7PCKA

Crystal structure of wild type human procathepsin k
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
314
structure length
314
Chain Sequence
LYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of wild-type human procathepsin K.
pubmed rcsb
molecule tags Hydrolase
molecule keywords PROTEIN (PROCATHEPSIN K)
total genus 66
structure length 314
sequence length 314
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 1998-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08246 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 7pckA00
1M6DA 3IOQA 2NQIA 4X6HA 2FRQA 1STFE 3S3RA 1U9QX 2JQFR 3BCNA 1AYWA 1CJLA 1JQPA 2B1MA 2YJ2A 3CH3X 2CB5A 1PCIA 5CHVA 3F75A 1U9VA 3V6CA 2Y5BA 3MTNA 1PPOA 3B79A 2H7JA 4FJCA 5CVNB 4BQVA 2P0RA 3M99A 1GMYA 1SP4B 3MORA 2ACTA 4QRVA 2G8EA 2XU3A 2P7UA 1PPNA 3BC3A 4QH6A 1FH0A 2CIOA 4QBBA 2JQGR 1F29A 2YJCA 2HXZA 3RVWA 2YJ8A 2R6NA 3H7DA 1ICFA 4QRXA 1MS6A 8PCHA 1K3BB 2WBFX 4YYRA 1EF7A 2FUDA 1YK8A 1QDQA 1PPDA 3OISA 1ME4A 2DC9A 3H8BA 3NHEA 4I04A 3O0UA 2DC8A 1GCBA 1CSBB 4W5CA 2DC6A 1NL6A 2IPPB 3LFYA 2DZYA 3GCBA 4X6IA 1VJVA 3QJ3A 3PBHA 3OF8A 3WXGA 4I07A 3KKUA 1PE6A 3QT4A 1AECA 1U9WA 2R9NA 4W4UA 1F2BA 4BS5A 3WXEA 4MSXA 1TLOA 4YYSA 2VHSA 2VHFA 1QMYA 2FRAA 2E00A 3KWBX 3KFQA 3HD3A 3MHHA 5JH3A 4HWYA 3HHIA 1X9YA 2XU1A 1EWLA 2YJ9A 2HHNA 4QRGA 2FYEA 2OZ2A 4P6EA 4Q8HA 3P5UA 4YVAA 4P6GA 2NQAA 2R9OA 2HD5A 1NQCA 3H8CA 3ERVA 2AYNA 1YT7A 1YALA 3P5VA 5K16A 1U5IA 1NB5A 1QXPA 1CVZA 3RVXA 3U8EA 3CBKA 2AUXA 4PADA 1VSNA 2DCBA 3OF9A 2FO5A 3USVA 4X6JA 2FTDA 1KHPA 1S4VA 1CB5A 3I3TA 1CPJA 5JA7A 4PI3A 4YYWA 2AUZA 2O6XA 2P86A 2E01A 2GHUA 4FK5A 2NQDB 4YV8A 2AYOA 2B1NA 4BSQA 1CQDA 3P5WA 1AYVA 2ATOA 1O0EA 1KFUL 4Q8GA 1POPA 4BS6A 4DMXA 1THEA 3PDFA 1EWPA 4YYQA 3BWKA 1YK7A 1SNKA 5EGWA 3PNRA 2NQGA 1MEGA 2DCDA 1AU2A 4RY2A 4I05A 4ZUXU 7PCKA 4CDDB 4CDEB 2G6DA 1PIPA 1CTEA 3KWZA 5A24A 3IUTA 1GLOA 1KFXL 3BOWA 2G7YA 3OVZA 1EWMA 1MDWA 2G8JA 3BPFA 3DF0A 3K9MA 1Y4HA 4DMYA 4AXLA 2HH5A 4W5BA 1BGOA 6PADA 1DF0A 2ARYA 2IBIA 1AU0A 2DC7A 1ME3A 1A6RA 2DZZA 3KX1A 3K8UA 2DCCA 1PPPA 5CHTA 3S3QA 3ZUAA 4MZOA 2E02A 4CDFB 2R9CA 4K7CA 1HUCB 1ITOA 1YVBA 2F1GA 3K24A 4CDCB 3LXSA 1CS8A 1QOLA 9PAPA 4MZSA 2Y6EA 1BP4A 3IMAA 2OULA 1AU3A 2PBHA 1CV8A 4OELA 2AU1A 5PADA 4CZWA 4G54A 3OVXA 1PADA 5FPWA 1TU6A 1MEMA 3WXFA 4N8WA 2BDLA 1F2CA 3MHSA 4WA6A 3F5VA 1PXVA 3KSEA 3QSDA 1F2AA 2F7DA 1PBHA 3AI8A 5J94A 1KXRA 2GFOA 3C9EA 4BPVA 3D6SA 4YYVA 2OP3A 4XR7A 1Y08A 1NPZA 3PW3A 3N4CA 3KW9A 2DJFB 2DJGB 2FQ9A 2PREA 2E03A 1ZIVA 1KHQA 3V6EA 2AVWA 4N79A 1AYUA 1TL9A 4YYUA 4KLBA 2FT2A 3IHPA 4N4ZA 1GECE 2AIMA 2AS8A 3E1ZB 2PADA 2DCAA 4OEMA 3RVVA 1EWOA 1ATKA 1BQIA 2YJBA 1DEUA 3IV2A 3N3KA 1XKGA 4PP1A 3HWNA 3TNXA 1AU4A 3O1GA 1BY8A 5CVMA 2R9FA 2BDZA 3P5XA 5CVOB 2R9MA 1MHWA 2XU5A 3H6SA 4PP2E 3I06A 3H89A 2PNSA 1NLJA 3IEJA 1IWDA 2XU4A 3HHAA 3CBJA 2C0YA 4FIPA 3BPMA 1NB3A 1U9XA 4XUIA 1AIMA 1Q6KA 1ZCMA 4AXMA 3CH2X 3N3GA 5F02A 1MIRA 5EF4A
chains in the Genus database with same CATH superfamily
4RNAA 4RKXA 1M6DA 3IOQA 2NQIA 4X6HA 2FRQA 3PRMA 1STFE 1PVJA 3S3RA 1U9QX 2JQFR 3BCNA 1AYWA 1CJLA 1JQPA 2B1MA 2YJ2A 3CH3X 2BTWA 2CB5A 1PCIA 5CHVA 3F75A 1U9VA 3V6CA 2Y5BA 3MTNA 1PPOA 4IP3A 3B79A 2H7JA 4FJCA 5CVNB 4BQVA 2P0RA 3M99A 1GMYA 2JRIA 1SP4B 3MORA 2ACTA 4QRVA 2J7QA 2G8EA 2XU3A 2P7UA 1PPNA 5KO3A 3BC3A 4QH6A 1FH0A 2CIOA 4HXDB 3MTVA 4BOZA 4QBBA 2JQGR 1F29A 2YJCA 2HXZA 3RVWA 5EZSA 2YJ8A 2R6NA 3H7DA 1ICFA 4QRXA 3W30A 1MS6A 8PCHA 1K3BB 2WBFX 4YYRA 1EF7A 2FUDA 1YK8A 1QDQA 1PPDA 3OISA 1ME4A 2DC9A 3H8BA 3NHEA 4I04A 3O0UA 2DC8A 3BY4A 1GCBA 1CSBB 4W5CA 2DC6A 1UKFA 1NL6A 2IPPB 3LFYA 2DZYA 3GCBA 4X6IA 1VJVA 3QJ3A 3PBHA 3PRPA 3OF8A 3WXGA 4I07A 3O65A 3KKUA 1PE6A 3QT4A 1DKIA 3B21A 1AECA 1U9WA 2R9NA 4W4UA 1F2BA 4BS5A 3WXEA 4MSXA 1TLOA 4YYSA 2VHSA 2VHFA 1QMYA 2FRAA 2E00A 3KWBX 3KFQA 4WURA 3HD3A 3MHHA 3PSEA 2J7QC 5JH3A 4HWYA 3HHIA 1X9YA 2XU1A 1EWLA 2FE8A 4XZXA 4BOPA 2YJ9A 2DOSA 2HHNA 4QRGA 2FYEA 2OZ2A 4BOUA 3W31A 4P6EA 4Q8HA 3P5UA 4YVAA 4P6GA 2NQAA 3PHUA 3PHWA 2R9OA 2HD5A 1NQCA 4RF1A 3H8CA 3ERVA 2AYNA 1YT7A 1YALA 3P5VA 5K16A 1U5IA 1NB5A 1QXPA 1CVZA 3RVXA 3U8EA 3CBKA 2AUXA 4PADA 1VSNA 2DCBA 5E6JA 3OF9A 2FO5A 3USVA 4X6JA 2FTDA 4ZTBA 1KHPA 1S4VA 1CB5A 3I3TA 1CPJA 5JA7A 4PI3A 4YYWA 2AUZA 2O6XA 2P86A 4R3DA 3C0RA 2E01A 2GHUA 4FK5A 2NQDB 5JZEA 4D8IA 4YV8A 4PT5A 4OW0A 2AYOA 2B1NA 4BSQA 1CQDA 3P5WA 1AYVA 2ATOA 2AGAA 1O0EA 3E9SA 1KFUL 4Q8GA 1POPA 4BS6A 4DMXA 1THEA 3PDFA 1EWPA 3OQCA 4YYQA 3BWKA 1YK7A 1SNKA 5EGWA 3PNRA 2NQGA 1MEGA 2DCDA 1AU2A 4RY2A 4I05A 4ZUXU 4MI7A 7PCKA 4CDDB 4CDEB 2G6DA 4A5UA 1PIPA 1CTEA 3KWZA 5A24A 3IUTA 1GLOA 1KFXL 3BOWA 2G7YA 3OVZA 1EWMA 1MDWA 2G8JA 3BPFA 3DF0A 3K9MA 1Y4HA 4DMYA 4AXLA 2HH5A 4W5BA 1BGOA 6PADA 4P16A 4BOQA 1DF0A 2ARYA 2IBIA 1AU0A 2DC7A 1ME3A 1A6RA 2DZZA 3KX1A 3K8UA 2DCCA 2BTWB 1PPPA 5CHTA 3S3QA 3ZUAA 4RF0A 4MZOA 2E02A 5EZQA 4CDFB 2Z84A 3BBAA 2R9CA 4K7CA 1HUCB 1ITOA 4M0WA 1YVBA 2F1GA 3K24A 4CDCB 3LXSA 1CS8A 1QOLA 9PAPA 4MZSA 2Y6EA 1BP4A 3IMAA 2OULA 3TRKA 4OVZA 1AU3A 2PBHA 2JTCA 1CV8A 4OELA 2UZJA 2AU1A 5PADA 4CZWA 4G54A 3OVXA 1PADA 5FPWA 1TU6A 1MEMA 3WXFA 4N8WA 2BDLA 3MJ5A 1F2CA 3MHSA 4WA6A 3PT2A 3F5VA 3RNVA 1PXVA 3KSEA 3QSDA 1F2AA 2F7DA 1PBHA 3AI8A 5J94A 4D8BA 1KXRA 2GFOA 1YZBA 3C9EA 3D6SA 4BPVA 4YYVA 2OP3A 4XR7A 1Y08A 4D8EA 1NPZA 3ZNHA 3PW3A 3N4CA 3KW9A 2DJFB 2DJGB 2FQ9A 2PREA 2E03A 1ZIVA 1KHQA 4BOSA 3V6EA 2AVWA 4N79A 1AYUA 1TL9A 4YYUA 4KLBA 2HWKA 2FT2A 3IHPA 4N4ZA 1GECE 3IFUA 3BB7A 2AIMA 2AS8A 3E1ZB 2PADA 4REZA 2BU3A 2DCAA 4OEMA 3RVVA 3MP2A 1EWOA 1ATKA 1BQIA 2YJBA 1DEUA 3IV2A 3N3KA 1XKGA 4PP1A 3HWNA 3TNXA 1AU4A 3O1GA 1BY8A 5CVMA 2R9FA 2BDZA 3P5XA 5CVOB 2R9MA 1MHWA 2XU5A 3H6SA 4PP2E 3I06A 3H89A 2PNSA 1NLJA 3IEJA 1IWDA 2XU4A 4GUAA 4MM3B 3HHAA 3CBJA 2C0YA 4IUMA 4FIPA 3BPMA 1NB3A 4OVZB 1U9XA 4XUIA 3TMPA 1AIMA 1Q6KA 1ZCMA 4AXMA 3CH2X 3N3GA 5F02A 1MIRA 5EF4A 3PHXA
chains in the Genus database with same CATH topology
1M6DA 3IOQA 2NQIA 4X6HA 2FRQA 1W5RA 1STFE 4B55A 3S3RA 1U9QX 2JQFR 3BCNA 1AYWA 1CJLA 1JQPA 2B1MA 2YJ2A 3CH3X 2CB5A 1PCIA 5CHVA 3F75A 1U9VA 3V6CA 2Y5BA 3MTNA 1PPOA 3B79A 2H7JA 4FJCA 5CVNB 4BQVA 2P0RA 1GX3A 3M99A 1GMYA 1SP4B 4C5PA 3MORA 2ACTA 4QRVA 2G8EA 2XU3A 2P7UA 1PPNA 3BC3A 4QH6A 1FH0A 2CIOA 4QBBA 2JQGR 1F29A 2YJCA 2HXZA 3RVWA 2YJ8A 2R6NA 3H7DA 1ICFA 4QRXA 1MS6A 8PCHA 1K3BB 2WBFX 4YYRA 1EF7A 2FUDA 1YK8A 1QDQA 1PPDA 3OISA 1ME4A 2DC9A 3H8BA 3NHEA 4I04A 3O0UA 2DC8A 1GCBA 1CSBB 4W5CA 2DC6A 1NL6A 2IPPB 3LFYA 2DZYA 3GCBA 4X6IA 1VJVA 3QJ3A 3PBHA 3OF8A 3WXGA 4I07A 3KKUA 1PE6A 3QT4A 1AECA 1U9WA 2R9NA 4W4UA 1F2BA 4BS5A 3WXEA 4MSXA 1TLOA 4YYSA 2VHSA 2VHFA 1QMYA 2FRAA 2E00A 3KWBX 3KFQA 3HD3A 3MHHA 5JH3A 4HWYA 3HHIA 1X9YA 2XU1A 1EWLA 2YJ9A 2HHNA 4QRGA 2FYEA 2OZ2A 4P6EA 4Q8HA 3P5UA 4YVAA 4P6GA 2NQAA 3LTWA 3D9WA 2R9OA 2HD5A 1NQCA 3H8CA 3ERVA 2AYNA 1YT7A 1YALA 3P5VA 5K16A 1U5IA 1NB5A 1QXPA 1CVZA 3RVXA 3U8EA 3CBKA 2AUXA 4PADA 1VSNA 2DCBA 3OF9A 2FO5A 3USVA 4X6JA 2FTDA 1KHPA 1S4VA 1CB5A 3I3TA 1W4TA 1CPJA 5JA7A 4PI3A 4YYWA 2AUZA 1W6FA 2O6XA 2P86A 2E01A 2GHUA 4FK5A 2NQDB 4YV8A 2AYOA 2B1NA 4BSQA 1CQDA 3P5WA 1AYVA 2ATOA 1O0EA 1KFUL 4Q8GA 1POPA 4BS6A 4DMXA 1THEA 3PDFA 1EWPA 4YYQA 3BWKA 1YK7A 1SNKA 5EGWA 3PNRA 2NQGA 1MEGA 2DCDA 1AU2A 4RY2A 4I05A 4ZUXU 7PCKA 4CDDB 4NV8A 2G6DA 4CDEB 1PIPA 1CTEA 3KWZA 5A24A 3IUTA 1GLOA 1KFXL 3BOWA 2G7YA 3OVZA 1EWMA 1MDWA 2G8JA 3BPFA 3DF0A 3K9MA 1Y4HA 4DMYA 4AXLA 2HH5A 4W5BA 1BGOA 6PADA 1DF0A 2ARYA 2IBIA 1AU0A 2DC7A 1ME3A 2BSZA 1A6RA 4NV7A 2DZZA 3KX1A 3K8UA 2DCCA 1PPPA 5CHTA 3S3QA 3ZUAA 4MZOA 2E02A 4CDFB 2R9CA 4K7CA 1E2TA 1HUCB 1ITOA 1YVBA 2F1GA 3K24A 4CDCB 3LXSA 1CS8A 1QOLA 9PAPA 4MZSA 2Y6EA 1BP4A 3IMAA 2OULA 1AU3A 2PBHA 1CV8A 4OELA 2AU1A 5PADA 4CZWA 4G54A 3OVXA 1PADA 4BGFA 5FPWA 1TU6A 1MEMA 3WXFA 4N8WA 2BDLA 1F2CA 3MHSA 4WA6A 3F5VA 1PXVA 3KSEA 3QSDA 1F2AA 2F7DA 1PBHA 3AI8A 4GUZA 5J94A 1KXRA 2GFOA 3C9EA 4BPVA 3D6SA 4YYVA 2OP3A 4XR7A 1Y08A 1NPZA 3PW3A 3N4CA 3KW9A 2DJFB 2DJGB 2FQ9A 2PREA 2E03A 1ZIVA 1KHQA 3V6EA 2AVWA 4N79A 1AYUA 1TL9A 4YYUA 4KLBA 2FT2A 3IHPA 4N4ZA 1GECE 2AIMA 2AS8A 3E1ZB 2PADA 2DCAA 4OEMA 3RVVA 2VFCA 1EWOA 1ATKA 1BQIA 2YJBA 1DEUA 3IV2A 3N3KA 1XKGA 4PP1A 3HWNA 3TNXA 1AU4A 3O1GA 1BY8A 5CVMA 2R9FA 2BDZA 3P5XA 5CVOB 2R9MA 1MHWA 2VFBA 2XU5A 3H6SA 4PP2E 3I06A 3H89A 2PNSA 1NLJA 3IEJA 1IWDA 2XU4A 3HHAA 3CBJA 2C0YA 4FIPA 3BPMA 1NB3A 1U9XA 4XUIA 1AIMA 1Q6KA 1ZCMA 4AXMA 3CH2X 3N3GA 5F02A 1MIRA 5EF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M6D A;  3IOQ A;  2NQI A;  4X6H A;  2FRQ A;  1STF E;  3S3R A;  1U9Q X;  2JQF R;  3BCN A;  1AYW A;  1CJL A;  1JQP A;  2B1M A;  2YJ2 A;  3CH3 X;  2CB5 A;  1PCI A;  5CHV A;  3F75 A;  1U9V A;  3V6C A;  2Y5B A;  3MTN A;  1PPO A;  3B79 A;  2H7J A;  4FJC A;  5CVN B;  4BQV A;  2P0R A;  3M99 A;  1GMY A;  1SP4 B;  3MOR A;  2ACT A;  4QRV A;  2G8E A;  2XU3 A;  2P7U A;  1PPN A;  3BC3 A;  4QH6 A;  1FH0 A;  2CIO A;  4QBB A;  2JQG R;  1F29 A;  2YJC A;  2HXZ A;  3RVW A;  2YJ8 A;  2R6N A;  3H7D A;  1ICF A;  4QRX A;  1MS6 A;  8PCH A;  1K3B B;  2WBF X;  4YYR A;  1EF7 A;  2FUD A;  1YK8 A;  1QDQ A;  1PPD A;  3OIS A;  1ME4 A;  2DC9 A;  3H8B A;  3NHE A;  4I04 A;  3O0U A;  2DC8 A;  1GCB A;  1CSB B;  4W5C A;  2DC6 A;  1NL6 A;  2IPP B;  3LFY A;  2DZY A;  3GCB A;  4X6I A;  1VJV A;  3QJ3 A;  3PBH A;  3OF8 A;  3WXG A;  4I07 A;  3KKU A;  1PE6 A;  3QT4 A;  1AEC A;  1U9W A;  2R9N A;  4W4U A;  1F2B A;  4BS5 A;  3WXE A;  4MSX A;  1TLO A;  4YYS A;  2VHS A;  2VHF A;  1QMY A;  2FRA A;  2E00 A;  3KWB X;  3KFQ A;  3HD3 A;  3MHH A;  5JH3 A;  4HWY A;  3HHI A;  1X9Y A;  2XU1 A;  1EWL A;  2YJ9 A;  2HHN A;  4QRG A;  2FYE A;  2OZ2 A;  4P6E A;  4Q8H A;  3P5U A;  4YVA A;  4P6G A;  2NQA A;  2R9O A;  2HD5 A;  1NQC A;  3H8C A;  3ERV A;  2AYN A;  1YT7 A;  1YAL A;  3P5V A;  5K16 A;  1U5I A;  1NB5 A;  1QXP A;  1CVZ A;  3RVX A;  3U8E A;  3CBK A;  2AUX A;  4PAD A;  1VSN A;  2DCB A;  3OF9 A;  2FO5 A;  3USV A;  4X6J A;  2FTD A;  1KHP A;  1S4V A;  1CB5 A;  3I3T A;  1CPJ A;  5JA7 A;  4PI3 A;  4YYW A;  2AUZ A;  2O6X A;  2P86 A;  2E01 A;  2GHU A;  4FK5 A;  2NQD B;  4YV8 A;  2AYO A;  2B1N A;  4BSQ A;  1CQD A;  3P5W A;  1AYV A;  2ATO A;  1O0E A;  1KFU L;  4Q8G A;  1POP A;  4BS6 A;  4DMX A;  1THE A;  3PDF A;  1EWP A;  4YYQ A;  3BWK A;  1YK7 A;  1SNK A;  5EGW A;  3PNR A;  2NQG A;  1MEG A;  2DCD A;  1AU2 A;  4RY2 A;  4I05 A;  4ZUX U;  7PCK A;  4CDD B;  4CDE B;  2G6D A;  1PIP A;  1CTE A;  3KWZ A;  5A24 A;  3IUT A;  1GLO A;  1KFX L;  3BOW A;  2G7Y A;  3OVZ A;  1EWM A;  1MDW A;  2G8J A;  3BPF A;  3DF0 A;  3K9M A;  1Y4H A;  4DMY A;  4AXL A;  2HH5 A;  4W5B A;  1BGO A;  6PAD A;  1DF0 A;  2ARY A;  2IBI A;  1AU0 A;  2DC7 A;  1ME3 A;  1A6R A;  2DZZ A;  3KX1 A;  3K8U A;  2DCC A;  1PPP A;  5CHT A;  3S3Q A;  3ZUA A;  4MZO A;  2E02 A;  4CDF B;  2R9C A;  4K7C A;  1HUC B;  1ITO A;  1YVB A;  2F1G A;  3K24 A;  4CDC B;  3LXS A;  1CS8 A;  1QOL A;  9PAP A;  4MZS A;  2Y6E A;  1BP4 A;  3IMA A;  2OUL A;  1AU3 A;  2PBH A;  1CV8 A;  4OEL A;  2AU1 A;  5PAD A;  4CZW A;  4G54 A;  3OVX A;  1PAD A;  5FPW A;  1TU6 A;  1MEM A;  3WXF A;  4N8W A;  2BDL A;  1F2C A;  3MHS A;  4WA6 A;  3F5V A;  1PXV A;  3KSE A;  3QSD A;  1F2A A;  2F7D A;  1PBH A;  3AI8 A;  5J94 A;  1KXR A;  2GFO A;  3C9E A;  4BPV A;  3D6S A;  4YYV A;  2OP3 A;  4XR7 A;  1Y08 A;  1NPZ A;  3PW3 A;  3N4C A;  3KW9 A;  2DJF B;  2DJG B;  2FQ9 A;  2PRE A;  2E03 A;  1ZIV A;  1KHQ A;  3V6E A;  2AVW A;  4N79 A;  1AYU A;  1TL9 A;  4YYU A;  4KLB A;  2FT2 A;  3IHP A;  4N4Z A;  1GEC E;  2AIM A;  2AS8 A;  3E1Z B;  2PAD A;  2DCA A;  4OEM A;  3RVV A;  1EWO A;  1ATK A;  1BQI A;  2YJB A;  1DEU A;  3IV2 A;  3N3K A;  1XKG A;  4PP1 A;  3HWN A;  3TNX A;  1AU4 A;  3O1G A;  1BY8 A;  5CVM A;  2R9F A;  2BDZ A;  3P5X A;  5CVO B;  2R9M A;  1MHW A;  2XU5 A;  3H6S A;  4PP2 E;  3I06 A;  3H89 A;  2PNS A;  1NLJ A;  3IEJ A;  1IWD A;  2XU4 A;  3HHA A;  3CBJ A;  2C0Y A;  4FIP A;  3BPM A;  1NB3 A;  1U9X A;  4XUI A;  1AIM A;  1Q6K A;  1ZCM A;  4AXM A;  3CH2 X;  3N3G A;  5F02 A;  1MIR A;  5EF4 A; 
#chains in the Genus database with same CATH topology
 4RNA A;  4RKX A;  1M6D A;  3IOQ A;  2NQI A;  4X6H A;  2FRQ A;  3PRM A;  1STF E;  1PVJ A;  3S3R A;  1U9Q X;  2JQF R;  3BCN A;  1AYW A;  1CJL A;  1JQP A;  2B1M A;  2YJ2 A;  3CH3 X;  2BTW A;  2CB5 A;  1PCI A;  5CHV A;  3F75 A;  1U9V A;  3V6C A;  2Y5B A;  3MTN A;  1PPO A;  4IP3 A;  3B79 A;  2H7J A;  4FJC A;  5CVN B;  4BQV A;  2P0R A;  3M99 A;  1GMY A;  2JRI A;  1SP4 B;  3MOR A;  2ACT A;  4QRV A;  2J7Q A;  2G8E A;  2XU3 A;  2P7U A;  1PPN A;  5KO3 A;  3BC3 A;  4QH6 A;  1FH0 A;  2CIO A;  4HXD B;  3MTV A;  4BOZ A;  4QBB A;  2JQG R;  1F29 A;  2YJC A;  2HXZ A;  3RVW A;  5EZS A;  2YJ8 A;  2R6N A;  3H7D A;  1ICF A;  4QRX A;  3W30 A;  1MS6 A;  8PCH A;  1K3B B;  2WBF X;  4YYR A;  1EF7 A;  2FUD A;  1YK8 A;  1QDQ A;  1PPD A;  3OIS A;  1ME4 A;  2DC9 A;  3H8B A;  3NHE A;  4I04 A;  3O0U A;  2DC8 A;  3BY4 A;  1GCB A;  1CSB B;  4W5C A;  2DC6 A;  1UKF A;  1NL6 A;  2IPP B;  3LFY A;  2DZY A;  3GCB A;  4X6I A;  1VJV A;  3QJ3 A;  3PBH A;  3PRP A;  3OF8 A;  3WXG A;  4I07 A;  3O65 A;  3KKU A;  1PE6 A;  3QT4 A;  1DKI A;  3B21 A;  1AEC A;  1U9W A;  2R9N A;  4W4U A;  1F2B A;  4BS5 A;  3WXE A;  4MSX A;  1TLO A;  4YYS A;  2VHS A;  2VHF A;  1QMY A;  2FRA A;  2E00 A;  3KWB X;  3KFQ A;  4WUR A;  3HD3 A;  3MHH A;  3PSE A;  2J7Q C;  5JH3 A;  4HWY A;  3HHI A;  1X9Y A;  2XU1 A;  1EWL A;  2FE8 A;  4XZX A;  4BOP A;  2YJ9 A;  2DOS A;  2HHN A;  4QRG A;  2FYE A;  2OZ2 A;  4BOU A;  3W31 A;  4P6E A;  4Q8H A;  3P5U A;  4YVA A;  4P6G A;  2NQA A;  3PHU A;  3PHW A;  2R9O A;  2HD5 A;  1NQC A;  4RF1 A;  3H8C A;  3ERV A;  2AYN A;  1YT7 A;  1YAL A;  3P5V A;  5K16 A;  1U5I A;  1NB5 A;  1QXP A;  1CVZ A;  3RVX A;  3U8E A;  3CBK A;  2AUX A;  4PAD A;  1VSN A;  2DCB A;  5E6J A;  3OF9 A;  2FO5 A;  3USV A;  4X6J A;  2FTD A;  4ZTB A;  1KHP A;  1S4V A;  1CB5 A;  3I3T A;  1CPJ A;  5JA7 A;  4PI3 A;  4YYW A;  2AUZ A;  2O6X A;  2P86 A;  4R3D A;  3C0R A;  2E01 A;  2GHU A;  4FK5 A;  2NQD B;  5JZE A;  4D8I A;  4YV8 A;  4PT5 A;  4OW0 A;  2AYO A;  2B1N A;  4BSQ A;  1CQD A;  3P5W A;  1AYV A;  2ATO A;  2AGA A;  1O0E A;  3E9S A;  1KFU L;  4Q8G A;  1POP A;  4BS6 A;  4DMX A;  1THE A;  3PDF A;  1EWP A;  3OQC A;  4YYQ A;  3BWK A;  1YK7 A;  1SNK A;  5EGW A;  3PNR A;  2NQG A;  1MEG A;  2DCD A;  1AU2 A;  4RY2 A;  4I05 A;  4ZUX U;  4MI7 A;  7PCK A;  4CDD B;  4CDE B;  2G6D A;  4A5U A;  1PIP A;  1CTE A;  3KWZ A;  5A24 A;  3IUT A;  1GLO A;  1KFX L;  3BOW A;  2G7Y A;  3OVZ A;  1EWM A;  1MDW A;  2G8J A;  3BPF A;  3DF0 A;  3K9M A;  1Y4H A;  4DMY A;  4AXL A;  2HH5 A;  4W5B A;  1BGO A;  6PAD A;  4P16 A;  4BOQ A;  1DF0 A;  2ARY A;  2IBI A;  1AU0 A;  2DC7 A;  1ME3 A;  1A6R A;  2DZZ A;  3KX1 A;  3K8U A;  2DCC A;  2BTW B;  1PPP A;  5CHT A;  3S3Q A;  3ZUA A;  4RF0 A;  4MZO A;  2E02 A;  5EZQ A;  4CDF B;  2Z84 A;  3BBA A;  2R9C A;  4K7C A;  1HUC B;  1ITO A;  4M0W A;  1YVB A;  2F1G A;  3K24 A;  4CDC B;  3LXS A;  1CS8 A;  1QOL A;  9PAP A;  4MZS A;  2Y6E A;  1BP4 A;  3IMA A;  2OUL A;  3TRK A;  4OVZ A;  1AU3 A;  2PBH A;  2JTC A;  1CV8 A;  4OEL A;  2UZJ A;  2AU1 A;  5PAD A;  4CZW A;  4G54 A;  3OVX A;  1PAD A;  5FPW A;  1TU6 A;  1MEM A;  3WXF A;  4N8W A;  2BDL A;  3MJ5 A;  1F2C A;  3MHS A;  4WA6 A;  3PT2 A;  3F5V A;  3RNV A;  1PXV A;  3KSE A;  3QSD A;  1F2A A;  2F7D A;  1PBH A;  3AI8 A;  5J94 A;  4D8B A;  1KXR A;  2GFO A;  1YZB A;  3C9E A;  3D6S A;  4BPV A;  4YYV A;  2OP3 A;  4XR7 A;  1Y08 A;  4D8E A;  1NPZ A;  3ZNH A;  3PW3 A;  3N4C A;  3KW9 A;  2DJF B;  2DJG B;  2FQ9 A;  2PRE A;  2E03 A;  1ZIV A;  1KHQ A;  4BOS A;  3V6E A;  2AVW A;  4N79 A;  1AYU A;  1TL9 A;  4YYU A;  4KLB A;  2HWK A;  2FT2 A;  3IHP A;  4N4Z A;  1GEC E;  3IFU A;  3BB7 A;  2AIM A;  2AS8 A;  3E1Z B;  2PAD A;  4REZ A;  2BU3 A;  2DCA A;  4OEM A;  3RVV A;  3MP2 A;  1EWO A;  1ATK A;  1BQI A;  2YJB A;  1DEU A;  3IV2 A;  3N3K A;  1XKG A;  4PP1 A;  3HWN A;  3TNX A;  1AU4 A;  3O1G A;  1BY8 A;  5CVM A;  2R9F A;  2BDZ A;  3P5X A;  5CVO B;  2R9M A;  1MHW A;  2XU5 A;  3H6S A;  4PP2 E;  3I06 A;  3H89 A;  2PNS A;  1NLJ A;  3IEJ A;  1IWD A;  2XU4 A;  4GUA A;  4MM3 B;  3HHA A;  3CBJ A;  2C0Y A;  4IUM A;  4FIP A;  3BPM A;  1NB3 A;  4OVZ B;  1U9X A;  4XUI A;  3TMP A;  1AIM A;  1Q6K A;  1ZCM A;  4AXM A;  3CH2 X;  3N3G A;  5F02 A;  1MIR A;  5EF4 A;  3PHX A; 
#chains in the Genus database with same CATH homology
 1M6D A;  3IOQ A;  2NQI A;  4X6H A;  2FRQ A;  1W5R A;  1STF E;  4B55 A;  3S3R A;  1U9Q X;  2JQF R;  3BCN A;  1AYW A;  1CJL A;  1JQP A;  2B1M A;  2YJ2 A;  3CH3 X;  2CB5 A;  1PCI A;  5CHV A;  3F75 A;  1U9V A;  3V6C A;  2Y5B A;  3MTN A;  1PPO A;  3B79 A;  2H7J A;  4FJC A;  5CVN B;  4BQV A;  2P0R A;  1GX3 A;  3M99 A;  1GMY A;  1SP4 B;  4C5P A;  3MOR A;  2ACT A;  4QRV A;  2G8E A;  2XU3 A;  2P7U A;  1PPN A;  3BC3 A;  4QH6 A;  1FH0 A;  2CIO A;  4QBB A;  2JQG R;  1F29 A;  2YJC A;  2HXZ A;  3RVW A;  2YJ8 A;  2R6N A;  3H7D A;  1ICF A;  4QRX A;  1MS6 A;  8PCH A;  1K3B B;  2WBF X;  4YYR A;  1EF7 A;  2FUD A;  1YK8 A;  1QDQ A;  1PPD A;  3OIS A;  1ME4 A;  2DC9 A;  3H8B A;  3NHE A;  4I04 A;  3O0U A;  2DC8 A;  1GCB A;  1CSB B;  4W5C A;  2DC6 A;  1NL6 A;  2IPP B;  3LFY A;  2DZY A;  3GCB A;  4X6I A;  1VJV A;  3QJ3 A;  3PBH A;  3OF8 A;  3WXG A;  4I07 A;  3KKU A;  1PE6 A;  3QT4 A;  1AEC A;  1U9W A;  2R9N A;  4W4U A;  1F2B A;  4BS5 A;  3WXE A;  4MSX A;  1TLO A;  4YYS A;  2VHS A;  2VHF A;  1QMY A;  2FRA A;  2E00 A;  3KWB X;  3KFQ A;  3HD3 A;  3MHH A;  5JH3 A;  4HWY A;  3HHI A;  1X9Y A;  2XU1 A;  1EWL A;  2YJ9 A;  2HHN A;  4QRG A;  2FYE A;  2OZ2 A;  4P6E A;  4Q8H A;  3P5U A;  4YVA A;  4P6G A;  2NQA A;  3LTW A;  3D9W A;  2R9O A;  2HD5 A;  1NQC A;  3H8C A;  3ERV A;  2AYN A;  1YT7 A;  1YAL A;  3P5V A;  5K16 A;  1U5I A;  1NB5 A;  1QXP A;  1CVZ A;  3RVX A;  3U8E A;  3CBK A;  2AUX A;  4PAD A;  1VSN A;  2DCB A;  3OF9 A;  2FO5 A;  3USV A;  4X6J A;  2FTD A;  1KHP A;  1S4V A;  1CB5 A;  3I3T A;  1W4T A;  1CPJ A;  5JA7 A;  4PI3 A;  4YYW A;  2AUZ A;  1W6F A;  2O6X A;  2P86 A;  2E01 A;  2GHU A;  4FK5 A;  2NQD B;  4YV8 A;  2AYO A;  2B1N A;  4BSQ A;  1CQD A;  3P5W A;  1AYV A;  2ATO A;  1O0E A;  1KFU L;  4Q8G A;  1POP A;  4BS6 A;  4DMX A;  1THE A;  3PDF A;  1EWP A;  4YYQ A;  3BWK A;  1YK7 A;  1SNK A;  5EGW A;  3PNR A;  2NQG A;  1MEG A;  2DCD A;  1AU2 A;  4RY2 A;  4I05 A;  4ZUX U;  7PCK A;  4CDD B;  4NV8 A;  2G6D A;  4CDE B;  1PIP A;  1CTE A;  3KWZ A;  5A24 A;  3IUT A;  1GLO A;  1KFX L;  3BOW A;  2G7Y A;  3OVZ A;  1EWM A;  1MDW A;  2G8J A;  3BPF A;  3DF0 A;  3K9M A;  1Y4H A;  4DMY A;  4AXL A;  2HH5 A;  4W5B A;  1BGO A;  6PAD A;  1DF0 A;  2ARY A;  2IBI A;  1AU0 A;  2DC7 A;  1ME3 A;  2BSZ A;  1A6R A;  4NV7 A;  2DZZ A;  3KX1 A;  3K8U A;  2DCC A;  1PPP A;  5CHT A;  3S3Q A;  3ZUA A;  4MZO A;  2E02 A;  4CDF B;  2R9C A;  4K7C A;  1E2T A;  1HUC B;  1ITO A;  1YVB A;  2F1G A;  3K24 A;  4CDC B;  3LXS A;  1CS8 A;  1QOL A;  9PAP A;  4MZS A;  2Y6E A;  1BP4 A;  3IMA A;  2OUL A;  1AU3 A;  2PBH A;  1CV8 A;  4OEL A;  2AU1 A;  5PAD A;  4CZW A;  4G54 A;  3OVX A;  1PAD A;  4BGF A;  5FPW A;  1TU6 A;  1MEM A;  3WXF A;  4N8W A;  2BDL A;  1F2C A;  3MHS A;  4WA6 A;  3F5V A;  1PXV A;  3KSE A;  3QSD A;  1F2A A;  2F7D A;  1PBH A;  3AI8 A;  4GUZ A;  5J94 A;  1KXR A;  2GFO A;  3C9E A;  4BPV A;  3D6S A;  4YYV A;  2OP3 A;  4XR7 A;  1Y08 A;  1NPZ A;  3PW3 A;  3N4C A;  3KW9 A;  2DJF B;  2DJG B;  2FQ9 A;  2PRE A;  2E03 A;  1ZIV A;  1KHQ A;  3V6E A;  2AVW A;  4N79 A;  1AYU A;  1TL9 A;  4YYU A;  4KLB A;  2FT2 A;  3IHP A;  4N4Z A;  1GEC E;  2AIM A;  2AS8 A;  3E1Z B;  2PAD A;  2DCA A;  4OEM A;  3RVV A;  2VFC A;  1EWO A;  1ATK A;  1BQI A;  2YJB A;  1DEU A;  3IV2 A;  3N3K A;  1XKG A;  4PP1 A;  3HWN A;  3TNX A;  1AU4 A;  3O1G A;  1BY8 A;  5CVM A;  2R9F A;  2BDZ A;  3P5X A;  5CVO B;  2R9M A;  1MHW A;  2VFB A;  2XU5 A;  3H6S A;  4PP2 E;  3I06 A;  3H89 A;  2PNS A;  1NLJ A;  3IEJ A;  1IWD A;  2XU4 A;  3HHA A;  3CBJ A;  2C0Y A;  4FIP A;  3BPM A;  1NB3 A;  1U9X A;  4XUI A;  1AIM A;  1Q6K A;  1ZCM A;  4AXM A;  3CH2 X;  3N3G A;  5F02 A;  1MIR A;  5EF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...