7PCKA

Crystal structure of wild type human procathepsin k
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
314
structure length
314
Chain Sequence
b'LYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PROCATHEPSIN K)
publication title Crystal structure of wild-type human procathepsin K.
pubmed rcsb
molecule tags Hydrolase
total genus 66
structure length 314
sequence length 314
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 1998-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08246 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 7pckA00
1NQCA 3LXSA 2AYNA 1KFUL 1PPDA 2PNSA 2ACTA 2PREA 5CHVA 3B79A 2YJBA 3MHSA 2XU3A 1F29A 1O0EA 3C9EA 2NQGA 1POPA 3HHIA 5K16A 3O0UA 4BS5A 2IBIA 4OELA 5EGWA 4N79A 5F02A 4CDEB 3DF0A 4QRVA 2GFOA 1F2AA 2DCDA 4OEMA 3KFQA 2E01A 2DJFB 1VSNA 1ME4A 1AIMA 2CIOA 1FH0A 1ICFA 2YJCA 1KXRA 1TU6A 2P0RA 1CS8A 1BY8A 1ZCMA 1HUCB 1NB3A 3BWKA 3MTNA 4ZUXU 2E03A 4P6EA 3PNRA 2B1MA 4CDDB 2YJ8A 1BP4A 4BS6A 2P7UA 2JQGR 1KHQA 1U5IA 4AXLA 3KWBX 3P5XA 3HD3A 5CHTA 4DMXA 1ITOA 3H89A 3PBHA 1F2BA 2FT2A 4N4ZA 2AUXA 3CBJA 3N4CA 2VHSA 3RVVA 3RVWA 2OZ2A 1YK7A 3H8BA 4CDFB 1NB5A 2O6XA 4YYQA 4YYVA 3IEJA 3P5UA 1QXPA 3KW9A 3D6SA 1U9VA 4QRGA 2DZZA 1MHWA 4QRXA 3S3RA 1PADA 1U9WA 4YYSA 2Y5BA 4KLBA 1ZIVA 2IPPB 3E1ZB 2H7JA 3OISA 5PADA 3N3KA 4PP1A 1PBHA 2FO5A 2G8JA 5A24A 4XR7A 1AYVA 2AUZA 1GLOA 1YVBA 1PIPA 1CV8A 2NQAA 1NL6A 3I3TA 5FPWA 3IHPA 2FQ9A 2BDLA 3BPMA 2DC6A 3LFYA 4G54A 5CVNB 1EWLA 1CB5A 4CDCB 5CVOB 3IV2A 4Q8HA 4HWYA 3USVA 4W4UA 1EWMA 1YALA 1THEA 2AVWA 1PPNA 3KSEA 3HWNA 1AYWA 1X9YA 2R9FA 1PE6A 2E00A 3NHEA 2R9NA 1MDWA 2HH5A 3MORA 3RVXA 2HHNA 1PPPA 1XKGA 1AU4A 4CZWA 2FRQA 1STFE 2G7YA 1VJVA 1AECA 1JQPA 3IOQA 1PXVA 3BPFA 1BGOA 2DZYA 2FUDA 1EF7A 3F5VA 2DC7A 4X6JA 5J94A 5JH3A 1AU2A 4X6HA 1U9QX 4FK5A 3V6EA 4P6GA 4RY2A 4YVAA 2B1NA 3CBKA 3KX1A 3O1GA 4W5CA 1QMYA 1CVZA 3OVZA 4BQVA 4Q8GA 1QOLA 3K24A 1PCIA 3CH2X 3M99A 3OF9A 5EF4A 4YYRA 1U9XA 4MZSA 2AS8A 3TNXA 4YYWA 4DMYA 2DCCA 1GCBA 1ME3A 4I04A 1K3BB 2DJGB 2ARYA 3WXFA 1S4VA 7PCKA 3WXGA 3QJ3A 3P5WA 2F7DA 2XU5A 4MZOA 2R9CA 3H8CA 3AI8A 2OULA 1DEUA 2AIMA 3F75A 2BDZA 4PADA 2R9MA 2E02A 2XU4A 4W5BA 3K8UA 4QH6A 2PBHA 1DF0A 3PW3A 2DCAA 1CTEA 4PP2E 2VHFA 3IUTA 4QBBA 2G6DA 2XU1A 3H6SA 2DCBA 1A6RA 2G8EA 3BC3A 1NPZA 2WBFX 1MEGA 1YK8A 4WA6A 4BPVA 1TL9A 2NQIA 2DC9A 4FIPA 4X6IA 3OVXA 3MHHA 1SNKA 1SP4B 1Y4HA 3ERVA 3S3QA 1ATKA 3N3GA 2F1GA 3CH3X 3K9MA 2FRAA 3BCNA 3PDFA 2AYOA 3WXEA 3QT4A 6PADA 2Y6EA 3U8EA 3KWZA 9PAPA 3V6CA 1EWPA 3QSDA 2FTDA 1Y08A 2CB5A 5JA7A 1EWOA 2PADA 2R9OA 2HXZA 1KHPA 2GHUA 1GECE 2R6NA 4PI3A 4BSQA 2YJ2A 1CPJA 1MS6A 2HD5A 4I05A 1PPOA 1CJLA 1KFXL 1CQDA 1CSBB 1AU0A 4YYUA 1MIRA 5CVMA 3BOWA 3I06A 1NLJA 1IWDA 4AXMA 4N8WA 4MSXA 3KKUA 4I07A 1MEMA 2YJ9A 4YV8A 3GCBA 2NQDB 1M6DA 2DC8A 3OF8A 2C0YA 1GMYA 1BQIA 4K7CA 1AU3A 8PCHA 2ATOA 3HHAA 2JQFR 3ZUAA 1Q6KA 1TLOA 1YT7A 2AU1A 4XUIA 4FJCA 3H7DA 3P5VA 2FYEA 2OP3A 1QDQA 2P86A 3IMAA 1AYUA 1F2CA
chains in the Genus database with same CATH superfamily
1NQCA 3LXSA 2AYNA 1KFUL 1PPDA 2PNSA 3PSEA 2ACTA 2PREA 5CHVA 3B79A 2YJBA 3MHSA 2XU3A 1F29A 1O0EA 3C9EA 2NQGA 1POPA 3HHIA 5K16A 3O0UA 4BS5A 2IBIA 4OELA 3PRPA 5EGWA 4N79A 5F02A 4CDEB 3DF0A 4QRVA 4OW0A 3BY4A 2GFOA 4RNAA 1F2AA 2DCDA 4OEMA 3KFQA 2E01A 3BBAA 2DJFB 1VSNA 2J7QA 4MI7A 1ME4A 2BTWB 1AIMA 2CIOA 1FH0A 1ICFA 2YJCA 4IUMA 1KXRA 1TU6A 2P0RA 1CS8A 2AGAA 1BY8A 1ZCMA 1HUCB 1NB3A 4BOPA 4IP3A 3BWKA 3MTNA 4ZUXU 2E03A 4P6EA 4BOQA 3PNRA 2B1MA 4CDDB 2YJ8A 5E6JA 1BP4A 4BS6A 2P7UA 2JQGR 1KHQA 1U5IA 4AXLA 3KWBX 3P5XA 3HD3A 5CHTA 4DMXA 1ITOA 3H89A 3PBHA 1F2BA 4D8EA 2FT2A 4GUAA 4N4ZA 2AUXA 3CBJA 3N4CA 2VHSA 3RVVA 3RVWA 2OZ2A 1YK7A 3H8BA 4CDFB 1NB5A 2O6XA 3PT2A 4YYQA 4YYVA 3IEJA 2BU3A 3E9SA 3P5UA 2HWKA 3RNVA 1QXPA 3ZNHA 3KW9A 3D6SA 1U9VA 4OVZA 3MP2A 4QRGA 2DZZA 1MHWA 4QRXA 3S3RA 1PADA 1U9WA 4YYSA 4M0WA 2Y5BA 4KLBA 1ZIVA 4A5UA 3TMPA 2IPPB 3E1ZB 4P16A 4BOZA 2H7JA 3OISA 5PADA 3N3KA 4PP1A 1PBHA 2FO5A 2G8JA 5A24A 4BOUA 1DKIA 4XR7A 1AYVA 2AUZA 4MM3B 1GLOA 1YVBA 1PIPA 1CV8A 2NQAA 1NL6A 2DOSA 3I3TA 5FPWA 3IHPA 2FQ9A 2BDLA 3BPMA 3OQCA 2UZJA 3PHXA 1F2CA 2DC6A 3LFYA 3IFUA 4G54A 5CVNB 1EWLA 1CB5A 4CDCB 5CVOB 3IV2A 4Q8HA 4HWYA 3USVA 4W4UA 1EWMA 3BB7A 1YALA 1THEA 2AVWA 1PPNA 3KSEA 3HWNA 4BOSA 4OVZB 5JZEA 1AYWA 1X9YA 2R9FA 1PE6A 2E00A 3NHEA 3PHWA 2R9NA 1MDWA 2HH5A 3MORA 3RVXA 2HHNA 1PPPA 1XKGA 1AU4A 1YZBA 4CZWA 2FRQA 1STFE 2G7YA 1VJVA 1AECA 2J7QC 1JQPA 3IOQA 1PXVA 3BPFA 1BGOA 2DZYA 2FUDA 1EF7A 3F5VA 2DC7A 4X6JA 5J94A 5JH3A 1AU2A 4X6HA 1U9QX 4FK5A 3V6EA 4P6GA 4RY2A 4YVAA 2B1NA 3CBKA 3KX1A 3O1GA 4W5CA 1QMYA 1CVZA 3OVZA 4BQVA 4Q8GA 1QOLA 3K24A 1PCIA 3CH2X 3M99A 3OF9A 5EF4A 4YYRA 1U9XA 4MZSA 2AS8A 2FE8A 3TNXA 4YYWA 3B21A 4DMYA 2DCCA 1GCBA 1ME3A 4I04A 1K3BB 2DJGB 5EZSA 2ARYA 3WXFA 1S4VA 2JRIA 7PCKA 3WXGA 3QJ3A 1UKFA 3P5WA 2F7DA 2XU5A 4MZOA 2R9CA 3H8CA 4D8BA 3AI8A 2OULA 1DEUA 2AIMA 3F75A 2BDZA 4PADA 2Z84A 2JTCA 2R9MA 2E02A 2XU4A 4W5BA 3TRKA 3K8UA 4QH6A 2PBHA 1DF0A 5KO3A 3PW3A 2DCAA 1CTEA 4PP2E 2VHFA 4RF0A 3O65A 3PRMA 3IUTA 3PHUA 4QBBA 2G6DA 2XU1A 3H6SA 2DCBA 1A6RA 2G8EA 3BC3A 1NPZA 2WBFX 1MEGA 1YK8A 4WA6A 4BPVA 1TL9A 2NQIA 2DC9A 4FIPA 4X6IA 3OVXA 3MHHA 1SNKA 1SP4B 1Y4HA 3ERVA 3S3QA 1ATKA 3N3GA 2F1GA 3CH3X 4HXDB 3K9MA 3MTVA 2FRAA 4PT5A 4RKXA 3BCNA 3PDFA 2AYOA 3WXEA 3QT4A 6PADA 2Y6EA 3U8EA 3KWZA 9PAPA 3V6CA 1EWPA 3QSDA 3C0RA 2FTDA 1Y08A 2CB5A 5JA7A 1EWOA 2PADA 2R9OA 2HXZA 1KHPA 2GHUA 1GECE 2R6NA 4PI3A 4BSQA 2YJ2A 4RF1A 1CPJA 1MS6A 2HD5A 4I05A 1PPOA 1CJLA 1KFXL 1CQDA 1CSBB 1AU0A 4YYUA 1MIRA 5CVMA 3BOWA 3I06A 1NLJA 1IWDA 4WURA 4AXMA 4N8WA 3MJ5A 4MSXA 4D8IA 3KKUA 4I07A 1MEMA 2YJ9A 2BTWA 4YV8A 3GCBA 2NQDB 1M6DA 4R3DA 2DC8A 5EZQA 3OF8A 2C0YA 1GMYA 1BQIA 3W30A 4K7CA 1AU3A 8PCHA 4XZXA 2ATOA 3HHAA 2JQFR 3ZUAA 1Q6KA 1TLOA 1YT7A 2AU1A 4XUIA 4FJCA 3H7DA 3P5VA 2FYEA 2OP3A 4ZTBA 4REZA 3W31A 1QDQA 2P86A 3IMAA 1AYUA 1PVJA
chains in the Genus database with same CATH topology
1NQCA 3LXSA 2AYNA 1KFUL 1PPDA 2PNSA 2ACTA 2PREA 5CHVA 3B79A 2YJBA 3MHSA 2XU3A 4C5PA 1F29A 1O0EA 3C9EA 2NQGA 1POPA 3HHIA 5K16A 3O0UA 4BS5A 2IBIA 4OELA 5EGWA 4N79A 5F02A 4CDEB 3DF0A 4QRVA 2GFOA 1F2AA 2DCDA 4OEMA 3KFQA 2E01A 2DJFB 1VSNA 4B55A 1ME4A 1AIMA 2CIOA 1FH0A 1ICFA 2YJCA 1KXRA 1TU6A 2P0RA 1CS8A 1BY8A 1ZCMA 1HUCB 1NB3A 3BWKA 3MTNA 4ZUXU 2E03A 4P6EA 3PNRA 2B1MA 4CDDB 2YJ8A 1BP4A 4BS6A 2P7UA 2JQGR 1KHQA 1U5IA 4AXLA 3KWBX 3P5XA 3HD3A 5CHTA 4DMXA 1ITOA 3H89A 3PBHA 1F2BA 2FT2A 4N4ZA 2AUXA 2VFCA 3CBJA 3N4CA 2VHSA 3RVVA 3RVWA 2OZ2A 1YK7A 3H8BA 4CDFB 1NB5A 2O6XA 4NV7A 4YYQA 4YYVA 3IEJA 3P5UA 1QXPA 3KW9A 3D6SA 1U9VA 4GUZA 4QRGA 2DZZA 1MHWA 4QRXA 3S3RA 1PADA 1U9WA 4YYSA 2Y5BA 4KLBA 1ZIVA 2IPPB 3E1ZB 2H7JA 3OISA 5PADA 3N3KA 4PP1A 1PBHA 2FO5A 2G8JA 5A24A 4XR7A 1AYVA 2AUZA 1GLOA 1YVBA 1PIPA 1CV8A 2NQAA 1NL6A 3I3TA 5FPWA 3IHPA 2FQ9A 2BDLA 3BPMA 2DC6A 3LFYA 4G54A 5CVNB 1EWLA 1CB5A 4CDCB 5CVOB 1W6FA 3IV2A 4Q8HA 4HWYA 3USVA 4W4UA 1EWMA 1YALA 1THEA 2AVWA 1PPNA 3KSEA 3HWNA 1AYWA 1X9YA 2R9FA 1PE6A 2E00A 3NHEA 2R9NA 1MDWA 2HH5A 3MORA 3RVXA 2HHNA 1PPPA 1XKGA 1AU4A 4CZWA 2FRQA 1STFE 2G7YA 1VJVA 1AECA 1JQPA 3IOQA 1PXVA 3BPFA 1BGOA 2DZYA 2FUDA 1EF7A 3F5VA 2DC7A 4X6JA 5J94A 1W5RA 5JH3A 1AU2A 4X6HA 1U9QX 4FK5A 3V6EA 4P6GA 4RY2A 4YVAA 2B1NA 3CBKA 3KX1A 2VFBA 3O1GA 4W5CA 1QMYA 1CVZA 3OVZA 4BQVA 4Q8GA 1QOLA 3K24A 1PCIA 3CH2X 3M99A 3OF9A 5EF4A 4YYRA 1U9XA 4MZSA 2AS8A 4NV8A 3TNXA 4YYWA 4DMYA 2DCCA 1GCBA 1ME3A 4I04A 1K3BB 2DJGB 2ARYA 3WXFA 1S4VA 1E2TA 7PCKA 3WXGA 3QJ3A 3P5WA 2F7DA 2XU5A 4MZOA 2R9CA 3H8CA 3AI8A 2OULA 1DEUA 2AIMA 4BGFA 3F75A 2BDZA 3D9WA 4PADA 3LTWA 2R9MA 2E02A 2XU4A 4W5BA 3K8UA 4QH6A 2PBHA 1DF0A 3PW3A 2DCAA 1CTEA 4PP2E 2VHFA 3IUTA 4QBBA 2G6DA 2XU1A 3H6SA 2DCBA 1A6RA 2G8EA 3BC3A 1NPZA 2WBFX 1MEGA 1YK8A 4WA6A 4BPVA 1TL9A 2NQIA 2DC9A 4FIPA 4X6IA 3OVXA 3MHHA 1SNKA 1SP4B 1Y4HA 3ERVA 3S3QA 1ATKA 3N3GA 2F1GA 3CH3X 3K9MA 2FRAA 3BCNA 3PDFA 2AYOA 3WXEA 3QT4A 6PADA 2Y6EA 3U8EA 3KWZA 9PAPA 3V6CA 1EWPA 3QSDA 2FTDA 1Y08A 2CB5A 5JA7A 1EWOA 2PADA 2R9OA 2HXZA 1KHPA 2GHUA 1GECE 2R6NA 4PI3A 4BSQA 2YJ2A 1CPJA 1MS6A 2HD5A 4I05A 1PPOA 1CJLA 1KFXL 1CQDA 1CSBB 1AU0A 4YYUA 1MIRA 5CVMA 3BOWA 3I06A 1NLJA 1IWDA 4AXMA 4N8WA 4MSXA 1GX3A 3KKUA 4I07A 1MEMA 2YJ9A 4YV8A 3GCBA 2NQDB 1M6DA 2DC8A 3OF8A 2C0YA 1GMYA 1W4TA 1BQIA 4K7CA 1AU3A 8PCHA 2ATOA 3HHAA 2JQFR 3ZUAA 1Q6KA 1TLOA 1YT7A 2AU1A 2BSZA 4XUIA 4FJCA 3H7DA 3P5VA 2FYEA 2OP3A 1QDQA 2P86A 3IMAA 1AYUA 1F2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NQC A;  3LXS A;  2AYN A;  1KFU L;  1PPD A;  2PNS A;  2ACT A;  2PRE A;  5CHV A;  3B79 A;  2YJB A;  3MHS A;  2XU3 A;  1F29 A;  1O0E A;  3C9E A;  2NQG A;  1POP A;  3HHI A;  5K16 A;  3O0U A;  4BS5 A;  2IBI A;  4OEL A;  5EGW A;  4N79 A;  5F02 A;  4CDE B;  3DF0 A;  4QRV A;  2GFO A;  1F2A A;  2DCD A;  4OEM A;  3KFQ A;  2E01 A;  2DJF B;  1VSN A;  1ME4 A;  1AIM A;  2CIO A;  1FH0 A;  1ICF A;  2YJC A;  1KXR A;  1TU6 A;  2P0R A;  1CS8 A;  1BY8 A;  1ZCM A;  1HUC B;  1NB3 A;  3BWK A;  3MTN A;  4ZUX U;  2E03 A;  4P6E A;  3PNR A;  2B1M A;  4CDD B;  2YJ8 A;  1BP4 A;  4BS6 A;  2P7U A;  2JQG R;  1KHQ A;  1U5I A;  4AXL A;  3KWB X;  3P5X A;  3HD3 A;  5CHT A;  4DMX A;  1ITO A;  3H89 A;  3PBH A;  1F2B A;  2FT2 A;  4N4Z A;  2AUX A;  3CBJ A;  3N4C A;  2VHS A;  3RVV A;  3RVW A;  2OZ2 A;  1YK7 A;  3H8B A;  4CDF B;  1NB5 A;  2O6X A;  4YYQ A;  4YYV A;  3IEJ A;  3P5U A;  1QXP A;  3KW9 A;  3D6S A;  1U9V A;  4QRG A;  2DZZ A;  1MHW A;  4QRX A;  3S3R A;  1PAD A;  1U9W A;  4YYS A;  2Y5B A;  4KLB A;  1ZIV A;  2IPP B;  3E1Z B;  2H7J A;  3OIS A;  5PAD A;  3N3K A;  4PP1 A;  1PBH A;  2FO5 A;  2G8J A;  5A24 A;  4XR7 A;  1AYV A;  2AUZ A;  1GLO A;  1YVB A;  1PIP A;  1CV8 A;  2NQA A;  1NL6 A;  3I3T A;  5FPW A;  3IHP A;  2FQ9 A;  2BDL A;  3BPM A;  2DC6 A;  3LFY A;  4G54 A;  5CVN B;  1EWL A;  1CB5 A;  4CDC B;  5CVO B;  3IV2 A;  4Q8H A;  4HWY A;  3USV A;  4W4U A;  1EWM A;  1YAL A;  1THE A;  2AVW A;  1PPN A;  3KSE A;  3HWN A;  1AYW A;  1X9Y A;  2R9F A;  1PE6 A;  2E00 A;  3NHE A;  2R9N A;  1MDW A;  2HH5 A;  3MOR A;  3RVX A;  2HHN A;  1PPP A;  1XKG A;  1AU4 A;  4CZW A;  2FRQ A;  1STF E;  2G7Y A;  1VJV A;  1AEC A;  1JQP A;  3IOQ A;  1PXV A;  3BPF A;  1BGO A;  2DZY A;  2FUD A;  1EF7 A;  3F5V A;  2DC7 A;  4X6J A;  5J94 A;  5JH3 A;  1AU2 A;  4X6H A;  1U9Q X;  4FK5 A;  3V6E A;  4P6G A;  4RY2 A;  4YVA A;  2B1N A;  3CBK A;  3KX1 A;  3O1G A;  4W5C A;  1QMY A;  1CVZ A;  3OVZ A;  4BQV A;  4Q8G A;  1QOL A;  3K24 A;  1PCI A;  3CH2 X;  3M99 A;  3OF9 A;  5EF4 A;  4YYR A;  1U9X A;  4MZS A;  2AS8 A;  3TNX A;  4YYW A;  4DMY A;  2DCC A;  1GCB A;  1ME3 A;  4I04 A;  1K3B B;  2DJG B;  2ARY A;  3WXF A;  1S4V A;  7PCK A;  3WXG A;  3QJ3 A;  3P5W A;  2F7D A;  2XU5 A;  4MZO A;  2R9C A;  3H8C A;  3AI8 A;  2OUL A;  1DEU A;  2AIM A;  3F75 A;  2BDZ A;  4PAD A;  2R9M A;  2E02 A;  2XU4 A;  4W5B A;  3K8U A;  4QH6 A;  2PBH A;  1DF0 A;  3PW3 A;  2DCA A;  1CTE A;  4PP2 E;  2VHF A;  3IUT A;  4QBB A;  2G6D A;  2XU1 A;  3H6S A;  2DCB A;  1A6R A;  2G8E A;  3BC3 A;  1NPZ A;  2WBF X;  1MEG A;  1YK8 A;  4WA6 A;  4BPV A;  1TL9 A;  2NQI A;  2DC9 A;  4FIP A;  4X6I A;  3OVX A;  3MHH A;  1SNK A;  1SP4 B;  1Y4H A;  3ERV A;  3S3Q A;  1ATK A;  3N3G A;  2F1G A;  3CH3 X;  3K9M A;  2FRA A;  3BCN A;  3PDF A;  2AYO A;  3WXE A;  3QT4 A;  6PAD A;  2Y6E A;  3U8E A;  3KWZ A;  9PAP A;  3V6C A;  1EWP A;  3QSD A;  2FTD A;  1Y08 A;  2CB5 A;  5JA7 A;  1EWO A;  2PAD A;  2R9O A;  2HXZ A;  1KHP A;  2GHU A;  1GEC E;  2R6N A;  4PI3 A;  4BSQ A;  2YJ2 A;  1CPJ A;  1MS6 A;  2HD5 A;  4I05 A;  1PPO A;  1CJL A;  1KFX L;  1CQD A;  1CSB B;  1AU0 A;  4YYU A;  1MIR A;  5CVM A;  3BOW A;  3I06 A;  1NLJ A;  1IWD A;  4AXM A;  4N8W A;  4MSX A;  3KKU A;  4I07 A;  1MEM A;  2YJ9 A;  4YV8 A;  3GCB A;  2NQD B;  1M6D A;  2DC8 A;  3OF8 A;  2C0Y A;  1GMY A;  1BQI A;  4K7C A;  1AU3 A;  8PCH A;  2ATO A;  3HHA A;  2JQF R;  3ZUA A;  1Q6K A;  1TLO A;  1YT7 A;  2AU1 A;  4XUI A;  4FJC A;  3H7D A;  3P5V A;  2FYE A;  2OP3 A;  1QDQ A;  2P86 A;  3IMA A;  1AYU A;  1F2C A; 
#chains in the Genus database with same CATH topology
 1NQC A;  3LXS A;  2AYN A;  1KFU L;  1PPD A;  2PNS A;  3PSE A;  2ACT A;  2PRE A;  5CHV A;  3B79 A;  2YJB A;  3MHS A;  2XU3 A;  1F29 A;  1O0E A;  3C9E A;  2NQG A;  1POP A;  3HHI A;  5K16 A;  3O0U A;  4BS5 A;  2IBI A;  4OEL A;  3PRP A;  5EGW A;  4N79 A;  5F02 A;  4CDE B;  3DF0 A;  4QRV A;  4OW0 A;  3BY4 A;  2GFO A;  4RNA A;  1F2A A;  2DCD A;  4OEM A;  3KFQ A;  2E01 A;  3BBA A;  2DJF B;  1VSN A;  2J7Q A;  4MI7 A;  1ME4 A;  2BTW B;  1AIM A;  2CIO A;  1FH0 A;  1ICF A;  2YJC A;  4IUM A;  1KXR A;  1TU6 A;  2P0R A;  1CS8 A;  2AGA A;  1BY8 A;  1ZCM A;  1HUC B;  1NB3 A;  4BOP A;  4IP3 A;  3BWK A;  3MTN A;  4ZUX U;  2E03 A;  4P6E A;  4BOQ A;  3PNR A;  2B1M A;  4CDD B;  2YJ8 A;  5E6J A;  1BP4 A;  4BS6 A;  2P7U A;  2JQG R;  1KHQ A;  1U5I A;  4AXL A;  3KWB X;  3P5X A;  3HD3 A;  5CHT A;  4DMX A;  1ITO A;  3H89 A;  3PBH A;  1F2B A;  4D8E A;  2FT2 A;  4GUA A;  4N4Z A;  2AUX A;  3CBJ A;  3N4C A;  2VHS A;  3RVV A;  3RVW A;  2OZ2 A;  1YK7 A;  3H8B A;  4CDF B;  1NB5 A;  2O6X A;  3PT2 A;  4YYQ A;  4YYV A;  3IEJ A;  2BU3 A;  3E9S A;  3P5U A;  2HWK A;  3RNV A;  1QXP A;  3ZNH A;  3KW9 A;  3D6S A;  1U9V A;  4OVZ A;  3MP2 A;  4QRG A;  2DZZ A;  1MHW A;  4QRX A;  3S3R A;  1PAD A;  1U9W A;  4YYS A;  4M0W A;  2Y5B A;  4KLB A;  1ZIV A;  4A5U A;  3TMP A;  2IPP B;  3E1Z B;  4P16 A;  4BOZ A;  2H7J A;  3OIS A;  5PAD A;  3N3K A;  4PP1 A;  1PBH A;  2FO5 A;  2G8J A;  5A24 A;  4BOU A;  1DKI A;  4XR7 A;  1AYV A;  2AUZ A;  4MM3 B;  1GLO A;  1YVB A;  1PIP A;  1CV8 A;  2NQA A;  1NL6 A;  2DOS A;  3I3T A;  5FPW A;  3IHP A;  2FQ9 A;  2BDL A;  3BPM A;  3OQC A;  2UZJ A;  3PHX A;  1F2C A;  2DC6 A;  3LFY A;  3IFU A;  4G54 A;  5CVN B;  1EWL A;  1CB5 A;  4CDC B;  5CVO B;  3IV2 A;  4Q8H A;  4HWY A;  3USV A;  4W4U A;  1EWM A;  3BB7 A;  1YAL A;  1THE A;  2AVW A;  1PPN A;  3KSE A;  3HWN A;  4BOS A;  4OVZ B;  5JZE A;  1AYW A;  1X9Y A;  2R9F A;  1PE6 A;  2E00 A;  3NHE A;  3PHW A;  2R9N A;  1MDW A;  2HH5 A;  3MOR A;  3RVX A;  2HHN A;  1PPP A;  1XKG A;  1AU4 A;  1YZB A;  4CZW A;  2FRQ A;  1STF E;  2G7Y A;  1VJV A;  1AEC A;  2J7Q C;  1JQP A;  3IOQ A;  1PXV A;  3BPF A;  1BGO A;  2DZY A;  2FUD A;  1EF7 A;  3F5V A;  2DC7 A;  4X6J A;  5J94 A;  5JH3 A;  1AU2 A;  4X6H A;  1U9Q X;  4FK5 A;  3V6E A;  4P6G A;  4RY2 A;  4YVA A;  2B1N A;  3CBK A;  3KX1 A;  3O1G A;  4W5C A;  1QMY A;  1CVZ A;  3OVZ A;  4BQV A;  4Q8G A;  1QOL A;  3K24 A;  1PCI A;  3CH2 X;  3M99 A;  3OF9 A;  5EF4 A;  4YYR A;  1U9X A;  4MZS A;  2AS8 A;  2FE8 A;  3TNX A;  4YYW A;  3B21 A;  4DMY A;  2DCC A;  1GCB A;  1ME3 A;  4I04 A;  1K3B B;  2DJG B;  5EZS A;  2ARY A;  3WXF A;  1S4V A;  2JRI A;  7PCK A;  3WXG A;  3QJ3 A;  1UKF A;  3P5W A;  2F7D A;  2XU5 A;  4MZO A;  2R9C A;  3H8C A;  4D8B A;  3AI8 A;  2OUL A;  1DEU A;  2AIM A;  3F75 A;  2BDZ A;  4PAD A;  2Z84 A;  2JTC A;  2R9M A;  2E02 A;  2XU4 A;  4W5B A;  3TRK A;  3K8U A;  4QH6 A;  2PBH A;  1DF0 A;  5KO3 A;  3PW3 A;  2DCA A;  1CTE A;  4PP2 E;  2VHF A;  4RF0 A;  3O65 A;  3PRM A;  3IUT A;  3PHU A;  4QBB A;  2G6D A;  2XU1 A;  3H6S A;  2DCB A;  1A6R A;  2G8E A;  3BC3 A;  1NPZ A;  2WBF X;  1MEG A;  1YK8 A;  4WA6 A;  4BPV A;  1TL9 A;  2NQI A;  2DC9 A;  4FIP A;  4X6I A;  3OVX A;  3MHH A;  1SNK A;  1SP4 B;  1Y4H A;  3ERV A;  3S3Q A;  1ATK A;  3N3G A;  2F1G A;  3CH3 X;  4HXD B;  3K9M A;  3MTV A;  2FRA A;  4PT5 A;  4RKX A;  3BCN A;  3PDF A;  2AYO A;  3WXE A;  3QT4 A;  6PAD A;  2Y6E A;  3U8E A;  3KWZ A;  9PAP A;  3V6C A;  1EWP A;  3QSD A;  3C0R A;  2FTD A;  1Y08 A;  2CB5 A;  5JA7 A;  1EWO A;  2PAD A;  2R9O A;  2HXZ A;  1KHP A;  2GHU A;  1GEC E;  2R6N A;  4PI3 A;  4BSQ A;  2YJ2 A;  4RF1 A;  1CPJ A;  1MS6 A;  2HD5 A;  4I05 A;  1PPO A;  1CJL A;  1KFX L;  1CQD A;  1CSB B;  1AU0 A;  4YYU A;  1MIR A;  5CVM A;  3BOW A;  3I06 A;  1NLJ A;  1IWD A;  4WUR A;  4AXM A;  4N8W A;  3MJ5 A;  4MSX A;  4D8I A;  3KKU A;  4I07 A;  1MEM A;  2YJ9 A;  2BTW A;  4YV8 A;  3GCB A;  2NQD B;  1M6D A;  4R3D A;  2DC8 A;  5EZQ A;  3OF8 A;  2C0Y A;  1GMY A;  1BQI A;  3W30 A;  4K7C A;  1AU3 A;  8PCH A;  4XZX A;  2ATO A;  3HHA A;  2JQF R;  3ZUA A;  1Q6K A;  1TLO A;  1YT7 A;  2AU1 A;  4XUI A;  4FJC A;  3H7D A;  3P5V A;  2FYE A;  2OP3 A;  4ZTB A;  4REZ A;  3W31 A;  1QDQ A;  2P86 A;  3IMA A;  1AYU A;  1PVJ A; 
#chains in the Genus database with same CATH homology
 1NQC A;  3LXS A;  2AYN A;  1KFU L;  1PPD A;  2PNS A;  2ACT A;  2PRE A;  5CHV A;  3B79 A;  2YJB A;  3MHS A;  2XU3 A;  4C5P A;  1F29 A;  1O0E A;  3C9E A;  2NQG A;  1POP A;  3HHI A;  5K16 A;  3O0U A;  4BS5 A;  2IBI A;  4OEL A;  5EGW A;  4N79 A;  5F02 A;  4CDE B;  3DF0 A;  4QRV A;  2GFO A;  1F2A A;  2DCD A;  4OEM A;  3KFQ A;  2E01 A;  2DJF B;  1VSN A;  4B55 A;  1ME4 A;  1AIM A;  2CIO A;  1FH0 A;  1ICF A;  2YJC A;  1KXR A;  1TU6 A;  2P0R A;  1CS8 A;  1BY8 A;  1ZCM A;  1HUC B;  1NB3 A;  3BWK A;  3MTN A;  4ZUX U;  2E03 A;  4P6E A;  3PNR A;  2B1M A;  4CDD B;  2YJ8 A;  1BP4 A;  4BS6 A;  2P7U A;  2JQG R;  1KHQ A;  1U5I A;  4AXL A;  3KWB X;  3P5X A;  3HD3 A;  5CHT A;  4DMX A;  1ITO A;  3H89 A;  3PBH A;  1F2B A;  2FT2 A;  4N4Z A;  2AUX A;  2VFC A;  3CBJ A;  3N4C A;  2VHS A;  3RVV A;  3RVW A;  2OZ2 A;  1YK7 A;  3H8B A;  4CDF B;  1NB5 A;  2O6X A;  4NV7 A;  4YYQ A;  4YYV A;  3IEJ A;  3P5U A;  1QXP A;  3KW9 A;  3D6S A;  1U9V A;  4GUZ A;  4QRG A;  2DZZ A;  1MHW A;  4QRX A;  3S3R A;  1PAD A;  1U9W A;  4YYS A;  2Y5B A;  4KLB A;  1ZIV A;  2IPP B;  3E1Z B;  2H7J A;  3OIS A;  5PAD A;  3N3K A;  4PP1 A;  1PBH A;  2FO5 A;  2G8J A;  5A24 A;  4XR7 A;  1AYV A;  2AUZ A;  1GLO A;  1YVB A;  1PIP A;  1CV8 A;  2NQA A;  1NL6 A;  3I3T A;  5FPW A;  3IHP A;  2FQ9 A;  2BDL A;  3BPM A;  2DC6 A;  3LFY A;  4G54 A;  5CVN B;  1EWL A;  1CB5 A;  4CDC B;  5CVO B;  1W6F A;  3IV2 A;  4Q8H A;  4HWY A;  3USV A;  4W4U A;  1EWM A;  1YAL A;  1THE A;  2AVW A;  1PPN A;  3KSE A;  3HWN A;  1AYW A;  1X9Y A;  2R9F A;  1PE6 A;  2E00 A;  3NHE A;  2R9N A;  1MDW A;  2HH5 A;  3MOR A;  3RVX A;  2HHN A;  1PPP A;  1XKG A;  1AU4 A;  4CZW A;  2FRQ A;  1STF E;  2G7Y A;  1VJV A;  1AEC A;  1JQP A;  3IOQ A;  1PXV A;  3BPF A;  1BGO A;  2DZY A;  2FUD A;  1EF7 A;  3F5V A;  2DC7 A;  4X6J A;  5J94 A;  1W5R A;  5JH3 A;  1AU2 A;  4X6H A;  1U9Q X;  4FK5 A;  3V6E A;  4P6G A;  4RY2 A;  4YVA A;  2B1N A;  3CBK A;  3KX1 A;  2VFB A;  3O1G A;  4W5C A;  1QMY A;  1CVZ A;  3OVZ A;  4BQV A;  4Q8G A;  1QOL A;  3K24 A;  1PCI A;  3CH2 X;  3M99 A;  3OF9 A;  5EF4 A;  4YYR A;  1U9X A;  4MZS A;  2AS8 A;  4NV8 A;  3TNX A;  4YYW A;  4DMY A;  2DCC A;  1GCB A;  1ME3 A;  4I04 A;  1K3B B;  2DJG B;  2ARY A;  3WXF A;  1S4V A;  1E2T A;  7PCK A;  3WXG A;  3QJ3 A;  3P5W A;  2F7D A;  2XU5 A;  4MZO A;  2R9C A;  3H8C A;  3AI8 A;  2OUL A;  1DEU A;  2AIM A;  4BGF A;  3F75 A;  2BDZ A;  3D9W A;  4PAD A;  3LTW A;  2R9M A;  2E02 A;  2XU4 A;  4W5B A;  3K8U A;  4QH6 A;  2PBH A;  1DF0 A;  3PW3 A;  2DCA A;  1CTE A;  4PP2 E;  2VHF A;  3IUT A;  4QBB A;  2G6D A;  2XU1 A;  3H6S A;  2DCB A;  1A6R A;  2G8E A;  3BC3 A;  1NPZ A;  2WBF X;  1MEG A;  1YK8 A;  4WA6 A;  4BPV A;  1TL9 A;  2NQI A;  2DC9 A;  4FIP A;  4X6I A;  3OVX A;  3MHH A;  1SNK A;  1SP4 B;  1Y4H A;  3ERV A;  3S3Q A;  1ATK A;  3N3G A;  2F1G A;  3CH3 X;  3K9M A;  2FRA A;  3BCN A;  3PDF A;  2AYO A;  3WXE A;  3QT4 A;  6PAD A;  2Y6E A;  3U8E A;  3KWZ A;  9PAP A;  3V6C A;  1EWP A;  3QSD A;  2FTD A;  1Y08 A;  2CB5 A;  5JA7 A;  1EWO A;  2PAD A;  2R9O A;  2HXZ A;  1KHP A;  2GHU A;  1GEC E;  2R6N A;  4PI3 A;  4BSQ A;  2YJ2 A;  1CPJ A;  1MS6 A;  2HD5 A;  4I05 A;  1PPO A;  1CJL A;  1KFX L;  1CQD A;  1CSB B;  1AU0 A;  4YYU A;  1MIR A;  5CVM A;  3BOW A;  3I06 A;  1NLJ A;  1IWD A;  4AXM A;  4N8W A;  4MSX A;  1GX3 A;  3KKU A;  4I07 A;  1MEM A;  2YJ9 A;  4YV8 A;  3GCB A;  2NQD B;  1M6D A;  2DC8 A;  3OF8 A;  2C0Y A;  1GMY A;  1W4T A;  1BQI A;  4K7C A;  1AU3 A;  8PCH A;  2ATO A;  3HHA A;  2JQF R;  3ZUA A;  1Q6K A;  1TLO A;  1YT7 A;  2AU1 A;  2BSZ A;  4XUI A;  4FJC A;  3H7D A;  3P5V A;  2FYE A;  2OP3 A;  1QDQ A;  2P86 A;  3IMA A;  1AYU A;  1F2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...