1CTEA

Crystal structures of recombinant rat cathepsin b and a cathepsin b-inhibitor complex: implications for structure-based inhibitor design
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
253
structure length
253
Chain Sequence
LPESFDAREQWSNCPTIAQIRDQGSCGSCWAFGAVEAMSDRICIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWNFWTRKGLVSGGVYNSHIGCLPYTIPPCEHHVNGARPPCTGEGDTPKCNKMCEAGYSTSYKEDKHYGYTSYSVSDSEKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDVMGGHAIRILGWGIENGVPYWLVANSWNADWGDNGFFKILRGENHCGIESEIVAGIPRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN B
publication title Crystal structures of recombinant rat cathepsin B and a cathepsin B-inhibitor complex. Implications for structure-based inhibitor design.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Thiol protease
total genus 69
structure length 253
sequence length 253
chains with identical sequence B
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 1995-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1cteA00
3IUTA 2FUDA 3K9MA 3PBHA 4BQVA 3RVVA 4YYVA 2Y5BA 1F29A 2NQAA 1GMYA 3ERVA 1NB5A 3LFYA 3K8UA 3CH2X 2AU1A 3HWNA 2YJ9A 2O6XA 2DJFB 4CDDB 5A24A 3LXSA 3H7DA 1CS8A 3O1GA 5CHVA 1THEA 1ZCMA 2B1MA 2DC6A 2JQFR 2G8EA 1POPA 4FIPA 3IMAA 1XKGA 1ME4A 1O0EA 5PADA 3BPMA 1QOLA 1BGOA 3CH3X 3HHAA 1MDWA 2YJ8A 1Y08A 1F2CA 4N8WA 2G7YA 5JA7A 1MHWA 3B79A 2E03A 2AYOA 3F75A 2IPPB 2PNSA 4CDFB 1EWMA 1QMYA 4DMYA 2CB5A 4MSXA 4AXMA 2NQDB 3CBJA 1AU2A 1CVZA 1MS6A 3MHSA 2OP3A 1YK7A 3KKUA 1AU3A 1ICFA 4Q8GA 5J94A 1F2AA 4YYWA 1U9WA 9PAPA 2R9CA 3M99A 1CQDA 2AVWA 1MIRA 4HWYA 2PREA 2PBHA 2DC9A 3OF8A 1KFUL 3BWKA 3MORA 2DZYA 2B1NA 4ZUXU 3N3KA 2R6NA 4PP1A 1SP4B 3S3QA 4I07A 2F1GA 2XU4A 2E01A 5CHTA 4YYQA 1U5IA 4RY2A 1AU0A 3P5XA 1TLOA 4W5BA 3WXGA 3U8EA 3H8CA 4P6GA 4W5CA 4K7CA 2R9FA 2AUXA 1PXVA 5CVMA 2P0RA 1EWLA 2ACTA 3TNXA 4CDEB 2OULA 4MZOA 5CVNB 3OF9A 4X6JA 1GECE 1CJLA 2XU5A 1PE6A 3P5UA 4X6HA 4YV8A 1PADA 4OELA 1BQIA 1KHPA 1BP4A 1PPPA 1GCBA 1NPZA 1AYUA 3KSEA 4CZWA 2DZZA 1Y4HA 3PW3A 2HHNA 1NB3A 1YT7A 2YJ2A 5K16A 4YYRA 1ZIVA 2DCBA 1MEMA 3IHPA 2C0YA 1BY8A 4I04A 3IOQA 3S3RA 2HXZA 4YYUA 3AI8A 2BDLA 1EWOA 1F2BA 3BOWA 1AYWA 3C9EA 1KXRA 1DEUA 4DMXA 2AIMA 2IBIA 3DF0A 3BCNA 4X6IA 2DJGB 1YK8A 2DCDA 7PCKA 1A6RA 1TL9A 3V6EA 4KLBA 6PADA 1HUCB 4WA6A 3RVXA 1Q6KA 4W4UA 2AS8A 4XUIA 1KHQA 2YJBA 1AECA 1JQPA 2VHSA 2R9OA 2PADA 4CDCB 1VJVA 1NL6A 3NHEA 4YVAA 1CTEA 2FYEA 2JQGR 3HHIA 1U9XA 1NLJA 2FRQA 4FJCA 1VSNA 2YJCA 3QT4A 3O0UA 2FQ9A 4AXLA 3KFQA 1YVBA 2DC8A 1EWPA 4N4ZA 4MZSA 2NQIA 3MTNA 3WXFA 4I05A 2CIOA 3PNRA 5EGWA 2FT2A 4QRXA 3N3GA 1ITOA 4QH6A 2VHFA 1KFXL 1AYVA 3QJ3A 2Y6EA 2GFOA 1ATKA 3QSDA 1AIMA 2DC7A 1DF0A 3BC3A 3PDFA 4FK5A 1M6DA 3E1ZB 2HH5A 2F7DA 2FTDA 2E00A 3WXEA 3KWBX 4Q8HA 2P7UA 5JH3A 3CBKA 4PP2E 1CSBB 1K3BB 4QRGA 4XR7A 2E02A 2WBFX 4G54A 3N4CA 3P5VA 4BSQA 1NQCA 3IEJA 2BDZA 5F02A 1PCIA 3GCBA 5EF4A 1CB5A 8PCHA 1ME3A 2HD5A 2GHUA 1EF7A 3K24A 1CV8A 4P6EA 1X9YA 1PPNA 1YALA 1FH0A 3KX1A 1QDQA 3OISA 2ARYA 1AU4A 3ZUAA 2R9NA 1S4VA 1U9VA 3HD3A 4BPVA 2AUZA 4YYSA 1PPDA 1PBHA 1TU6A 3H6SA 3KWZA 3USVA 4OEMA 2H7JA 2R9MA 3OVXA 3OVZA 1QXPA 3I3TA 1IWDA 3F5VA 3BPFA 4QRVA 1SNKA 3IV2A 2XU1A 2P86A 1U9QX 3RVWA 4BS5A 3P5WA 2AYNA 3I06A 2G8JA 1PPOA 4N79A 1MEGA 2OZ2A 2DCAA 3H89A 3MHHA 3D6SA 4PADA 4BS6A 2DCCA 5CVOB 4PI3A 2FRAA 1STFE 2G6DA 4QBBA 1PIPA 3V6CA 3H8BA 3KW9A 2ATOA 1GLOA 2FO5A 2XU3A 1CPJA 5FPWA 2NQGA
chains in the Genus database with same CATH superfamily
3IUTA 3PHUA 4OVZB 2FUDA 5E6JA 2FE8A 3K9MA 3PBHA 4BQVA 3RVVA 4YYVA 2Y5BA 1F29A 2NQAA 1GMYA 3ERVA 1NB5A 3LFYA 3K8UA 3W30A 1DKIA 3CH2X 4D8BA 2AU1A 3HWNA 2YJ9A 2O6XA 2DJFB 4CDDB 5A24A 4MM3B 3LXSA 3H7DA 1CS8A 3O1GA 3OQCA 5CHVA 2UZJA 1THEA 4OVZA 4A5UA 1ZCMA 2B1MA 2DC6A 2JQFR 2G8EA 1POPA 3MJ5A 4FIPA 3IMAA 1XKGA 3PHWA 1ME4A 4RKXA 5KO3A 3MTVA 1O0EA 5PADA 3BPMA 1QOLA 1BGOA 3CH3X 3HHAA 1MDWA 2YJ8A 1Y08A 1F2CA 4N8WA 2G7YA 5JA7A 1MHWA 3B79A 4OW0A 2E03A 2AYOA 3F75A 2IPPB 2PNSA 3RNVA 4CDFB 1EWMA 1QMYA 4DMYA 2CB5A 4MSXA 4AXMA 2NQDB 3CBJA 4GUAA 1AU2A 1CVZA 3MHSA 1MS6A 2OP3A 1YK7A 3KKUA 1AU3A 1ICFA 4Q8GA 5J94A 1F2AA 4YYWA 1U9WA 9PAPA 2R9CA 3M99A 1CQDA 3PRPA 2AVWA 1MIRA 4HWYA 2PREA 2PBHA 2BTWB 2DC9A 3OF8A 1KFUL 3BWKA 3MORA 2DZYA 2B1NA 4ZUXU 3N3KA 2R6NA 1SP4B 4PP1A 3S3QA 4I07A 2F1GA 2XU4A 2E01A 5CHTA 4YYQA 1U5IA 4RY2A 1AU0A 3P5XA 1TLOA 4W5BA 3WXGA 2JRIA 4BOZA 3U8EA 3IFUA 3H8CA 3PRMA 4P6GA 3MP2A 4HXDB 4W5CA 4K7CA 2R9FA 2AUXA 1PXVA 3C0RA 5CVMA 2P0RA 1EWLA 2ACTA 3TNXA 4CDEB 2OULA 4MZOA 5CVNB 3OF9A 4X6JA 1GECE 1CJLA 2XU5A 1PE6A 3ZNHA 3P5UA 4X6HA 4YV8A 1PADA 4OELA 3BB7A 1BQIA 1KHPA 1BP4A 1PPPA 1GCBA 5JZEA 1NPZA 1AYUA 3KSEA 4CZWA 2DZZA 2J7QA 4RF0A 1Y4HA 3PW3A 2HHNA 1NB3A 1YT7A 2YJ2A 5K16A 4YYRA 1ZIVA 2J7QC 2DCBA 1MEMA 3IHPA 2C0YA 1BY8A 4I04A 3IOQA 3S3RA 2HXZA 4YYUA 3AI8A 2BDLA 1EWOA 1F2BA 3BOWA 1AYWA 3C9EA 1KXRA 1DEUA 4DMXA 2AIMA 2IBIA 3DF0A 3BCNA 4X6IA 2DJGB 1YK8A 2DCDA 7PCKA 1A6RA 2DOSA 1TL9A 3TMPA 3V6EA 4KLBA 6PADA 1HUCB 4WA6A 3RVXA 1Q6KA 4W4UA 2AS8A 4RNAA 4D8IA 4XUIA 1KHQA 4ZTBA 2YJBA 4BOUA 1AECA 1JQPA 2VHSA 2R9OA 2PADA 4CDCB 1VJVA 4MI7A 1NL6A 3NHEA 4YVAA 1CTEA 4R3DA 3O65A 4IP3A 2FYEA 2JQGR 3HHIA 4BOQA 1U9XA 1NLJA 2FRQA 4FJCA 2JTCA 1VSNA 2YJCA 3QT4A 2BTWA 3O0UA 3BBAA 2FQ9A 4AXLA 3KFQA 1YVBA 2DC8A 1EWPA 4N4ZA 4MZSA 2NQIA 3MTNA 3WXFA 4I05A 2CIOA 3PNRA 4IUMA 5EGWA 2FT2A 4QRXA 3N3GA 1ITOA 2AGAA 4QH6A 2VHFA 1KFXL 1AYVA 3QJ3A 2Y6EA 2GFOA 1ATKA 3QSDA 1AIMA 2DC7A 1DF0A 3BC3A 3PDFA 4FK5A 5EZQA 1M6DA 3E9SA 3E1ZB 2HH5A 2F7DA 2FTDA 2E00A 3WXEA 3KWBX 4Q8HA 2P7UA 5JH3A 3CBKA 4PP2E 3BY4A 1CSBB 1K3BB 3W31A 4QRGA 4XR7A 2E02A 4REZA 2WBFX 4G54A 3N4CA 3P5VA 4BSQA 1NQCA 3IEJA 2BDZA 5F02A 1PCIA 3GCBA 3PHXA 3TRKA 4D8EA 5EF4A 1CB5A 8PCHA 1ME3A 2HD5A 2GHUA 1EF7A 3K24A 4RF1A 1CV8A 4P6EA 1X9YA 1PPNA 1YALA 3PT2A 1FH0A 3KX1A 1QDQA 3OISA 2ARYA 1AU4A 3ZUAA 2BU3A 2R9NA 1S4VA 1U9VA 4M0WA 3HD3A 4BPVA 2AUZA 4YYSA 1PPDA 1PBHA 3PSEA 1TU6A 1UKFA 3H6SA 3KWZA 3USVA 2Z84A 4OEMA 2H7JA 3B21A 2R9MA 3OVXA 3OVZA 1QXPA 3I3TA 1IWDA 3F5VA 3BPFA 4QRVA 1SNKA 4PT5A 3IV2A 2XU1A 2P86A 1U9QX 3RVWA 4BS5A 3P5WA 2AYNA 3I06A 2G8JA 2HWKA 1PPOA 4N79A 1MEGA 2OZ2A 2DCAA 5EZSA 4BOPA 3H89A 3MHHA 3D6SA 4BOSA 4PADA 4BS6A 2DCCA 1PVJA 5CVOB 4PI3A 4WURA 2FRAA 4P16A 1STFE 2G6DA 4QBBA 4XZXA 1PIPA 3V6CA 3H8BA 3KW9A 2ATOA 1GLOA 2FO5A 1YZBA 2XU3A 1CPJA 5FPWA 2NQGA
chains in the Genus database with same CATH topology
3IUTA 2FUDA 3K9MA 3PBHA 4BQVA 3RVVA 4YYVA 2Y5BA 1F29A 2NQAA 1GMYA 3ERVA 1NB5A 4NV7A 3LFYA 3K8UA 3CH2X 2AU1A 3HWNA 2YJ9A 2O6XA 2DJFB 4CDDB 5A24A 3LXSA 3H7DA 1CS8A 3O1GA 5CHVA 1THEA 1ZCMA 2B1MA 2DC6A 2JQFR 2G8EA 1POPA 4FIPA 3IMAA 1XKGA 1ME4A 1O0EA 5PADA 3BPMA 1QOLA 1BGOA 3CH3X 3HHAA 1MDWA 2YJ8A 1Y08A 1F2CA 4N8WA 2G7YA 5JA7A 1MHWA 3B79A 2E03A 2AYOA 3F75A 2IPPB 2PNSA 4CDFB 1EWMA 1QMYA 4DMYA 2CB5A 4MSXA 4AXMA 2NQDB 3CBJA 1AU2A 1CVZA 1MS6A 3MHSA 2OP3A 1YK7A 3KKUA 1AU3A 1ICFA 4Q8GA 5J94A 1F2AA 4YYWA 1U9WA 9PAPA 2R9CA 3M99A 1CQDA 2AVWA 1MIRA 4HWYA 2PREA 2PBHA 2DC9A 3OF8A 1KFUL 3BWKA 3MORA 4NV8A 2DZYA 2B1NA 4ZUXU 3N3KA 2R6NA 1SP4B 4PP1A 3S3QA 4I07A 2F1GA 1W4TA 2XU4A 2E01A 5CHTA 4YYQA 1U5IA 4RY2A 1AU0A 3P5XA 1TLOA 4W5BA 3WXGA 1W6FA 3U8EA 3H8CA 4P6GA 4W5CA 4K7CA 2R9FA 4C5PA 2AUXA 1PXVA 5CVMA 2P0RA 1EWLA 2ACTA 3TNXA 4BGFA 4CDEB 2OULA 4MZOA 5CVNB 3OF9A 4X6JA 1GECE 1CJLA 2XU5A 1PE6A 3P5UA 4X6HA 4YV8A 1PADA 4OELA 1BQIA 1KHPA 1BP4A 1PPPA 1GCBA 1NPZA 4GUZA 1AYUA 3KSEA 4CZWA 2DZZA 1Y4HA 3PW3A 2HHNA 1NB3A 1YT7A 2YJ2A 2BSZA 5K16A 4YYRA 1ZIVA 2DCBA 1MEMA 3IHPA 2C0YA 1BY8A 4I04A 3IOQA 3S3RA 2HXZA 4YYUA 3AI8A 2BDLA 1EWOA 1F2BA 3BOWA 1AYWA 3C9EA 1KXRA 1DEUA 4DMXA 2AIMA 2IBIA 3DF0A 3BCNA 4X6IA 2DJGB 1YK8A 2DCDA 1W5RA 7PCKA 3LTWA 1A6RA 1TL9A 3V6EA 4KLBA 6PADA 1HUCB 4WA6A 3RVXA 1Q6KA 4W4UA 2AS8A 4XUIA 1KHQA 2YJBA 3D9WA 1AECA 1JQPA 2VHSA 2R9OA 2PADA 4CDCB 1VJVA 1NL6A 3NHEA 4YVAA 1CTEA 2FYEA 2JQGR 3HHIA 1U9XA 1NLJA 2FRQA 4FJCA 1VSNA 2YJCA 3QT4A 3O0UA 2VFCA 2FQ9A 4AXLA 3KFQA 1YVBA 2DC8A 1EWPA 4N4ZA 4MZSA 2NQIA 3MTNA 3WXFA 4I05A 2CIOA 2VFBA 3PNRA 5EGWA 2FT2A 4QRXA 3N3GA 1ITOA 4QH6A 2VHFA 1KFXL 1AYVA 3QJ3A 2Y6EA 2GFOA 1ATKA 3QSDA 1AIMA 2DC7A 1DF0A 3BC3A 3PDFA 4FK5A 1M6DA 3E1ZB 2HH5A 2F7DA 2FTDA 2E00A 3WXEA 3KWBX 4Q8HA 2P7UA 5JH3A 3CBKA 4PP2E 1CSBB 1K3BB 4QRGA 1GX3A 4XR7A 2E02A 2WBFX 4G54A 3N4CA 3P5VA 4BSQA 1NQCA 3IEJA 2BDZA 5F02A 1PCIA 3GCBA 5EF4A 1CB5A 8PCHA 1ME3A 2HD5A 2GHUA 1EF7A 3K24A 1CV8A 4P6EA 1X9YA 1PPNA 1YALA 1FH0A 3KX1A 1QDQA 3OISA 2ARYA 1AU4A 3ZUAA 4B55A 2R9NA 1S4VA 1U9VA 3HD3A 4BPVA 2AUZA 4YYSA 1PPDA 1PBHA 1TU6A 3H6SA 3KWZA 3USVA 4OEMA 2H7JA 2R9MA 3OVXA 3OVZA 1QXPA 3I3TA 1IWDA 3F5VA 3BPFA 4QRVA 1SNKA 3IV2A 2XU1A 2P86A 1U9QX 3RVWA 4BS5A 3P5WA 2AYNA 3I06A 2G8JA 1PPOA 4N79A 1MEGA 2OZ2A 2DCAA 3H89A 3MHHA 3D6SA 4PADA 4BS6A 2DCCA 5CVOB 4PI3A 1E2TA 2FRAA 1STFE 2G6DA 4QBBA 1PIPA 3V6CA 3H8BA 3KW9A 2ATOA 1GLOA 2FO5A 2XU3A 1CPJA 5FPWA 2NQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IUT A;  2FUD A;  3K9M A;  3PBH A;  4BQV A;  3RVV A;  4YYV A;  2Y5B A;  1F29 A;  2NQA A;  1GMY A;  3ERV A;  1NB5 A;  3LFY A;  3K8U A;  3CH2 X;  2AU1 A;  3HWN A;  2YJ9 A;  2O6X A;  2DJF B;  4CDD B;  5A24 A;  3LXS A;  3H7D A;  1CS8 A;  3O1G A;  5CHV A;  1THE A;  1ZCM A;  2B1M A;  2DC6 A;  2JQF R;  2G8E A;  1POP A;  4FIP A;  3IMA A;  1XKG A;  1ME4 A;  1O0E A;  5PAD A;  3BPM A;  1QOL A;  1BGO A;  3CH3 X;  3HHA A;  1MDW A;  2YJ8 A;  1Y08 A;  1F2C A;  4N8W A;  2G7Y A;  5JA7 A;  1MHW A;  3B79 A;  2E03 A;  2AYO A;  3F75 A;  2IPP B;  2PNS A;  4CDF B;  1EWM A;  1QMY A;  4DMY A;  2CB5 A;  4MSX A;  4AXM A;  2NQD B;  3CBJ A;  1AU2 A;  1CVZ A;  1MS6 A;  3MHS A;  2OP3 A;  1YK7 A;  3KKU A;  1AU3 A;  1ICF A;  4Q8G A;  5J94 A;  1F2A A;  4YYW A;  1U9W A;  9PAP A;  2R9C A;  3M99 A;  1CQD A;  2AVW A;  1MIR A;  4HWY A;  2PRE A;  2PBH A;  2DC9 A;  3OF8 A;  1KFU L;  3BWK A;  3MOR A;  2DZY A;  2B1N A;  4ZUX U;  3N3K A;  2R6N A;  4PP1 A;  1SP4 B;  3S3Q A;  4I07 A;  2F1G A;  2XU4 A;  2E01 A;  5CHT A;  4YYQ A;  1U5I A;  4RY2 A;  1AU0 A;  3P5X A;  1TLO A;  4W5B A;  3WXG A;  3U8E A;  3H8C A;  4P6G A;  4W5C A;  4K7C A;  2R9F A;  2AUX A;  1PXV A;  5CVM A;  2P0R A;  1EWL A;  2ACT A;  3TNX A;  4CDE B;  2OUL A;  4MZO A;  5CVN B;  3OF9 A;  4X6J A;  1GEC E;  1CJL A;  2XU5 A;  1PE6 A;  3P5U A;  4X6H A;  4YV8 A;  1PAD A;  4OEL A;  1BQI A;  1KHP A;  1BP4 A;  1PPP A;  1GCB A;  1NPZ A;  1AYU A;  3KSE A;  4CZW A;  2DZZ A;  1Y4H A;  3PW3 A;  2HHN A;  1NB3 A;  1YT7 A;  2YJ2 A;  5K16 A;  4YYR A;  1ZIV A;  2DCB A;  1MEM A;  3IHP A;  2C0Y A;  1BY8 A;  4I04 A;  3IOQ A;  3S3R A;  2HXZ A;  4YYU A;  3AI8 A;  2BDL A;  1EWO A;  1F2B A;  3BOW A;  1AYW A;  3C9E A;  1KXR A;  1DEU A;  4DMX A;  2AIM A;  2IBI A;  3DF0 A;  3BCN A;  4X6I A;  2DJG B;  1YK8 A;  2DCD A;  7PCK A;  1A6R A;  1TL9 A;  3V6E A;  4KLB A;  6PAD A;  1HUC B;  4WA6 A;  3RVX A;  1Q6K A;  4W4U A;  2AS8 A;  4XUI A;  1KHQ A;  2YJB A;  1AEC A;  1JQP A;  2VHS A;  2R9O A;  2PAD A;  4CDC B;  1VJV A;  1NL6 A;  3NHE A;  4YVA A;  1CTE A;  2FYE A;  2JQG R;  3HHI A;  1U9X A;  1NLJ A;  2FRQ A;  4FJC A;  1VSN A;  2YJC A;  3QT4 A;  3O0U A;  2FQ9 A;  4AXL A;  3KFQ A;  1YVB A;  2DC8 A;  1EWP A;  4N4Z A;  4MZS A;  2NQI A;  3MTN A;  3WXF A;  4I05 A;  2CIO A;  3PNR A;  5EGW A;  2FT2 A;  4QRX A;  3N3G A;  1ITO A;  4QH6 A;  2VHF A;  1KFX L;  1AYV A;  3QJ3 A;  2Y6E A;  2GFO A;  1ATK A;  3QSD A;  1AIM A;  2DC7 A;  1DF0 A;  3BC3 A;  3PDF A;  4FK5 A;  1M6D A;  3E1Z B;  2HH5 A;  2F7D A;  2FTD A;  2E00 A;  3WXE A;  3KWB X;  4Q8H A;  2P7U A;  5JH3 A;  3CBK A;  4PP2 E;  1CSB B;  1K3B B;  4QRG A;  4XR7 A;  2E02 A;  2WBF X;  4G54 A;  3N4C A;  3P5V A;  4BSQ A;  1NQC A;  3IEJ A;  2BDZ A;  5F02 A;  1PCI A;  3GCB A;  5EF4 A;  1CB5 A;  8PCH A;  1ME3 A;  2HD5 A;  2GHU A;  1EF7 A;  3K24 A;  1CV8 A;  4P6E A;  1X9Y A;  1PPN A;  1YAL A;  1FH0 A;  3KX1 A;  1QDQ A;  3OIS A;  2ARY A;  1AU4 A;  3ZUA A;  2R9N A;  1S4V A;  1U9V A;  3HD3 A;  4BPV A;  2AUZ A;  4YYS A;  1PPD A;  1PBH A;  1TU6 A;  3H6S A;  3KWZ A;  3USV A;  4OEM A;  2H7J A;  2R9M A;  3OVX A;  3OVZ A;  1QXP A;  3I3T A;  1IWD A;  3F5V A;  3BPF A;  4QRV A;  1SNK A;  3IV2 A;  2XU1 A;  2P86 A;  1U9Q X;  3RVW A;  4BS5 A;  3P5W A;  2AYN A;  3I06 A;  2G8J A;  1PPO A;  4N79 A;  1MEG A;  2OZ2 A;  2DCA A;  3H89 A;  3MHH A;  3D6S A;  4PAD A;  4BS6 A;  2DCC A;  5CVO B;  4PI3 A;  2FRA A;  1STF E;  2G6D A;  4QBB A;  1PIP A;  3V6C A;  3H8B A;  3KW9 A;  2ATO A;  1GLO A;  2FO5 A;  2XU3 A;  1CPJ A;  5FPW A;  2NQG A; 
#chains in the Genus database with same CATH topology
 3IUT A;  3PHU A;  4OVZ B;  2FUD A;  5E6J A;  2FE8 A;  3K9M A;  3PBH A;  4BQV A;  3RVV A;  4YYV A;  2Y5B A;  1F29 A;  2NQA A;  1GMY A;  3ERV A;  1NB5 A;  3LFY A;  3K8U A;  3W30 A;  1DKI A;  3CH2 X;  4D8B A;  2AU1 A;  3HWN A;  2YJ9 A;  2O6X A;  2DJF B;  4CDD B;  5A24 A;  4MM3 B;  3LXS A;  3H7D A;  1CS8 A;  3O1G A;  3OQC A;  5CHV A;  2UZJ A;  1THE A;  4OVZ A;  4A5U A;  1ZCM A;  2B1M A;  2DC6 A;  2JQF R;  2G8E A;  1POP A;  3MJ5 A;  4FIP A;  3IMA A;  1XKG A;  3PHW A;  1ME4 A;  4RKX A;  5KO3 A;  3MTV A;  1O0E A;  5PAD A;  3BPM A;  1QOL A;  1BGO A;  3CH3 X;  3HHA A;  1MDW A;  2YJ8 A;  1Y08 A;  1F2C A;  4N8W A;  2G7Y A;  5JA7 A;  1MHW A;  3B79 A;  4OW0 A;  2E03 A;  2AYO A;  3F75 A;  2IPP B;  2PNS A;  3RNV A;  4CDF B;  1EWM A;  1QMY A;  4DMY A;  2CB5 A;  4MSX A;  4AXM A;  2NQD B;  3CBJ A;  4GUA A;  1AU2 A;  1CVZ A;  3MHS A;  1MS6 A;  2OP3 A;  1YK7 A;  3KKU A;  1AU3 A;  1ICF A;  4Q8G A;  5J94 A;  1F2A A;  4YYW A;  1U9W A;  9PAP A;  2R9C A;  3M99 A;  1CQD A;  3PRP A;  2AVW A;  1MIR A;  4HWY A;  2PRE A;  2PBH A;  2BTW B;  2DC9 A;  3OF8 A;  1KFU L;  3BWK A;  3MOR A;  2DZY A;  2B1N A;  4ZUX U;  3N3K A;  2R6N A;  1SP4 B;  4PP1 A;  3S3Q A;  4I07 A;  2F1G A;  2XU4 A;  2E01 A;  5CHT A;  4YYQ A;  1U5I A;  4RY2 A;  1AU0 A;  3P5X A;  1TLO A;  4W5B A;  3WXG A;  2JRI A;  4BOZ A;  3U8E A;  3IFU A;  3H8C A;  3PRM A;  4P6G A;  3MP2 A;  4HXD B;  4W5C A;  4K7C A;  2R9F A;  2AUX A;  1PXV A;  3C0R A;  5CVM A;  2P0R A;  1EWL A;  2ACT A;  3TNX A;  4CDE B;  2OUL A;  4MZO A;  5CVN B;  3OF9 A;  4X6J A;  1GEC E;  1CJL A;  2XU5 A;  1PE6 A;  3ZNH A;  3P5U A;  4X6H A;  4YV8 A;  1PAD A;  4OEL A;  3BB7 A;  1BQI A;  1KHP A;  1BP4 A;  1PPP A;  1GCB A;  5JZE A;  1NPZ A;  1AYU A;  3KSE A;  4CZW A;  2DZZ A;  2J7Q A;  4RF0 A;  1Y4H A;  3PW3 A;  2HHN A;  1NB3 A;  1YT7 A;  2YJ2 A;  5K16 A;  4YYR A;  1ZIV A;  2J7Q C;  2DCB A;  1MEM A;  3IHP A;  2C0Y A;  1BY8 A;  4I04 A;  3IOQ A;  3S3R A;  2HXZ A;  4YYU A;  3AI8 A;  2BDL A;  1EWO A;  1F2B A;  3BOW A;  1AYW A;  3C9E A;  1KXR A;  1DEU A;  4DMX A;  2AIM A;  2IBI A;  3DF0 A;  3BCN A;  4X6I A;  2DJG B;  1YK8 A;  2DCD A;  7PCK A;  1A6R A;  2DOS A;  1TL9 A;  3TMP A;  3V6E A;  4KLB A;  6PAD A;  1HUC B;  4WA6 A;  3RVX A;  1Q6K A;  4W4U A;  2AS8 A;  4RNA A;  4D8I A;  4XUI A;  1KHQ A;  4ZTB A;  2YJB A;  4BOU A;  1AEC A;  1JQP A;  2VHS A;  2R9O A;  2PAD A;  4CDC B;  1VJV A;  4MI7 A;  1NL6 A;  3NHE A;  4YVA A;  1CTE A;  4R3D A;  3O65 A;  4IP3 A;  2FYE A;  2JQG R;  3HHI A;  4BOQ A;  1U9X A;  1NLJ A;  2FRQ A;  4FJC A;  2JTC A;  1VSN A;  2YJC A;  3QT4 A;  2BTW A;  3O0U A;  3BBA A;  2FQ9 A;  4AXL A;  3KFQ A;  1YVB A;  2DC8 A;  1EWP A;  4N4Z A;  4MZS A;  2NQI A;  3MTN A;  3WXF A;  4I05 A;  2CIO A;  3PNR A;  4IUM A;  5EGW A;  2FT2 A;  4QRX A;  3N3G A;  1ITO A;  2AGA A;  4QH6 A;  2VHF A;  1KFX L;  1AYV A;  3QJ3 A;  2Y6E A;  2GFO A;  1ATK A;  3QSD A;  1AIM A;  2DC7 A;  1DF0 A;  3BC3 A;  3PDF A;  4FK5 A;  5EZQ A;  1M6D A;  3E9S A;  3E1Z B;  2HH5 A;  2F7D A;  2FTD A;  2E00 A;  3WXE A;  3KWB X;  4Q8H A;  2P7U A;  5JH3 A;  3CBK A;  4PP2 E;  3BY4 A;  1CSB B;  1K3B B;  3W31 A;  4QRG A;  4XR7 A;  2E02 A;  4REZ A;  2WBF X;  4G54 A;  3N4C A;  3P5V A;  4BSQ A;  1NQC A;  3IEJ A;  2BDZ A;  5F02 A;  1PCI A;  3GCB A;  3PHX A;  3TRK A;  4D8E A;  5EF4 A;  1CB5 A;  8PCH A;  1ME3 A;  2HD5 A;  2GHU A;  1EF7 A;  3K24 A;  4RF1 A;  1CV8 A;  4P6E A;  1X9Y A;  1PPN A;  1YAL A;  3PT2 A;  1FH0 A;  3KX1 A;  1QDQ A;  3OIS A;  2ARY A;  1AU4 A;  3ZUA A;  2BU3 A;  2R9N A;  1S4V A;  1U9V A;  4M0W A;  3HD3 A;  4BPV A;  2AUZ A;  4YYS A;  1PPD A;  1PBH A;  3PSE A;  1TU6 A;  1UKF A;  3H6S A;  3KWZ A;  3USV A;  2Z84 A;  4OEM A;  2H7J A;  3B21 A;  2R9M A;  3OVX A;  3OVZ A;  1QXP A;  3I3T A;  1IWD A;  3F5V A;  3BPF A;  4QRV A;  1SNK A;  4PT5 A;  3IV2 A;  2XU1 A;  2P86 A;  1U9Q X;  3RVW A;  4BS5 A;  3P5W A;  2AYN A;  3I06 A;  2G8J A;  2HWK A;  1PPO A;  4N79 A;  1MEG A;  2OZ2 A;  2DCA A;  5EZS A;  4BOP A;  3H89 A;  3MHH A;  3D6S A;  4BOS A;  4PAD A;  4BS6 A;  2DCC A;  1PVJ A;  5CVO B;  4PI3 A;  4WUR A;  2FRA A;  4P16 A;  1STF E;  2G6D A;  4QBB A;  4XZX A;  1PIP A;  3V6C A;  3H8B A;  3KW9 A;  2ATO A;  1GLO A;  2FO5 A;  1YZB A;  2XU3 A;  1CPJ A;  5FPW A;  2NQG A; 
#chains in the Genus database with same CATH homology
 3IUT A;  2FUD A;  3K9M A;  3PBH A;  4BQV A;  3RVV A;  4YYV A;  2Y5B A;  1F29 A;  2NQA A;  1GMY A;  3ERV A;  1NB5 A;  4NV7 A;  3LFY A;  3K8U A;  3CH2 X;  2AU1 A;  3HWN A;  2YJ9 A;  2O6X A;  2DJF B;  4CDD B;  5A24 A;  3LXS A;  3H7D A;  1CS8 A;  3O1G A;  5CHV A;  1THE A;  1ZCM A;  2B1M A;  2DC6 A;  2JQF R;  2G8E A;  1POP A;  4FIP A;  3IMA A;  1XKG A;  1ME4 A;  1O0E A;  5PAD A;  3BPM A;  1QOL A;  1BGO A;  3CH3 X;  3HHA A;  1MDW A;  2YJ8 A;  1Y08 A;  1F2C A;  4N8W A;  2G7Y A;  5JA7 A;  1MHW A;  3B79 A;  2E03 A;  2AYO A;  3F75 A;  2IPP B;  2PNS A;  4CDF B;  1EWM A;  1QMY A;  4DMY A;  2CB5 A;  4MSX A;  4AXM A;  2NQD B;  3CBJ A;  1AU2 A;  1CVZ A;  1MS6 A;  3MHS A;  2OP3 A;  1YK7 A;  3KKU A;  1AU3 A;  1ICF A;  4Q8G A;  5J94 A;  1F2A A;  4YYW A;  1U9W A;  9PAP A;  2R9C A;  3M99 A;  1CQD A;  2AVW A;  1MIR A;  4HWY A;  2PRE A;  2PBH A;  2DC9 A;  3OF8 A;  1KFU L;  3BWK A;  3MOR A;  4NV8 A;  2DZY A;  2B1N A;  4ZUX U;  3N3K A;  2R6N A;  1SP4 B;  4PP1 A;  3S3Q A;  4I07 A;  2F1G A;  1W4T A;  2XU4 A;  2E01 A;  5CHT A;  4YYQ A;  1U5I A;  4RY2 A;  1AU0 A;  3P5X A;  1TLO A;  4W5B A;  3WXG A;  1W6F A;  3U8E A;  3H8C A;  4P6G A;  4W5C A;  4K7C A;  2R9F A;  4C5P A;  2AUX A;  1PXV A;  5CVM A;  2P0R A;  1EWL A;  2ACT A;  3TNX A;  4BGF A;  4CDE B;  2OUL A;  4MZO A;  5CVN B;  3OF9 A;  4X6J A;  1GEC E;  1CJL A;  2XU5 A;  1PE6 A;  3P5U A;  4X6H A;  4YV8 A;  1PAD A;  4OEL A;  1BQI A;  1KHP A;  1BP4 A;  1PPP A;  1GCB A;  1NPZ A;  4GUZ A;  1AYU A;  3KSE A;  4CZW A;  2DZZ A;  1Y4H A;  3PW3 A;  2HHN A;  1NB3 A;  1YT7 A;  2YJ2 A;  2BSZ A;  5K16 A;  4YYR A;  1ZIV A;  2DCB A;  1MEM A;  3IHP A;  2C0Y A;  1BY8 A;  4I04 A;  3IOQ A;  3S3R A;  2HXZ A;  4YYU A;  3AI8 A;  2BDL A;  1EWO A;  1F2B A;  3BOW A;  1AYW A;  3C9E A;  1KXR A;  1DEU A;  4DMX A;  2AIM A;  2IBI A;  3DF0 A;  3BCN A;  4X6I A;  2DJG B;  1YK8 A;  2DCD A;  1W5R A;  7PCK A;  3LTW A;  1A6R A;  1TL9 A;  3V6E A;  4KLB A;  6PAD A;  1HUC B;  4WA6 A;  3RVX A;  1Q6K A;  4W4U A;  2AS8 A;  4XUI A;  1KHQ A;  2YJB A;  3D9W A;  1AEC A;  1JQP A;  2VHS A;  2R9O A;  2PAD A;  4CDC B;  1VJV A;  1NL6 A;  3NHE A;  4YVA A;  1CTE A;  2FYE A;  2JQG R;  3HHI A;  1U9X A;  1NLJ A;  2FRQ A;  4FJC A;  1VSN A;  2YJC A;  3QT4 A;  3O0U A;  2VFC A;  2FQ9 A;  4AXL A;  3KFQ A;  1YVB A;  2DC8 A;  1EWP A;  4N4Z A;  4MZS A;  2NQI A;  3MTN A;  3WXF A;  4I05 A;  2CIO A;  2VFB A;  3PNR A;  5EGW A;  2FT2 A;  4QRX A;  3N3G A;  1ITO A;  4QH6 A;  2VHF A;  1KFX L;  1AYV A;  3QJ3 A;  2Y6E A;  2GFO A;  1ATK A;  3QSD A;  1AIM A;  2DC7 A;  1DF0 A;  3BC3 A;  3PDF A;  4FK5 A;  1M6D A;  3E1Z B;  2HH5 A;  2F7D A;  2FTD A;  2E00 A;  3WXE A;  3KWB X;  4Q8H A;  2P7U A;  5JH3 A;  3CBK A;  4PP2 E;  1CSB B;  1K3B B;  4QRG A;  1GX3 A;  4XR7 A;  2E02 A;  2WBF X;  4G54 A;  3N4C A;  3P5V A;  4BSQ A;  1NQC A;  3IEJ A;  2BDZ A;  5F02 A;  1PCI A;  3GCB A;  5EF4 A;  1CB5 A;  8PCH A;  1ME3 A;  2HD5 A;  2GHU A;  1EF7 A;  3K24 A;  1CV8 A;  4P6E A;  1X9Y A;  1PPN A;  1YAL A;  1FH0 A;  3KX1 A;  1QDQ A;  3OIS A;  2ARY A;  1AU4 A;  3ZUA A;  4B55 A;  2R9N A;  1S4V A;  1U9V A;  3HD3 A;  4BPV A;  2AUZ A;  4YYS A;  1PPD A;  1PBH A;  1TU6 A;  3H6S A;  3KWZ A;  3USV A;  4OEM A;  2H7J A;  2R9M A;  3OVX A;  3OVZ A;  1QXP A;  3I3T A;  1IWD A;  3F5V A;  3BPF A;  4QRV A;  1SNK A;  3IV2 A;  2XU1 A;  2P86 A;  1U9Q X;  3RVW A;  4BS5 A;  3P5W A;  2AYN A;  3I06 A;  2G8J A;  1PPO A;  4N79 A;  1MEG A;  2OZ2 A;  2DCA A;  3H89 A;  3MHH A;  3D6S A;  4PAD A;  4BS6 A;  2DCC A;  5CVO B;  4PI3 A;  1E2T A;  2FRA A;  1STF E;  2G6D A;  4QBB A;  1PIP A;  3V6C A;  3H8B A;  3KW9 A;  2ATO A;  1GLO A;  2FO5 A;  2XU3 A;  1CPJ A;  5FPW A;  2NQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...