7PCKA

Crystal structure of wild type human procathepsin k
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
314
structure length
314
Chain Sequence
LYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of wild-type human procathepsin K.
pubmed rcsb
molecule tags Hydrolase
molecule keywords PROTEIN (PROCATHEPSIN K)
total genus 66
structure length 314
sequence length 314
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 1998-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08246 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 7pckA00
1EWOA 1MS6A 1ME4A 1U5IA 3N4CA 3NHEA 4ZUXU 1MIRA 1MEMA 5PADA 2PBHA 2FRQA 2G8EA 4QRGA 3BOWA 1CQDA 2NQDB 3LFYA 3BPMA 1YK8A 3AI8A 3P5XA 2O6XA 1NB3A 1EF7A 2GFOA 2F1GA 2HHNA 3KKUA 4CDFB 1CPJA 1Y08A 4W5CA 4PADA 4BS6A 3O1GA 4CDDB 2DCAA 2AIMA 5J94A 3HD3A 5CHVA 3E1ZB 3C9EA 1KHPA 2FRAA 1F29A 4BPVA 3IV2A 3N3GA 5CHTA 4FIPA 1NL6A 4HWYA 3IUTA 1TU6A 3H7DA 1X9YA 2XU4A 1EWLA 2DCDA 4Q8GA 2OP3A 1YT7A 5CVMA 2DZYA 1PBHA 1GCBA 3BWKA 7PCKA 2YJBA 4I05A 4W5BA 4X6IA 4P6EA 5A24A 2OZ2A 2DC8A 4FJCA 2P7UA 4OEMA 3TNXA 2XU5A 4QRXA 1CJLA 2G7YA 3OISA 2Y6EA 2FQ9A 4MZOA 2HH5A 2BDZA 3BC3A 2FT2A 1M6DA 4YYWA 4QH6A 1EWPA 1CVZA 1Q6KA 1CTEA 1U9VA 1NPZA 1YK7A 4AXLA 3OF9A 1PPPA 1U9QX 5K16A 2YJ9A 2YJ8A 1PE6A 4P6GA 4MSXA 2NQAA 2FYEA 1AIMA 5FPWA 1DEUA 5JH3A 1AYWA 1PPDA 1ZCMA 2AUZA 2OULA 3H89A 3I06A 1TLOA 5CVOB 4YYUA 2R9FA 1PPNA 1QDQA 2FO5A 1IWDA 2IPPB 2DC9A 2E00A 2YJ2A 3QJ3A 3F75A 3CH2X 4YYSA 2WBFX 1BY8A 1VSNA 4QRVA 1KXRA 1QOLA 2PREA 1GMYA 3QT4A 3D6SA 4PP2E 3K8UA 3IOQA 1YALA 1YVBA 2DZZA 4X6JA 3PDFA 3M99A 1XKGA 1MHWA 2PNSA 2VHSA 3F5VA 4W4UA 4AXMA 3MHHA 3CH3X 2P0RA 3QSDA 1MDWA 1S4VA 2R9OA 5CVNB 4OELA 2DCCA 1MEGA 2XU3A 4MZSA 3N3KA 2R6NA 1AU2A 4WA6A 3KWZA 4CDCB 3MORA 3USVA 1PADA 1CS8A 2P86A 2ACTA 2R9MA 4K7CA 3DF0A 4YV8A 3RVWA 2R9NA 4X6HA 1AECA 3H8BA 2H7JA 1SNKA 2ATOA 2XU1A 2VHFA 1CSBB 1VJVA 4PP1A 3CBKA 2AS8A 4QBBA 1NQCA 2R9CA 1AU4A 1KFUL 1QMYA 1KFXL 1F2CA 4YVAA 4N79A 1BQIA 2Y5BA 2B1MA 3S3QA 2FTDA 3PNRA 1AYUA 1ZIVA 1A6RA 2NQIA 1NB5A 1AU0A 3BPFA 3GCBA 4RY2A 3U8EA 4CDEB 2AUXA 3RVXA 4KLBA 3P5UA 1AU3A 1Y4HA 3MHSA 1GLOA 2DCBA 3BCNA 2DC7A 1O0EA 4Q8HA 4N4ZA 2AYNA 4BSQA 4YYQA 1CV8A 3RVVA 1THEA 1FH0A 3H6SA 1EWMA 2DC6A 3KFQA 1ITOA 5JA7A 1ATKA 3ZUAA 2IBIA 2NQGA 1SP4B 4DMXA 3PBHA 2HD5A 4FK5A 1JQPA 1F2BA 3V6EA 1TL9A 3KW9A 5F02A 2C0YA 2CB5A 3P5VA 3O0UA 4DMYA 5EGWA 1KHQA 3HHAA 3K24A 1DF0A 3HHIA 6PADA 4CZWA 1ME3A 2JQGR 1CB5A 3LXSA 3KWBX 2E02A 1PXVA 3KX1A 3WXGA 2BDLA 1ICFA 3K9MA 2G6DA 2PADA 3KSEA 4PI3A 2B1NA 1U9XA 3WXFA 2CIOA 4YYRA 4XUIA 1BGOA 3IHPA 8PCHA 4G54A 1PPOA 1POPA 2YJCA 2AYOA 2FUDA 4N8WA 5EF4A 2HXZA 1PCIA 1BP4A 2F7DA 3P5WA 2E01A 1F2AA 3H8CA 9PAPA 3I3TA 1PIPA 4YYVA 3S3RA 1NLJA 3MTNA 3PW3A 2GHUA 3B79A 1U9WA 1AYVA 3WXEA 1GECE 2AVWA 1STFE 3HWNA 3V6CA 2ARYA 1HUCB 2AU1A 3OVXA 3IMAA 3OVZA 3IEJA 1QXPA 2E03A 4BS5A 4I07A 2DJFB 2JQFR 3CBJA 1K3BB 4XR7A 3OF8A 4I04A 2DJGB 3ERVA 2G8JA 4BQVA
chains in the Genus database with same CATH superfamily
1EWOA 1MS6A 4OVZB 1ME4A 1U5IA 3N4CA 3NHEA 4ZUXU 1MIRA 1MEMA 5PADA 4REZA 2PBHA 2FRQA 2G8EA 4QRGA 3BOWA 1CQDA 2NQDB 3LFYA 3BPMA 1YK8A 3W31A 3AI8A 3P5XA 2O6XA 1NB3A 1EF7A 2GFOA 2F1GA 2HHNA 3KKUA 4RKXA 4CDFB 2DOSA 1CPJA 4BOUA 1Y08A 4W5CA 2HWKA 4PADA 4BS6A 4WURA 3O1GA 4CDDB 2DCAA 2AIMA 5J94A 3HD3A 5CHVA 4A5UA 3E1ZB 3C9EA 1KHPA 2FRAA 1F29A 4BPVA 3IV2A 3N3GA 5CHTA 5EZQA 4FIPA 1NL6A 4HWYA 3IUTA 1TU6A 3H7DA 4GUAA 1X9YA 2XU4A 1EWLA 4BOQA 2DCDA 4Q8GA 2OP3A 1YT7A 5CVMA 2DZYA 3B21A 4XZXA 1PBHA 1GCBA 3BWKA 7PCKA 2YJBA 4I05A 4W5BA 4X6IA 4P6EA 5A24A 2OZ2A 2DC8A 4FJCA 2P7UA 4OEMA 3TNXA 4ZTBA 2XU5A 4QRXA 1CJLA 2BTWB 2G7YA 4R3DA 3OISA 2JTCA 2Y6EA 2FQ9A 4MZOA 2HH5A 4IUMA 2BDZA 4D8EA 3BC3A 2FT2A 2J7QC 2AGAA 4OVZA 1M6DA 4YYWA 4QH6A 1EWPA 1CVZA 1Q6KA 5E6JA 4IP3A 1CTEA 1U9VA 1NPZA 1YK7A 4AXLA 3OF9A 1PPPA 1U9QX 3BBAA 5K16A 2YJ9A 2YJ8A 1PE6A 4P6GA 4MSXA 2NQAA 2JRIA 2FYEA 1AIMA 4OW0A 5FPWA 1DEUA 5JH3A 1AYWA 3PHXA 1PPDA 1ZCMA 2AUZA 2OULA 3H89A 3I06A 1TLOA 5CVOB 4YYUA 3PHWA 2R9FA 3PHUA 1PPNA 4HXDB 1QDQA 2FO5A 1IWDA 2IPPB 2DC9A 2E00A 3C0RA 2YJ2A 4RF1A 3E9SA 3QJ3A 3F75A 3CH2X 4YYSA 2WBFX 1BY8A 1VSNA 4QRVA 1KXRA 1QOLA 2PREA 1GMYA 3QT4A 3D6SA 4PP2E 3K8UA 3IOQA 1YALA 1YVBA 2DZZA 4X6JA 3PDFA 3M99A 1XKGA 1MHWA 2PNSA 2VHSA 4MM3B 3F5VA 4W4UA 4AXMA 3MHHA 3PT2A 3CH3X 2P0RA 3QSDA 1MDWA 3IFUA 1S4VA 3MP2A 2R9OA 5CVNB 1PVJA 4OELA 2J7QA 2DCCA 1MEGA 2XU3A 4MZSA 1YZBA 3N3KA 2R6NA 4BOPA 4MI7A 1AU2A 4WA6A 3KWZA 4CDCB 3MORA 3USVA 1PADA 1CS8A 2P86A 2ACTA 2R9MA 4K7CA 2FE8A 5JZEA 3DF0A 3TMPA 4YV8A 3RVWA 2R9NA 3PRPA 4X6HA 1AECA 3H8BA 3RNVA 2H7JA 1SNKA 2ATOA 2XU1A 3PSEA 2VHFA 1CSBB 1VJVA 4PP1A 4PT5A 3CBKA 2AS8A 4QBBA 1NQCA 2R9CA 1AU4A 3MTVA 1KFUL 1QMYA 1KFXL 1F2CA 4YVAA 4N79A 1BQIA 2Y5BA 2B1MA 3S3QA 2Z84A 2FTDA 3PNRA 1AYUA 1ZIVA 1A6RA 4BOZA 2NQIA 1NB5A 1AU0A 3BPFA 3GCBA 4RY2A 3U8EA 4CDEB 2AUXA 3RVXA 4KLBA 3W30A 3P5UA 1AU3A 1Y4HA 3MHSA 1GLOA 2DCBA 3BCNA 2DC7A 1O0EA 4Q8HA 4N4ZA 3BY4A 2AYNA 3MJ5A 4BSQA 4YYQA 1CV8A 3RVVA 1THEA 4BOSA 4RF0A 1FH0A 3H6SA 1EWMA 2DC6A 3KFQA 1ITOA 5JA7A 1ATKA 3ZUAA 5EZSA 2IBIA 2NQGA 1SP4B 4DMXA 3PBHA 2HD5A 4FK5A 1JQPA 1DKIA 1F2BA 3V6EA 1TL9A 3BB7A 3KW9A 5F02A 2C0YA 2CB5A 3P5VA 3O0UA 4DMYA 5EGWA 1KHQA 3HHAA 3K24A 1DF0A 3HHIA 6PADA 4CZWA 1ME3A 2JQGR 1CB5A 3LXSA 3KWBX 2E02A 1PXVA 3KX1A 3WXGA 2BDLA 1ICFA 3K9MA 4D8BA 2G6DA 2PADA 3KSEA 4PI3A 2B1NA 3PRMA 1U9XA 4P16A 3WXFA 2CIOA 4M0WA 4YYRA 4XUIA 1BGOA 3IHPA 8PCHA 4G54A 1PPOA 1POPA 2YJCA 2AYOA 2FUDA 4N8WA 5EF4A 2HXZA 1PCIA 1BP4A 2F7DA 3P5WA 2E01A 1F2AA 3H8CA 9PAPA 3I3TA 1PIPA 4YYVA 5KO3A 3S3RA 1NLJA 3MTNA 3PW3A 2GHUA 3B79A 1U9WA 1AYVA 3WXEA 1GECE 3TRKA 3OQCA 2AVWA 1STFE 3HWNA 3V6CA 2ARYA 1HUCB 2AU1A 2BTWA 3OVXA 3IMAA 3OVZA 3ZNHA 4D8IA 3IEJA 1QXPA 2E03A 4BS5A 2UZJA 4I07A 2DJFB 2JQFR 3CBJA 1K3BB 4XR7A 3OF8A 4RNAA 4I04A 2DJGB 1UKFA 3ERVA 2BU3A 2G8JA 3O65A 4BQVA
chains in the Genus database with same CATH topology
1EWOA 1MS6A 1ME4A 1U5IA 3N4CA 3NHEA 4ZUXU 1MIRA 1MEMA 5PADA 2PBHA 2FRQA 2G8EA 4QRGA 3BOWA 1CQDA 2NQDB 3LFYA 3BPMA 1YK8A 3AI8A 3P5XA 2O6XA 4NV7A 1NB3A 1EF7A 2GFOA 2F1GA 2HHNA 2VFBA 3KKUA 4CDFB 1CPJA 1Y08A 4W5CA 4PADA 4BS6A 3O1GA 4CDDB 2DCAA 2AIMA 5J94A 3HD3A 5CHVA 3E1ZB 3C9EA 1KHPA 2FRAA 1F29A 4BPVA 3IV2A 3N3GA 5CHTA 4FIPA 1NL6A 4HWYA 3IUTA 1TU6A 3H7DA 1X9YA 2XU4A 1EWLA 1GX3A 2DCDA 4Q8GA 2OP3A 1YT7A 5CVMA 2DZYA 1PBHA 1GCBA 3BWKA 7PCKA 2YJBA 4I05A 4W5BA 4X6IA 4P6EA 5A24A 2OZ2A 2DC8A 4FJCA 2P7UA 4OEMA 3TNXA 2XU5A 4QRXA 1CJLA 2G7YA 3OISA 2BSZA 2FQ9A 2Y6EA 4MZOA 2HH5A 2BDZA 3BC3A 2FT2A 1M6DA 4YYWA 4QH6A 1EWPA 1CVZA 1Q6KA 1CTEA 1U9VA 1NPZA 1YK7A 4AXLA 3OF9A 1PPPA 1U9QX 5K16A 2YJ9A 2YJ8A 1PE6A 4P6GA 4MSXA 2NQAA 2FYEA 1AIMA 5FPWA 1DEUA 5JH3A 1AYWA 1PPDA 1W5RA 1ZCMA 2AUZA 2OULA 3H89A 3I06A 1TLOA 5CVOB 4YYUA 2R9FA 1PPNA 1QDQA 4B55A 2FO5A 1IWDA 2IPPB 2DC9A 2E00A 2YJ2A 3QJ3A 3F75A 3CH2X 4YYSA 2WBFX 1BY8A 1VSNA 4QRVA 1KXRA 1QOLA 2PREA 1GMYA 3QT4A 4NV8A 3D6SA 4PP2E 3K8UA 3IOQA 1YALA 1YVBA 2DZZA 4X6JA 3PDFA 3M99A 1XKGA 1MHWA 2PNSA 2VHSA 3F5VA 4W4UA 4AXMA 1W4TA 3MHHA 3CH3X 2P0RA 3QSDA 1MDWA 1S4VA 2R9OA 5CVNB 4OELA 2DCCA 1MEGA 2XU3A 4MZSA 3N3KA 2R6NA 1AU2A 4WA6A 3KWZA 4CDCB 3MORA 3USVA 1PADA 1CS8A 2P86A 2ACTA 2R9MA 4K7CA 3DF0A 4YV8A 3RVWA 2R9NA 4X6HA 1AECA 3H8BA 2H7JA 1SNKA 2ATOA 2XU1A 2VHFA 1CSBB 1VJVA 4PP1A 3CBKA 2AS8A 4QBBA 1NQCA 2R9CA 1AU4A 1KFUL 1QMYA 1KFXL 1F2CA 4YVAA 4N79A 1BQIA 2Y5BA 2B1MA 3S3QA 2FTDA 3PNRA 1AYUA 4C5PA 1ZIVA 1A6RA 2NQIA 1NB5A 1AU0A 3BPFA 3GCBA 4RY2A 3U8EA 4CDEB 2AUXA 3RVXA 4KLBA 3P5UA 1AU3A 1Y4HA 3MHSA 1GLOA 2DCBA 3BCNA 4GUZA 2DC7A 1O0EA 4Q8HA 4N4ZA 1W6FA 2AYNA 4BSQA 4YYQA 1CV8A 3RVVA 1THEA 1FH0A 3H6SA 1EWMA 2DC6A 3LTWA 3KFQA 1ITOA 5JA7A 1ATKA 3ZUAA 1E2TA 2IBIA 2NQGA 1SP4B 4DMXA 3PBHA 2HD5A 4FK5A 1JQPA 1F2BA 3V6EA 1TL9A 3KW9A 5F02A 2C0YA 3D9WA 2CB5A 3P5VA 3O0UA 4DMYA 5EGWA 1KHQA 3HHAA 3K24A 1DF0A 3HHIA 6PADA 4BGFA 4CZWA 1ME3A 2JQGR 1CB5A 3LXSA 3KWBX 2E02A 1PXVA 3KX1A 3WXGA 2BDLA 1ICFA 3K9MA 2G6DA 2PADA 3KSEA 4PI3A 2B1NA 1U9XA 3WXFA 2CIOA 4YYRA 4XUIA 1BGOA 3IHPA 8PCHA 4G54A 1PPOA 1POPA 2YJCA 2AYOA 2FUDA 4N8WA 5EF4A 2HXZA 1PCIA 1BP4A 2F7DA 3P5WA 2E01A 1F2AA 3H8CA 9PAPA 3I3TA 1PIPA 4YYVA 3S3RA 1NLJA 3MTNA 3PW3A 2GHUA 3B79A 1U9WA 1AYVA 3WXEA 1GECE 2AVWA 1STFE 3HWNA 3V6CA 2ARYA 1HUCB 2AU1A 3OVXA 2VFCA 3IMAA 3OVZA 3IEJA 1QXPA 2E03A 4BS5A 4I07A 2DJFB 2JQFR 3CBJA 1K3BB 4XR7A 3OF8A 4I04A 2DJGB 3ERVA 2G8JA 4BQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EWO A;  1MS6 A;  1ME4 A;  1U5I A;  3N4C A;  3NHE A;  4ZUX U;  1MIR A;  1MEM A;  5PAD A;  2PBH A;  2FRQ A;  2G8E A;  4QRG A;  3BOW A;  1CQD A;  2NQD B;  3LFY A;  3BPM A;  1YK8 A;  3AI8 A;  3P5X A;  2O6X A;  1NB3 A;  1EF7 A;  2GFO A;  2F1G A;  2HHN A;  3KKU A;  4CDF B;  1CPJ A;  1Y08 A;  4W5C A;  4PAD A;  4BS6 A;  3O1G A;  4CDD B;  2DCA A;  2AIM A;  5J94 A;  3HD3 A;  5CHV A;  3E1Z B;  3C9E A;  1KHP A;  2FRA A;  1F29 A;  4BPV A;  3IV2 A;  3N3G A;  5CHT A;  4FIP A;  1NL6 A;  4HWY A;  3IUT A;  1TU6 A;  3H7D A;  1X9Y A;  2XU4 A;  1EWL A;  2DCD A;  4Q8G A;  2OP3 A;  1YT7 A;  5CVM A;  2DZY A;  1PBH A;  1GCB A;  3BWK A;  7PCK A;  2YJB A;  4I05 A;  4W5B A;  4X6I A;  4P6E A;  5A24 A;  2OZ2 A;  2DC8 A;  4FJC A;  2P7U A;  4OEM A;  3TNX A;  2XU5 A;  4QRX A;  1CJL A;  2G7Y A;  3OIS A;  2Y6E A;  2FQ9 A;  4MZO A;  2HH5 A;  2BDZ A;  3BC3 A;  2FT2 A;  1M6D A;  4YYW A;  4QH6 A;  1EWP A;  1CVZ A;  1Q6K A;  1CTE A;  1U9V A;  1NPZ A;  1YK7 A;  4AXL A;  3OF9 A;  1PPP A;  1U9Q X;  5K16 A;  2YJ9 A;  2YJ8 A;  1PE6 A;  4P6G A;  4MSX A;  2NQA A;  2FYE A;  1AIM A;  5FPW A;  1DEU A;  5JH3 A;  1AYW A;  1PPD A;  1ZCM A;  2AUZ A;  2OUL A;  3H89 A;  3I06 A;  1TLO A;  5CVO B;  4YYU A;  2R9F A;  1PPN A;  1QDQ A;  2FO5 A;  1IWD A;  2IPP B;  2DC9 A;  2E00 A;  2YJ2 A;  3QJ3 A;  3F75 A;  3CH2 X;  4YYS A;  2WBF X;  1BY8 A;  1VSN A;  4QRV A;  1KXR A;  1QOL A;  2PRE A;  1GMY A;  3QT4 A;  3D6S A;  4PP2 E;  3K8U A;  3IOQ A;  1YAL A;  1YVB A;  2DZZ A;  4X6J A;  3PDF A;  3M99 A;  1XKG A;  1MHW A;  2PNS A;  2VHS A;  3F5V A;  4W4U A;  4AXM A;  3MHH A;  3CH3 X;  2P0R A;  3QSD A;  1MDW A;  1S4V A;  2R9O A;  5CVN B;  4OEL A;  2DCC A;  1MEG A;  2XU3 A;  4MZS A;  3N3K A;  2R6N A;  1AU2 A;  4WA6 A;  3KWZ A;  4CDC B;  3MOR A;  3USV A;  1PAD A;  1CS8 A;  2P86 A;  2ACT A;  2R9M A;  4K7C A;  3DF0 A;  4YV8 A;  3RVW A;  2R9N A;  4X6H A;  1AEC A;  3H8B A;  2H7J A;  1SNK A;  2ATO A;  2XU1 A;  2VHF A;  1CSB B;  1VJV A;  4PP1 A;  3CBK A;  2AS8 A;  4QBB A;  1NQC A;  2R9C A;  1AU4 A;  1KFU L;  1QMY A;  1KFX L;  1F2C A;  4YVA A;  4N79 A;  1BQI A;  2Y5B A;  2B1M A;  3S3Q A;  2FTD A;  3PNR A;  1AYU A;  1ZIV A;  1A6R A;  2NQI A;  1NB5 A;  1AU0 A;  3BPF A;  3GCB A;  4RY2 A;  3U8E A;  4CDE B;  2AUX A;  3RVX A;  4KLB A;  3P5U A;  1AU3 A;  1Y4H A;  3MHS A;  1GLO A;  2DCB A;  3BCN A;  2DC7 A;  1O0E A;  4Q8H A;  4N4Z A;  2AYN A;  4BSQ A;  4YYQ A;  1CV8 A;  3RVV A;  1THE A;  1FH0 A;  3H6S A;  1EWM A;  2DC6 A;  3KFQ A;  1ITO A;  5JA7 A;  1ATK A;  3ZUA A;  2IBI A;  2NQG A;  1SP4 B;  4DMX A;  3PBH A;  2HD5 A;  4FK5 A;  1JQP A;  1F2B A;  3V6E A;  1TL9 A;  3KW9 A;  5F02 A;  2C0Y A;  2CB5 A;  3P5V A;  3O0U A;  4DMY A;  5EGW A;  1KHQ A;  3HHA A;  3K24 A;  1DF0 A;  3HHI A;  6PAD A;  4CZW A;  1ME3 A;  2JQG R;  1CB5 A;  3LXS A;  3KWB X;  2E02 A;  1PXV A;  3KX1 A;  3WXG A;  2BDL A;  1ICF A;  3K9M A;  2G6D A;  2PAD A;  3KSE A;  4PI3 A;  2B1N A;  1U9X A;  3WXF A;  2CIO A;  4YYR A;  4XUI A;  1BGO A;  3IHP A;  8PCH A;  4G54 A;  1PPO A;  1POP A;  2YJC A;  2AYO A;  2FUD A;  4N8W A;  5EF4 A;  2HXZ A;  1PCI A;  1BP4 A;  2F7D A;  3P5W A;  2E01 A;  1F2A A;  3H8C A;  9PAP A;  3I3T A;  1PIP A;  4YYV A;  3S3R A;  1NLJ A;  3MTN A;  3PW3 A;  2GHU A;  3B79 A;  1U9W A;  1AYV A;  3WXE A;  1GEC E;  2AVW A;  1STF E;  3HWN A;  3V6C A;  2ARY A;  1HUC B;  2AU1 A;  3OVX A;  3IMA A;  3OVZ A;  3IEJ A;  1QXP A;  2E03 A;  4BS5 A;  4I07 A;  2DJF B;  2JQF R;  3CBJ A;  1K3B B;  4XR7 A;  3OF8 A;  4I04 A;  2DJG B;  3ERV A;  2G8J A;  4BQV A; 
#chains in the Genus database with same CATH topology
 1EWO A;  1MS6 A;  4OVZ B;  1ME4 A;  1U5I A;  3N4C A;  3NHE A;  4ZUX U;  1MIR A;  1MEM A;  5PAD A;  4REZ A;  2PBH A;  2FRQ A;  2G8E A;  4QRG A;  3BOW A;  1CQD A;  2NQD B;  3LFY A;  3BPM A;  1YK8 A;  3W31 A;  3AI8 A;  3P5X A;  2O6X A;  1NB3 A;  1EF7 A;  2GFO A;  2F1G A;  2HHN A;  3KKU A;  4RKX A;  4CDF B;  2DOS A;  1CPJ A;  4BOU A;  1Y08 A;  4W5C A;  2HWK A;  4PAD A;  4BS6 A;  4WUR A;  3O1G A;  4CDD B;  2DCA A;  2AIM A;  5J94 A;  3HD3 A;  5CHV A;  4A5U A;  3E1Z B;  3C9E A;  1KHP A;  2FRA A;  1F29 A;  4BPV A;  3IV2 A;  3N3G A;  5CHT A;  5EZQ A;  4FIP A;  1NL6 A;  4HWY A;  3IUT A;  1TU6 A;  3H7D A;  4GUA A;  1X9Y A;  2XU4 A;  1EWL A;  4BOQ A;  2DCD A;  4Q8G A;  2OP3 A;  1YT7 A;  5CVM A;  2DZY A;  3B21 A;  4XZX A;  1PBH A;  1GCB A;  3BWK A;  7PCK A;  2YJB A;  4I05 A;  4W5B A;  4X6I A;  4P6E A;  5A24 A;  2OZ2 A;  2DC8 A;  4FJC A;  2P7U A;  4OEM A;  3TNX A;  4ZTB A;  2XU5 A;  4QRX A;  1CJL A;  2BTW B;  2G7Y A;  4R3D A;  3OIS A;  2JTC A;  2Y6E A;  2FQ9 A;  4MZO A;  2HH5 A;  4IUM A;  2BDZ A;  4D8E A;  3BC3 A;  2FT2 A;  2J7Q C;  2AGA A;  4OVZ A;  1M6D A;  4YYW A;  4QH6 A;  1EWP A;  1CVZ A;  1Q6K A;  5E6J A;  4IP3 A;  1CTE A;  1U9V A;  1NPZ A;  1YK7 A;  4AXL A;  3OF9 A;  1PPP A;  1U9Q X;  3BBA A;  5K16 A;  2YJ9 A;  2YJ8 A;  1PE6 A;  4P6G A;  4MSX A;  2NQA A;  2JRI A;  2FYE A;  1AIM A;  4OW0 A;  5FPW A;  1DEU A;  5JH3 A;  1AYW A;  3PHX A;  1PPD A;  1ZCM A;  2AUZ A;  2OUL A;  3H89 A;  3I06 A;  1TLO A;  5CVO B;  4YYU A;  3PHW A;  2R9F A;  3PHU A;  1PPN A;  4HXD B;  1QDQ A;  2FO5 A;  1IWD A;  2IPP B;  2DC9 A;  2E00 A;  3C0R A;  2YJ2 A;  4RF1 A;  3E9S A;  3QJ3 A;  3F75 A;  3CH2 X;  4YYS A;  2WBF X;  1BY8 A;  1VSN A;  4QRV A;  1KXR A;  1QOL A;  2PRE A;  1GMY A;  3QT4 A;  3D6S A;  4PP2 E;  3K8U A;  3IOQ A;  1YAL A;  1YVB A;  2DZZ A;  4X6J A;  3PDF A;  3M99 A;  1XKG A;  1MHW A;  2PNS A;  2VHS A;  4MM3 B;  3F5V A;  4W4U A;  4AXM A;  3MHH A;  3PT2 A;  3CH3 X;  2P0R A;  3QSD A;  1MDW A;  3IFU A;  1S4V A;  3MP2 A;  2R9O A;  5CVN B;  1PVJ A;  4OEL A;  2J7Q A;  2DCC A;  1MEG A;  2XU3 A;  4MZS A;  1YZB A;  3N3K A;  2R6N A;  4BOP A;  4MI7 A;  1AU2 A;  4WA6 A;  3KWZ A;  4CDC B;  3MOR A;  3USV A;  1PAD A;  1CS8 A;  2P86 A;  2ACT A;  2R9M A;  4K7C A;  2FE8 A;  5JZE A;  3DF0 A;  3TMP A;  4YV8 A;  3RVW A;  2R9N A;  3PRP A;  4X6H A;  1AEC A;  3H8B A;  3RNV A;  2H7J A;  1SNK A;  2ATO A;  2XU1 A;  3PSE A;  2VHF A;  1CSB B;  1VJV A;  4PP1 A;  4PT5 A;  3CBK A;  2AS8 A;  4QBB A;  1NQC A;  2R9C A;  1AU4 A;  3MTV A;  1KFU L;  1QMY A;  1KFX L;  1F2C A;  4YVA A;  4N79 A;  1BQI A;  2Y5B A;  2B1M A;  3S3Q A;  2Z84 A;  2FTD A;  3PNR A;  1AYU A;  1ZIV A;  1A6R A;  4BOZ A;  2NQI A;  1NB5 A;  1AU0 A;  3BPF A;  3GCB A;  4RY2 A;  3U8E A;  4CDE B;  2AUX A;  3RVX A;  4KLB A;  3W30 A;  3P5U A;  1AU3 A;  1Y4H A;  3MHS A;  1GLO A;  2DCB A;  3BCN A;  2DC7 A;  1O0E A;  4Q8H A;  4N4Z A;  3BY4 A;  2AYN A;  3MJ5 A;  4BSQ A;  4YYQ A;  1CV8 A;  3RVV A;  1THE A;  4BOS A;  4RF0 A;  1FH0 A;  3H6S A;  1EWM A;  2DC6 A;  3KFQ A;  1ITO A;  5JA7 A;  1ATK A;  3ZUA A;  5EZS A;  2IBI A;  2NQG A;  1SP4 B;  4DMX A;  3PBH A;  2HD5 A;  4FK5 A;  1JQP A;  1DKI A;  1F2B A;  3V6E A;  1TL9 A;  3BB7 A;  3KW9 A;  5F02 A;  2C0Y A;  2CB5 A;  3P5V A;  3O0U A;  4DMY A;  5EGW A;  1KHQ A;  3HHA A;  3K24 A;  1DF0 A;  3HHI A;  6PAD A;  4CZW A;  1ME3 A;  2JQG R;  1CB5 A;  3LXS A;  3KWB X;  2E02 A;  1PXV A;  3KX1 A;  3WXG A;  2BDL A;  1ICF A;  3K9M A;  4D8B A;  2G6D A;  2PAD A;  3KSE A;  4PI3 A;  2B1N A;  3PRM A;  1U9X A;  4P16 A;  3WXF A;  2CIO A;  4M0W A;  4YYR A;  4XUI A;  1BGO A;  3IHP A;  8PCH A;  4G54 A;  1PPO A;  1POP A;  2YJC A;  2AYO A;  2FUD A;  4N8W A;  5EF4 A;  2HXZ A;  1PCI A;  1BP4 A;  2F7D A;  3P5W A;  2E01 A;  1F2A A;  3H8C A;  9PAP A;  3I3T A;  1PIP A;  4YYV A;  5KO3 A;  3S3R A;  1NLJ A;  3MTN A;  3PW3 A;  2GHU A;  3B79 A;  1U9W A;  1AYV A;  3WXE A;  1GEC E;  3TRK A;  3OQC A;  2AVW A;  1STF E;  3HWN A;  3V6C A;  2ARY A;  1HUC B;  2AU1 A;  2BTW A;  3OVX A;  3IMA A;  3OVZ A;  3ZNH A;  4D8I A;  3IEJ A;  1QXP A;  2E03 A;  4BS5 A;  2UZJ A;  4I07 A;  2DJF B;  2JQF R;  3CBJ A;  1K3B B;  4XR7 A;  3OF8 A;  4RNA A;  4I04 A;  2DJG B;  1UKF A;  3ERV A;  2BU3 A;  2G8J A;  3O65 A;  4BQV A; 
#chains in the Genus database with same CATH homology
 1EWO A;  1MS6 A;  1ME4 A;  1U5I A;  3N4C A;  3NHE A;  4ZUX U;  1MIR A;  1MEM A;  5PAD A;  2PBH A;  2FRQ A;  2G8E A;  4QRG A;  3BOW A;  1CQD A;  2NQD B;  3LFY A;  3BPM A;  1YK8 A;  3AI8 A;  3P5X A;  2O6X A;  4NV7 A;  1NB3 A;  1EF7 A;  2GFO A;  2F1G A;  2HHN A;  2VFB A;  3KKU A;  4CDF B;  1CPJ A;  1Y08 A;  4W5C A;  4PAD A;  4BS6 A;  3O1G A;  4CDD B;  2DCA A;  2AIM A;  5J94 A;  3HD3 A;  5CHV A;  3E1Z B;  3C9E A;  1KHP A;  2FRA A;  1F29 A;  4BPV A;  3IV2 A;  3N3G A;  5CHT A;  4FIP A;  1NL6 A;  4HWY A;  3IUT A;  1TU6 A;  3H7D A;  1X9Y A;  2XU4 A;  1EWL A;  1GX3 A;  2DCD A;  4Q8G A;  2OP3 A;  1YT7 A;  5CVM A;  2DZY A;  1PBH A;  1GCB A;  3BWK A;  7PCK A;  2YJB A;  4I05 A;  4W5B A;  4X6I A;  4P6E A;  5A24 A;  2OZ2 A;  2DC8 A;  4FJC A;  2P7U A;  4OEM A;  3TNX A;  2XU5 A;  4QRX A;  1CJL A;  2G7Y A;  3OIS A;  2BSZ A;  2FQ9 A;  2Y6E A;  4MZO A;  2HH5 A;  2BDZ A;  3BC3 A;  2FT2 A;  1M6D A;  4YYW A;  4QH6 A;  1EWP A;  1CVZ A;  1Q6K A;  1CTE A;  1U9V A;  1NPZ A;  1YK7 A;  4AXL A;  3OF9 A;  1PPP A;  1U9Q X;  5K16 A;  2YJ9 A;  2YJ8 A;  1PE6 A;  4P6G A;  4MSX A;  2NQA A;  2FYE A;  1AIM A;  5FPW A;  1DEU A;  5JH3 A;  1AYW A;  1PPD A;  1W5R A;  1ZCM A;  2AUZ A;  2OUL A;  3H89 A;  3I06 A;  1TLO A;  5CVO B;  4YYU A;  2R9F A;  1PPN A;  1QDQ A;  4B55 A;  2FO5 A;  1IWD A;  2IPP B;  2DC9 A;  2E00 A;  2YJ2 A;  3QJ3 A;  3F75 A;  3CH2 X;  4YYS A;  2WBF X;  1BY8 A;  1VSN A;  4QRV A;  1KXR A;  1QOL A;  2PRE A;  1GMY A;  3QT4 A;  4NV8 A;  3D6S A;  4PP2 E;  3K8U A;  3IOQ A;  1YAL A;  1YVB A;  2DZZ A;  4X6J A;  3PDF A;  3M99 A;  1XKG A;  1MHW A;  2PNS A;  2VHS A;  3F5V A;  4W4U A;  4AXM A;  1W4T A;  3MHH A;  3CH3 X;  2P0R A;  3QSD A;  1MDW A;  1S4V A;  2R9O A;  5CVN B;  4OEL A;  2DCC A;  1MEG A;  2XU3 A;  4MZS A;  3N3K A;  2R6N A;  1AU2 A;  4WA6 A;  3KWZ A;  4CDC B;  3MOR A;  3USV A;  1PAD A;  1CS8 A;  2P86 A;  2ACT A;  2R9M A;  4K7C A;  3DF0 A;  4YV8 A;  3RVW A;  2R9N A;  4X6H A;  1AEC A;  3H8B A;  2H7J A;  1SNK A;  2ATO A;  2XU1 A;  2VHF A;  1CSB B;  1VJV A;  4PP1 A;  3CBK A;  2AS8 A;  4QBB A;  1NQC A;  2R9C A;  1AU4 A;  1KFU L;  1QMY A;  1KFX L;  1F2C A;  4YVA A;  4N79 A;  1BQI A;  2Y5B A;  2B1M A;  3S3Q A;  2FTD A;  3PNR A;  1AYU A;  4C5P A;  1ZIV A;  1A6R A;  2NQI A;  1NB5 A;  1AU0 A;  3BPF A;  3GCB A;  4RY2 A;  3U8E A;  4CDE B;  2AUX A;  3RVX A;  4KLB A;  3P5U A;  1AU3 A;  1Y4H A;  3MHS A;  1GLO A;  2DCB A;  3BCN A;  4GUZ A;  2DC7 A;  1O0E A;  4Q8H A;  4N4Z A;  1W6F A;  2AYN A;  4BSQ A;  4YYQ A;  1CV8 A;  3RVV A;  1THE A;  1FH0 A;  3H6S A;  1EWM A;  2DC6 A;  3LTW A;  3KFQ A;  1ITO A;  5JA7 A;  1ATK A;  3ZUA A;  1E2T A;  2IBI A;  2NQG A;  1SP4 B;  4DMX A;  3PBH A;  2HD5 A;  4FK5 A;  1JQP A;  1F2B A;  3V6E A;  1TL9 A;  3KW9 A;  5F02 A;  2C0Y A;  3D9W A;  2CB5 A;  3P5V A;  3O0U A;  4DMY A;  5EGW A;  1KHQ A;  3HHA A;  3K24 A;  1DF0 A;  3HHI A;  6PAD A;  4BGF A;  4CZW A;  1ME3 A;  2JQG R;  1CB5 A;  3LXS A;  3KWB X;  2E02 A;  1PXV A;  3KX1 A;  3WXG A;  2BDL A;  1ICF A;  3K9M A;  2G6D A;  2PAD A;  3KSE A;  4PI3 A;  2B1N A;  1U9X A;  3WXF A;  2CIO A;  4YYR A;  4XUI A;  1BGO A;  3IHP A;  8PCH A;  4G54 A;  1PPO A;  1POP A;  2YJC A;  2AYO A;  2FUD A;  4N8W A;  5EF4 A;  2HXZ A;  1PCI A;  1BP4 A;  2F7D A;  3P5W A;  2E01 A;  1F2A A;  3H8C A;  9PAP A;  3I3T A;  1PIP A;  4YYV A;  3S3R A;  1NLJ A;  3MTN A;  3PW3 A;  2GHU A;  3B79 A;  1U9W A;  1AYV A;  3WXE A;  1GEC E;  2AVW A;  1STF E;  3HWN A;  3V6C A;  2ARY A;  1HUC B;  2AU1 A;  3OVX A;  2VFC A;  3IMA A;  3OVZ A;  3IEJ A;  1QXP A;  2E03 A;  4BS5 A;  4I07 A;  2DJF B;  2JQF R;  3CBJ A;  1K3B B;  4XR7 A;  3OF8 A;  4I04 A;  2DJG B;  3ERV A;  2G8J A;  4BQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...