HU3 A;  1MPE A;  2ZM6 M;  1T3T A;  3BZD B;  4RF1 A;  4AG6 A;  3ZGZ A;  1FCC C;  4RGT A;  1R7R A;  5AUK A;  2HKJ A;  4LRT A;  1IBL M;  3MHV C;  4LTU A;  4YSZ B;  3GLG A;  4DUY M;  1ET9 A;  3VR8 B;  3I9V 1;  2YNM D;  2JWU A;  1Q10 A;  4DV1 M;  3VK8 A;  3P4R B;  2QPA A;  3ZNH A;  4FW9 A;  1NEK B;  2AX5 A;  1VDV A;  1DKI A;  3VDP A;  3PZ8 A;  5DNY A;  1IXR C;  1FFU A;  3FYC A;  1SXJ C;  1QAQ A;  1W5T A;  3IAS 1;  2PVO D;  4FWH A;  3SMP A;  5LMN M;  2Y5C A;  2W54 A;  4MH8 A;  4X62 M;  3CIR B;  2HWK A;  1TKE A;  4AQY M;  4XDC A;  3GQ5 A;  1HZ6 A;  4ZRQ A;  1ZUD 2;  2FOI C;  1N61 A;  2CUZ A;  4MAC A;  2X38 A;  3MP2 A;  4QHS A;  4WAF A;  2E5L M;  1WSP A;  3RFZ B;  1SEB D;  1ZDX A;  1RWS A;  2LMC A;  3T3O A;  3FUT A;  3KXE C;  2NTS A;  1K82 A;  3KW6 A;  3B21 A;  4H2A A;  3RE8 A;  4B3S M;  2JRI A;  2Y5P A;  1TKG A;  5JZE A;  1K3W A;  3OQC A;  1IN6 A;  5IZ7 D;  3TEW A;  4BOQ A;  4XE0 A;  3T1H M;  2JZP A;  3HU2 A;  1W5S A;  2PLP A;  3BVM A;  1N77 A;  1VRA B;  5BYR A;  3ABV B;  1QAM A;  2BNK A;  3BK2 A;  2A5Y B;  4ZRP A;  2C9O A;  3U6L A;  3AE2 B;  2KZS A;  3BVG A;  2R45 A;  1KRH A;  1FIQ A;  4WW0 A;  4DR5 M;  2DZO B;  1M4V A;  2KWD A;  4LF8 M;  2JA2 A;  5EXX A;  4KKI A;  1QKZ A;  4LJ6 A;  3IFU A;  2R62 A;  1D5X C;  3ZJT A;  1WWT A;  1E7P B;  4MGZ E;  3GB1 A;  4KGS A;  3GLH A;  1E32 A;  2C5R A;  1Q39 A;  4L4U A;  3LB8 C;  1DOY A;  3ZJU A;  1GOZ A;  4IIW A;  4DV3 M;  2LJI A;  4LJ7 A;  3FUW A;  2KQ4 X;  1TGU A;  4IBJ A;  2XN9 C;  4OU7 A;  2O5R A;  1FO4 A;  1PGX A;  2DWQ A;  3AE4 B;  1UKF A;  1R6B X;  2QSD A;  1XWI A;  2X49 A;  3KOX E;  2XLJ A;  1FNV A;  3IT6 B;  5A2Q S;  2Z4S A;  3Q8B A;  1DO0 A;  1UM8 A;  2VQE M;  3EA6 A;  2ICI A;  4JI7 M;  4EE2 A;  2YR0 A;  2D7E A;  4UDU C;  1P7E A;  4B3M M;  4GMQ A;  1I4G A;  3A42 A;  1KSF X;  3C0R A;  3KP0 E;  2M19 A;  4DR1 M;  5H92 C;  1BXT A;  1JWU D;  2FUG 1;  2UXB M;  2WXK A;  3U6D A;  4QNM A;  4GHL A;  3AED B;  4N58 A;  4L16 A;  2WXP A;  2CJO A;  4TQ0 A;  4HEA 1;  3D8B A;  1YE9 A;  1YQ3 B;  4R7G A;  2J7Q A;  2RGH A;  3AE1 B;  3U52 E;  4KKJ A;  2N7J A;  3BVZ A;  3VFD A;  2LHD A;  2INP E;  4DV6 M;  2DHR A;  4BOP A;  3IXS A;  8CAT A;  2R18 A;  1C79 A;  1FNU A;  5FTM A;  4A90 A;  2MJD A;  2QP9 X;  3P42 A;  4IBG A;  2Q2E B;  1JWM D;  3SR6 A;  2MEK A;  1XNQ M;  4D8I A;  2BB6 A;  4YTM B;  4MT5 A;  3UJN A;  4GRI A;  3URY A;  2SEB D;  5EP3 A;  5F3W A;  3AEA B;  1QQW A;  4GIP A;  1OQR A;  2BTW B;  4DR2 M;  5DYI A;  4YXD B;  4C7Z A;  4JN6 A;  2AQ3 B;  4JI3 M;  1KFV A;  1I4W A;  5HFY A;  2FFJ A;  4ZHO A;  2G1E A;  2WDR B;  2WXO A;  3PHW A;  3NVW A;  1RFK A;  3HRD D;  1DGB A;  3R8F A;  1DYQ A;  2ON8 A;  4HLQ A;  1C77 A;  2XNA C;  3HHZ A;  4XZX A;  4JI8 M;  2XEP A;  1IN5 A;  1YSY A;  1IXS B;  1QF6 A;  4LFC M;  4WIP A;  4X65 M;  4AKH A;  3U6Q A;  1GVN A;  5DYG A;  2RPV A;  1YNT E;  5FTL A;  2WXI A;  3UZU A;  4LLG M;  4XGI A;  3TQS A;  1G8P A;  3T38 A;  2HHH M;  3AL0 C;  1XHB A;  3ZCB B;  1XNR M;  2ONQ A;  4A9A A;  1F0Z A;  3NWL A;  3VR9 B;  1I4X A;  1TS3 A;  2LGI A;  1FEH A;  1SXT A;  4Q2J A;  1CJE A;  1FCL A;  3R2T A;  1EM7 A;  2ZAM A;  2KN4 A;  2L52 A;  4WWM A;  1V1P B;  1J7A A;  2LFI A;  3GRR A;  1IM2 A;  2QEN A;  1VZ6 A;  5GXG B;  2CV0 A;  1K53 A;  2NMQ A;  3GPU A;  2E3T A;  1WGK A;  1FNW A;  2V3N A;  3IG8 A;  2MJ3 A;  3KS4 A;  4NXN M;  2UUA M;  2Z7J A;  3GLG B;  4RFB A;  2QIE B;  1KF6 B;  1S3S A;  5JI2 E;  1E9R A;  3TWM A;  2K5P A;  2BBC A;  1XCQ L;  1HNW M;  2Z8L A;  3CWI A;  1E0Z A;  3FD9 A;  3IG5 A;  1YN3 A;  4YTN B;  3DFZ A;  2ZAO A;  1YUB A;  5FK9 C;  3JAM S;  1XMO M;  2BU3 A;  4R3D A;  5D3D A;  1GLN A;  1NNJ A;  4MB7 A;  3MC0 B;  3I4Y A;  1PYW D;  1QOG A;  2EEL A;  1J09 A;  3HJQ A;  2GB1 A;  5BMI A;  3K2L A;  2D7H A;  3W9C B;  2K0P A;  4D8B A;  1FNN A;  1KFY B;  3IAM 1;  4NL4 H;  1XXG A;  1TH4 A;  2FBW B;  3FKE A;  1FMA D;  3KWV A;  3W0L B;  3NBI A;  4ZTB A;  4GUA A;  5E26 A;  4LZJ A;  1ZOY B;  1YMH E;  1XXH B;  2LUM A;  4M9Z A;  4TQ1 A;  1CK1 A;  3UMM A;  4B0M A;  3PNY A;  3PO0 A;  1QAO A;  2R4E A;  1SXJ D;  2INN E;  1I4Q A;  1R2Y A;  4WQM A;  5IRE B;  3KS8 A;  1NEN B;  3ZQ4 A;  1TH2 A;  5FTJ A;  2R65 A;  2X8A A;  1NNU C;  1HEZ E;  1J5E M;  2CU3 A;  2N9L A;  1E10 A;  1MX0 A;  2UUC M;  3NVZ A;  4BOU A;  3HHX A;  3FIL A;  3FYD A;  3N9Y C;  2M5Z A;  3W31 A;  1JR3 A;  1JWS D;  4CIS A;  2V1C A;  4DUZ M;  3U6E A;  4PDG A;  1L0V B;  4D80 A;  1IN4 A;  4MGI E;  3NVV A;  3M6A A;  4HRO A;  3GLH B;  1T6B X;  3W5U B;  1N33 M;  1SE4 A;  4LK0 M;  4AZF A;  4IBE A;  3MFG A;  3TEZ A;  3TRK A;  5ITT A;  5EP1 A;  4X66 M;  3GP1 A;  5BYS A;  4B3T M;  4XWW A;  4QOS A;  3BB7 A;  3KDS E;  2M56 B;  2W3S A;  3FC4 A;  4DR7 M;  2YEP B;  4PCZ A;  1JRP A;  2CV1 A;  2JSV X;  4HKZ E;  4L8R C;  4ITQ A;  5G5H A;  4JXJ A;  1YZB A;  1XLN A;  3CF2 A;  3TEX A;  2WXL A;  3PSE A;  1LV7 A;  1QYR A;  5ITY A;  3AE6 B;  1K50 A;  1JCK B;  2XSZ D;  2IJ0 A;  2PKO A;  3AH7 A;  1V97 A;  2UXC M;  4GDK B;  1ACC A;  2B76 B;  1TJE A;  2DWZ B;  2R4J A;  1N32 M;  2JQR B;  3U60 A;  4NSO B;  1L2B A;  3FUU A;  3SMS A;  4REZ A;  2AHM A;  4FWG A;  4KO8 A;  3Q8C A;  2F5S A;  2BS3 B;  1HXY D;  2JX5 A;  4DV5 M;  3AE7 B;  1X37 A;  3J9C A;  2NTT A;  3R9X B;  3K1J A;  3AB5 A;  1N5X A;  2RKO A;  2I7N A;  4BLC A;  1XXH A;  3U5Z B;  2Z4R A;  4C7Y A;  3VRB B;  2K9X A;  3H8H A;  1F2R I;  4N6E B;  2LHE A;  4WH4 A;  1Z59 A;  3PXG A;  2DLB A;  4DV7 M;  2QEJ C;  4IBK A;  4PT5 A;  2L6O A;  2WXN A;  4A5U A;  1TKY A;  3RGS A;  1OFH A;  3I57 A;  3BWU D;  3J7A S;  1MHX A;  5C1B A;  2BTE A;  1PDX A;  3L2A A;  1TDZ A;  3VK7 A;  1NHW C;  1XO3 A;  4LGY A;  4L23 A;  2Y3A A;  4FCW A;  5FLX S;  4CQN A;  5LMU M;  1DGH B;  2OPF A;  2QBY B;  2LNH C;  2DBY A;  2KMM A;  1IUE A;  2R46 A;  4LJ4 A;  3GP7 A;  4G4Q A;  2N9K A;  3ILK A;  2ERC A;  3BY4 A;  3AN1 A;  1HA5 A;  4LJ9 A;  4KHP M;  4ZYS A;  3A98 B;  3R2I A;  1NVI D;  4LFB M;  2XH9 A;  3KOW E;  1I4P A;  4S12 A;  3AE8 B;  3NUH B;  5GKN A;  4US9 A;  2LEK A;  1HZ5 A;  3SAV A;  2M0A A;  4L1B A;  4YSX B;  4MI7 A;  1NI3 A;  4G4O A;  1C76 A;  4NAW B;  3SEB A;  3VQI A;  4DV2 M;  1L2D A;  4JWU C;  5C18 A;  3FTD A;  2V6Z M;  4GDL B;  4M0D A;  3VLF B;  3GLF B;  3PRM A;  2KAJ A;  2NQ8 C;  3GLI A;  1HQY E;  3U4E G;  1FXA A;  2JTC A;  1Q3C A;  1Z6T A;  1N5W A;  1N78 A;  4JV5 M;  4XBO A;  2N0S B;  3QAU A;  3AV0 A;  3UI3 A;  4JYA M;  5D7G A;  1EE8 A;  1JQJ C;  3U7Z A;  2QIL A;  2OQ4 A;  3LQR A;  1EU4 A;  4M9X A;  3HVZ A;  3RFW A;  5KPR A;  4RF0 A;  2VQF M;  1N36 M;  2OED A;  4LF6 M;  2D5G A;  3E56 A;  4OZA A;  4P6V F;  3U5Z A;  3BYY B;  1E94 E;  4LG2 A;  3U61 B;  3SC3 A;  1I7H A;  4YSY B;  5H8Y E;  3L28 A;  1GKI A;  1FM0 D;  3J7B A;  1ZQ9 A;  3U6C A;  2L7I A;  2FE8 A;  2Q5W D;  1GL7 A;  1EU3 A;  4WUR A;  4OW0 A;  4GKJ M;  3P4S B;  2QMT A;  4IBD A;  3AOE A;  1T3Q A;  2P5T A;  1QAN A;  5IT9 S;  2WXQ A;  3B9P A;  3DWG C;  4FCT A;  3TL4 X;  5KQD A;  3GPX A;  3HHW A;  1Z5A A;  3J2P B;  1PJI A;  2F5P A;  2MJE A;  1DGH A;  2LH0 A;  2QBY A;  1VR9 A;  3DZD A;  1QVR A;  1TDH A;  1K3X A;  5EE9 A;  3KQ4 A;  3LQQ A;  2PIA A;  4NRV A;  4IKG A;  3H4M A;  2DOS A;  1AW7 A;  3W5V B;  3MTV A;  4RGM A;  1PJJ A;  1JW9 D;  5T8I A;  3A45 A;  4GC9 A;  1N60 A;  4NJC A;  5BYQ A;  3ZYY X;  3AE9 B;  7CAT A;  3CF6 E;  3PNV A;  1YQ4 B;  4II7 A;  4ITK A;  3A46 A;  5ITR A;  2DYO A;  2WDQ B;  3HGI A;  2J7Q C;  4B7H A;  1VZ8 A;  1JQ4 A;  2WU2 B;  1T5X D;  3GLF A;  2J53 A;  3SFZ A;  1B1Z A;  3FUV A;  3I4V A;  2BYT A;  2VZK D;  3AKZ A;  1L0Y B;  1L6U A;  1QZM A;  3E4R A;  3B2F A;  5EJC A;  3HKP A;  4LJ8 A;  1SXJ B;  4IBC A;  4P16 A;  3AE3 B;  1HT1 E;  3FIL B;  1SJE D;  4A55 A;  3GRY A;  4PDI A;  3BK1 A;  5KPZ A;  4DXG A;  2DXI A;  4KOD A;  1PVJ A;  1J7C A;  1OQQ A;  2EUC A;  5AUI A;  2CE7 A;  4D8E A;  4LY6 A;  1HT2 E;  2CFO A;  4LF4 M;  2H1R A;  3CF0 A;  2J42 A;  3PZ7 A;  3AFH A;  1RM6 C;  3U61 A;  3P4Q B;  2L32 A;  3Q8A A;  4LRS A;  5HHD G;  5EXT A;  5EE3 A;  4JWS C;  1JWB D;  4QOZ C;  3SFD B;  2L7H A;  3FTF A;  1HQC A;  3LVV A;  3I51 A;  4LJ5 A;  2C9C A;  1ENF A;  2F5N A;  1WYG A;  4JI1 M;  1JML A;  4W5W A;  3W1S A;  2IGD A;  2JYE A;  2BS4 B;  1DGJ A;  3AEE B;  3PRP A;  1L8Q A;  3AM9 A;  1TYG B;  1QOF A;  3VRA B;  1GL6 A;  5E6J A;  3U6S A;  4TMA B;  2CEA A;  4JI2 M;  2RGO A;  1CQV A;  4A6Q A;  4LFA M;  4MM3 B;  3GRV A;  2WXJ A;  3FTC A;  3U60 B;  3KFU G;  3B2G A;  5JI3 E;  4KX6 B;  1NHG C;  2IPK D;  1H6U A;  2WNM A;  2RDH A;  4NAM A;  2KXE A;  3AEB B;  4IP3 A;  1YJJ A;  5KPT A;  3U6M A;  3Q69 A;  1OJL A;  2XZF A;  1FXI A;  2F5O A;  4L78 A;  1QOA A;  1A70 A;  3MK6 A;  1NJF A;  2DWL A;  3AEG B;  1Z5B A;  3NS1 A;  3HJS A;  5ITX A;  2IDY A;  2I2Y A;  4GC5 A;  1XEE A;  1HQR D;  4DV0 M;  4GHA A;  1NJG A;  1Q3B A;  1K51 A;  3AV8 A;  5KQ8 A;  1SIJ A;  2C96 A;  2C99 A;  4O1N A;  3J81 S;  1SXJ A;  5LNK 1;  3GRU A;  1SBB B;  1IBX A;  1FD6 A;  3BII D;  1V1O A;  3PVS A;  2XFS A;  5TSS A;  3NZ3 A;  1QLB B;  5EQT A;  3PFI A;  1ROE A;  2WXR A;  1SE3 A;  2J7N A;  1ESF A;  2PMV A;  4DXF A;  4I8O A;  1L0X B;  4KLN A;  1AYF A;  4OX9 M;  3MJ5 A;  1YN4 A;  1IXZ A;  3GPY A;  4ARI A;  1SSN A;  4KGT A;  1EWY C;  1VJK A;  3VKG A;  3KOZ E;  3C8Y A;  3Q8F A;  4K0K M;  3WCQ A;  1IGC A;  1GAQ B;  3SFE B;  1D6E C;  3SAW A;  2KRU A;  4FVM A;  3IT4 B;  1JAL A;  1ZP0 B;  2LWX A;  1G3I A;  1NYQ A;  1XLO A;  2EA0 A;  4TUW A;  2PW9 A;  4USA A;  2IGG A;  4JI5 M;  4JI0 M;  2ZW1 A;  4I4L A;  4IJF A;  1SB3 C;  1C4P A;  3SYK A;  3KWL A;  2V1U A;  2L1A A;  3HWS A;  4OVZ B;  1K52 A;  2CJN A;  2WLB A;  4Z8X A;  3GLI B;  1ZPS A;  2EO2 A;  1NVM A;  3AJI B;  2D7G A;  1L1T A;  1KLU D;  3GQ3 A;  2XSZ A;  4FCV A;  5EXP A;  2R61 A;  4IBI A;  2CV2 A;  2H88 B;  1IY0 A;  4GIT A;  3Q8E A;  2XFT A;  4MGK E;  4LF5 M;  1WXQ A;  1IBK M;  1TS5 A;  3ZH9 B;  2KRK A;  3SAU A;  3RGP A;  1IN7 A;  4US8 A;  5ITQ A;  1VDD A;  1TY0 A;  1L4Z B;  1PM5 A;  2K3U A;  4CGY B;  4NRW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...