1CTEA

Crystal structures of recombinant rat cathepsin b and a cathepsin b-inhibitor complex: implications for structure-based inhibitor design
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
253
structure length
253
Chain Sequence
LPESFDAREQWSNCPTIAQIRDQGSCGSCWAFGAVEAMSDRICIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWNFWTRKGLVSGGVYNSHIGCLPYTIPPCEHHVNGARPPCTGEGDTPKCNKMCEAGYSTSYKEDKHYGYTSYSVSDSEKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDVMGGHAIRILGWGIENGVPYWLVANSWNADWGDNGFFKILRGENHCGIESEIVAGIPRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN B
publication title Crystal structures of recombinant rat cathepsin B and a cathepsin B-inhibitor complex. Implications for structure-based inhibitor design.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Thiol protease
total genus 69
structure length 253
sequence length 253
chains with identical sequence B
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 1995-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1cteA00
1U5IA 1JQPA 1U9VA 1U9QX 4PI3A 4AXMA 2GFOA 1CSBB 1DF0A 2AUZA 4QH6A 3OF8A 3PW3A 1MDWA 2R6NA 1S4VA 2DCDA 4G54A 3LFYA 2AS8A 2OULA 3V6EA 4CDCB 1PXVA 1XKGA 4CZWA 1U9WA 1GLOA 1GECE 1MS6A 1PCIA 2FT2A 4I04A 1PE6A 5CVMA 1ZIVA 4N8WA 3BPMA 3HD3A 2XU4A 1YALA 4X6JA 2IBIA 3H6SA 3MHSA 1EF7A 1AU2A 2AUXA 3PBHA 5EF4A 3HWNA 3MTNA 5CHVA 4YV8A 3V6CA 3HHAA 2C0YA 5JH3A 2VHFA 2DCBA 2O6XA 2R9NA 1A6RA 2Y6EA 4QRGA 4W5CA 4PADA 4BSQA 3IMAA 1EWLA 2AIMA 1ICFA 4DMXA 3IHPA 1AYVA 4FJCA 2E01A 1VJVA 1PPNA 4P6EA 1SP4B 1GCBA 1MEGA 3CBKA 3WXEA 3H8CA 1O0EA 2NQDB 1MIRA 5K16A 1F2BA 3K24A 1PPOA 1F2CA 4W4UA 1CTEA 1ME3A 1X9YA 4K7CA 4BS6A 3KWZA 2R9MA 4YYRA 1AYWA 2NQIA 1AYUA 2H7JA 3F5VA 2DCAA 3KSEA 1BP4A 3O1GA 4P6GA 6PADA 4MZOA 2DZYA 1KHQA 1BQIA 4AXLA 3ERVA 3USVA 1YK8A 4MSXA 2FUDA 4YYSA 1PPPA 3WXGA 2YJ9A 1CV8A 1GMYA 2FYEA 4OEMA 8PCHA 2G7YA 1Y4HA 2HHNA 2ATOA 1F29A 1NPZA 3H89A 3KX1A 1QMYA 2YJ2A 4N4ZA 4Q8GA 3I3TA 3IOQA 2AVWA 4BS5A 1TLOA 4OELA 4XR7A 1CPJA 5CHTA 3RVVA 2AYOA 2OP3A 4CDFB 4X6HA 3IUTA 4CDEB 1QOLA 3PDFA 1YT7A 1AIMA 1Q6KA 1FH0A 2P0RA 4HWYA 3C9EA 2B1MA 2R9OA 3BOWA 1YVBA 3F75A 3ZUAA 5JA7A 4BPVA 3M99A 3N3GA 3E1ZB 2VHSA 2R9FA 7PCKA 4FK5A 3MHHA 1QXPA 1MHWA 4X6IA 3H7DA 3HHIA 3S3QA 2DJGB 4WA6A 3S3RA 5PADA 2FRQA 3IV2A 5CVNB 1KXRA 2HXZA 1EWMA 1M6DA 5EGWA 3OF9A 3TNXA 3OVZA 3I06A 2BDLA 3N4CA 4CDDB 5CVOB 5A24A 4XUIA 3KKUA 2E03A 2XU5A 2YJ8A 1STFE 2DC8A 1PADA 2P86A 1Y08A 2HD5A 2CB5A 4BQVA 1AU0A 3QJ3A 4Q8HA 1VSNA 2XU3A 4YYQA 1ITOA 2YJBA 1POPA 3CH2X 2DC6A 4YVAA 3P5UA 2AU1A 1KHPA 3WXFA 1KFXL 1NB3A 4ZUXU 1TL9A 1K3BB 1CQDA 2DZZA 3RVXA 3OVXA 2G6DA 2JQGR 2HH5A 2NQAA 3N3KA 4I07A 5FPWA 3K8UA 2G8EA 3RVWA 2ARYA 2IPPB 5J94A 1SNKA 4YYVA 3P5XA 2BDZA 1QDQA 2E02A 3QT4A 1CB5A 3K9MA 2DC9A 3KWBX 2DCCA 1BY8A 3BPFA 1TU6A 3IEJA 2PADA 1MEMA 2FO5A 4RY2A 3D6SA 1KFUL 3NHEA 4MZSA 3KW9A 4PP1A 2OZ2A 1ME4A 2AYNA 2P7UA 3LXSA 4I05A 9PAPA 2E00A 5F02A 1CVZA 2F1GA 1BGOA 3GCBA 3QSDA 1THEA 3AI8A 1IWDA 2CIOA 3BCNA 2PNSA 1DEUA 1AU3A 2GHUA 2NQGA 1AECA 3BC3A 2PREA 3MORA 1NLJA 1YK7A 2ACTA 1AU4A 4QRXA 3U8EA 2XU1A 3O0UA 2WBFX 2YJCA 3B79A 3H8BA 3P5VA 1U9XA 3KFQA 1ZCMA 3CH3X 4QRVA 1HUCB 1PPDA 1F2AA 2PBHA 2R9CA 4YYUA 3OISA 1NQCA 2FRAA 3DF0A 4W5BA 2JQFR 2Y5BA 2DJFB 4KLBA 1CS8A 4YYWA 1EWPA 2G8JA 1EWOA 2DC7A 3CBJA 2B1NA 1NL6A 1PBHA 4PP2E 4QBBA 1ATKA 1NB5A 1PIPA 2FQ9A 1CJLA 2F7DA 3P5WA 3BWKA 2FTDA 3PNRA 4FIPA 4N79A 4DMYA
chains in the Genus database with same CATH superfamily
1U5IA 1JQPA 3PRMA 1U9VA 1U9QX 1UKFA 4PI3A 4AXMA 2JTCA 3C0RA 2GFOA 1CSBB 1DF0A 3PSEA 2AUZA 4D8BA 4QH6A 1DKIA 3OF8A 4REZA 3PW3A 1MDWA 3MJ5A 2R6NA 1S4VA 2DCDA 4G54A 3LFYA 2AS8A 2OULA 3V6EA 4CDCB 1PXVA 1XKGA 3PT2A 4CZWA 1U9WA 1GLOA 1GECE 1MS6A 1PCIA 2FT2A 4I04A 1PE6A 5CVMA 1ZIVA 3B21A 4N8WA 3BPMA 3HD3A 2XU4A 1YALA 4X6JA 2IBIA 3H6SA 3MHSA 1EF7A 4OW0A 1AU2A 2AUXA 3PBHA 5EF4A 3HWNA 3MTNA 5CHVA 4YV8A 3V6CA 2DOSA 3HHAA 2C0YA 4D8IA 2VHFA 5JH3A 2DCBA 2O6XA 2R9NA 1A6RA 2Y6EA 4QRGA 4W5CA 3W31A 4PADA 2FE8A 4BSQA 3IMAA 1EWLA 2AIMA 1ICFA 4DMXA 3IHPA 1AYVA 4FJCA 2E01A 1VJVA 1PPNA 4P6EA 1SP4B 1GCBA 1MEGA 3CBKA 3WXEA 4RNAA 3H8CA 1O0EA 2NQDB 1MIRA 5K16A 1F2BA 3K24A 1PPOA 3BBAA 1F2CA 4W4UA 1CTEA 1ME3A 3TMPA 1X9YA 4K7CA 4BS6A 3KWZA 2R9MA 4YYRA 1AYWA 2NQIA 1AYUA 4RF1A 2H7JA 3F5VA 4BOPA 2DCAA 3PHUA 3KSEA 4MI7A 1BP4A 1YZBA 3O1GA 4P6GA 6PADA 4MZOA 2DZYA 1KHQA 1BQIA 4AXLA 3ERVA 3USVA 1YK8A 4MSXA 2FUDA 4YYSA 1PPPA 4OVZA 3WXGA 2YJ9A 1CV8A 1GMYA 2FYEA 4OEMA 8PCHA 2G7YA 1Y4HA 2HHNA 2ATOA 1F29A 4R3DA 1NPZA 3H89A 3KX1A 1QMYA 2YJ2A 4N4ZA 4Q8GA 3ZNHA 3I3TA 3IOQA 2AVWA 4BS5A 1TLOA 4OELA 4XR7A 1CPJA 5CHTA 3BY4A 3W30A 3RVVA 2AYOA 2OP3A 4CDFB 4X6HA 3IUTA 4CDEB 1QOLA 3PDFA 1YT7A 1AIMA 1Q6KA 1FH0A 2P0RA 4HWYA 3C9EA 2B1MA 2BTWB 2R9OA 3BB7A 3BOWA 1YVBA 3MTVA 3F75A 2UZJA 3ZUAA 5JA7A 4BPVA 3M99A 3N3GA 3E1ZB 2VHSA 2R9FA 7PCKA 4FK5A 3MHHA 1QXPA 1MHWA 5KO3A 4X6IA 3H7DA 3HHIA 3S3QA 2DJGB 4WA6A 4GUAA 3S3RA 2JRIA 5PADA 2FRQA 3IV2A 5CVNB 5EZSA 1KXRA 2HXZA 1EWMA 1M6DA 5EGWA 3OF9A 3TNXA 3OVZA 3I06A 2BDLA 3N4CA 4CDDB 4RKXA 5CVOB 5A24A 4D8EA 4XUIA 3KKUA 2E03A 2XU5A 2YJ8A 1STFE 4BOZA 2DC8A 1PADA 2P86A 1Y08A 2HD5A 2CB5A 4BQVA 3RNVA 1AU0A 3QJ3A 4Q8HA 1VSNA 2XU3A 4YYQA 1ITOA 2YJBA 1POPA 4XZXA 3CH2X 2DC6A 4YVAA 3P5UA 2AU1A 1KHPA 3WXFA 1KFXL 1NB3A 4ZUXU 4P16A 1TL9A 1K3BB 1CQDA 2DZZA 3RVXA 3OVXA 2AGAA 2G6DA 2HWKA 2JQGR 2HH5A 2NQAA 3N3KA 2Z84A 4I07A 1PVJA 4A5UA 3OQCA 5FPWA 3K8UA 4BOUA 2G8EA 3RVWA 3O65A 2ARYA 2IPPB 5J94A 1SNKA 4YYVA 3P5XA 3MP2A 3PHXA 2BDZA 4ZTBA 1QDQA 2E02A 3QT4A 4HXDB 1CB5A 4BOSA 3K9MA 4MM3B 4M0WA 2DC9A 3KWBX 2DCCA 1BY8A 3BPFA 3PRPA 1TU6A 3IEJA 2PADA 1MEMA 2FO5A 4RY2A 3D6SA 1KFUL 3NHEA 4MZSA 3KW9A 4IUMA 4PP1A 2OZ2A 1ME4A 2AYNA 4IP3A 2P7UA 3LXSA 2BU3A 4I05A 9PAPA 2E00A 5F02A 1CVZA 2F1GA 1BGOA 3GCBA 3QSDA 5E6JA 1THEA 3AI8A 3TRKA 5EZQA 1IWDA 3IFUA 2CIOA 3BCNA 2PNSA 4OVZB 5JZEA 1DEUA 1AU3A 2GHUA 2NQGA 1AECA 3BC3A 4BOQA 2PREA 4WURA 3MORA 1NLJA 1YK7A 2ACTA 1AU4A 4QRXA 3U8EA 2XU1A 3O0UA 2WBFX 2YJCA 3B79A 3H8BA 3P5VA 3E9SA 1U9XA 3KFQA 1ZCMA 3CH3X 4QRVA 1HUCB 1PPDA 4PT5A 1F2AA 2PBHA 2R9CA 2BTWA 2J7QC 4YYUA 3OISA 1NQCA 2FRAA 3DF0A 4W5BA 2JQFR 2Y5BA 2DJFB 4KLBA 3PHWA 1CS8A 4YYWA 1EWPA 2J7QA 2G8JA 1EWOA 2DC7A 3CBJA 4RF0A 2B1NA 1NL6A 1PBHA 4PP2E 4QBBA 1ATKA 1NB5A 1PIPA 2FQ9A 1CJLA 2F7DA 3P5WA 3BWKA 2FTDA 3PNRA 4FIPA 4N79A 4DMYA
chains in the Genus database with same CATH topology
1U5IA 1JQPA 1U9VA 1U9QX 4PI3A 4AXMA 2GFOA 1CSBB 1DF0A 2AUZA 4QH6A 3OF8A 3PW3A 1MDWA 2R6NA 1S4VA 2DCDA 4G54A 3LFYA 2AS8A 2OULA 3V6EA 4CDCB 1PXVA 1XKGA 4CZWA 1GX3A 1U9WA 1GLOA 1GECE 1MS6A 1PCIA 2FT2A 4I04A 1PE6A 5CVMA 1ZIVA 4N8WA 3BPMA 3HD3A 2XU4A 1YALA 4X6JA 2IBIA 3H6SA 3MHSA 1EF7A 1AU2A 2AUXA 3PBHA 5EF4A 3HWNA 3MTNA 5CHVA 4YV8A 3V6CA 3HHAA 2C0YA 5JH3A 2VHFA 2DCBA 2O6XA 2R9NA 1A6RA 2Y6EA 4QRGA 4W5CA 4PADA 2VFCA 4BSQA 3IMAA 1EWLA 2AIMA 1ICFA 4DMXA 1W5RA 3IHPA 1AYVA 4FJCA 2E01A 1VJVA 1PPNA 4P6EA 1SP4B 1GCBA 1MEGA 3CBKA 3WXEA 3H8CA 1O0EA 2NQDB 1MIRA 5K16A 1F2BA 3K24A 1PPOA 1F2CA 4W4UA 1CTEA 1ME3A 1X9YA 4K7CA 4BS6A 1W4TA 2R9MA 3KWZA 4YYRA 1AYWA 2NQIA 1AYUA 2H7JA 3F5VA 2DCAA 3KSEA 1BP4A 3O1GA 4P6GA 6PADA 4MZOA 2DZYA 1KHQA 1BQIA 4AXLA 3ERVA 3USVA 1YK8A 4MSXA 2FUDA 4YYSA 1PPPA 3WXGA 2YJ9A 1CV8A 1GMYA 2FYEA 4OEMA 8PCHA 2G7YA 1Y4HA 2HHNA 2ATOA 1F29A 4C5PA 1NPZA 3H89A 3KX1A 1QMYA 2YJ2A 4N4ZA 4Q8GA 3I3TA 3IOQA 2AVWA 4BS5A 1TLOA 4OELA 4XR7A 1CPJA 5CHTA 3RVVA 2AYOA 2OP3A 4CDFB 4X6HA 3IUTA 4CDEB 1QOLA 3PDFA 1YT7A 1AIMA 1Q6KA 1FH0A 2P0RA 4HWYA 3C9EA 2B1MA 2R9OA 3BOWA 1YVBA 3F75A 3ZUAA 5JA7A 4BPVA 3M99A 3N3GA 3E1ZB 2VHSA 2R9FA 7PCKA 4FK5A 4NV7A 3MHHA 1QXPA 1MHWA 4X6IA 3H7DA 3HHIA 3S3QA 2DJGB 4WA6A 3S3RA 2BSZA 5PADA 2FRQA 3IV2A 5CVNB 1KXRA 2HXZA 1EWMA 1M6DA 5EGWA 3OF9A 3TNXA 3OVZA 3I06A 4GUZA 2BDLA 3N4CA 4CDDB 5CVOB 1W6FA 5A24A 4XUIA 3KKUA 2E03A 3D9WA 2XU5A 2YJ8A 1STFE 2DC8A 1PADA 2P86A 1Y08A 2HD5A 2CB5A 4BQVA 1AU0A 2VFBA 3QJ3A 4Q8HA 1VSNA 2XU3A 4YYQA 1ITOA 2YJBA 1POPA 4BGFA 3CH2X 2DC6A 4YVAA 3P5UA 2AU1A 1KHPA 3WXFA 1KFXL 1NB3A 4NV8A 4ZUXU 1TL9A 1K3BB 1CQDA 2DZZA 3RVXA 3OVXA 2G6DA 2JQGR 2HH5A 2NQAA 3N3KA 4I07A 3LTWA 5FPWA 3K8UA 2G8EA 3RVWA 2ARYA 2IPPB 5J94A 1E2TA 1SNKA 4YYVA 3P5XA 2BDZA 1QDQA 2E02A 3QT4A 1CB5A 3K9MA 2DC9A 3KWBX 2DCCA 1BY8A 3BPFA 1TU6A 3IEJA 2PADA 1MEMA 2FO5A 4RY2A 3D6SA 1KFUL 3NHEA 4MZSA 3KW9A 4PP1A 2OZ2A 1ME4A 2AYNA 2P7UA 3LXSA 4I05A 9PAPA 2E00A 5F02A 1CVZA 2F1GA 1BGOA 3GCBA 3QSDA 1THEA 3AI8A 1IWDA 2CIOA 3BCNA 2PNSA 1DEUA 1AU3A 2GHUA 2NQGA 1AECA 3BC3A 2PREA 3MORA 1NLJA 1YK7A 2ACTA 1AU4A 4QRXA 3U8EA 2XU1A 3O0UA 2WBFX 2YJCA 3B79A 3H8BA 3P5VA 1U9XA 3KFQA 1ZCMA 3CH3X 4QRVA 1HUCB 1PPDA 1F2AA 2PBHA 2R9CA 4YYUA 4B55A 3OISA 1NQCA 2FRAA 3DF0A 4W5BA 2JQFR 2Y5BA 2DJFB 4KLBA 1CS8A 4YYWA 1EWPA 2G8JA 1EWOA 2DC7A 3CBJA 2B1NA 1NL6A 1PBHA 4PP2E 4QBBA 1ATKA 1NB5A 1PIPA 2FQ9A 1CJLA 2F7DA 3P5WA 3BWKA 2FTDA 3PNRA 4FIPA 4N79A 4DMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U5I A;  1JQP A;  1U9V A;  1U9Q X;  4PI3 A;  4AXM A;  2GFO A;  1CSB B;  1DF0 A;  2AUZ A;  4QH6 A;  3OF8 A;  3PW3 A;  1MDW A;  2R6N A;  1S4V A;  2DCD A;  4G54 A;  3LFY A;  2AS8 A;  2OUL A;  3V6E A;  4CDC B;  1PXV A;  1XKG A;  4CZW A;  1U9W A;  1GLO A;  1GEC E;  1MS6 A;  1PCI A;  2FT2 A;  4I04 A;  1PE6 A;  5CVM A;  1ZIV A;  4N8W A;  3BPM A;  3HD3 A;  2XU4 A;  1YAL A;  4X6J A;  2IBI A;  3H6S A;  3MHS A;  1EF7 A;  1AU2 A;  2AUX A;  3PBH A;  5EF4 A;  3HWN A;  3MTN A;  5CHV A;  4YV8 A;  3V6C A;  3HHA A;  2C0Y A;  5JH3 A;  2VHF A;  2DCB A;  2O6X A;  2R9N A;  1A6R A;  2Y6E A;  4QRG A;  4W5C A;  4PAD A;  4BSQ A;  3IMA A;  1EWL A;  2AIM A;  1ICF A;  4DMX A;  3IHP A;  1AYV A;  4FJC A;  2E01 A;  1VJV A;  1PPN A;  4P6E A;  1SP4 B;  1GCB A;  1MEG A;  3CBK A;  3WXE A;  3H8C A;  1O0E A;  2NQD B;  1MIR A;  5K16 A;  1F2B A;  3K24 A;  1PPO A;  1F2C A;  4W4U A;  1CTE A;  1ME3 A;  1X9Y A;  4K7C A;  4BS6 A;  3KWZ A;  2R9M A;  4YYR A;  1AYW A;  2NQI A;  1AYU A;  2H7J A;  3F5V A;  2DCA A;  3KSE A;  1BP4 A;  3O1G A;  4P6G A;  6PAD A;  4MZO A;  2DZY A;  1KHQ A;  1BQI A;  4AXL A;  3ERV A;  3USV A;  1YK8 A;  4MSX A;  2FUD A;  4YYS A;  1PPP A;  3WXG A;  2YJ9 A;  1CV8 A;  1GMY A;  2FYE A;  4OEM A;  8PCH A;  2G7Y A;  1Y4H A;  2HHN A;  2ATO A;  1F29 A;  1NPZ A;  3H89 A;  3KX1 A;  1QMY A;  2YJ2 A;  4N4Z A;  4Q8G A;  3I3T A;  3IOQ A;  2AVW A;  4BS5 A;  1TLO A;  4OEL A;  4XR7 A;  1CPJ A;  5CHT A;  3RVV A;  2AYO A;  2OP3 A;  4CDF B;  4X6H A;  3IUT A;  4CDE B;  1QOL A;  3PDF A;  1YT7 A;  1AIM A;  1Q6K A;  1FH0 A;  2P0R A;  4HWY A;  3C9E A;  2B1M A;  2R9O A;  3BOW A;  1YVB A;  3F75 A;  3ZUA A;  5JA7 A;  4BPV A;  3M99 A;  3N3G A;  3E1Z B;  2VHS A;  2R9F A;  7PCK A;  4FK5 A;  3MHH A;  1QXP A;  1MHW A;  4X6I A;  3H7D A;  3HHI A;  3S3Q A;  2DJG B;  4WA6 A;  3S3R A;  5PAD A;  2FRQ A;  3IV2 A;  5CVN B;  1KXR A;  2HXZ A;  1EWM A;  1M6D A;  5EGW A;  3OF9 A;  3TNX A;  3OVZ A;  3I06 A;  2BDL A;  3N4C A;  4CDD B;  5CVO B;  5A24 A;  4XUI A;  3KKU A;  2E03 A;  2XU5 A;  2YJ8 A;  1STF E;  2DC8 A;  1PAD A;  2P86 A;  1Y08 A;  2HD5 A;  2CB5 A;  4BQV A;  1AU0 A;  3QJ3 A;  4Q8H A;  1VSN A;  2XU3 A;  4YYQ A;  1ITO A;  2YJB A;  1POP A;  3CH2 X;  2DC6 A;  4YVA A;  3P5U A;  2AU1 A;  1KHP A;  3WXF A;  1KFX L;  1NB3 A;  4ZUX U;  1TL9 A;  1K3B B;  1CQD A;  2DZZ A;  3RVX A;  3OVX A;  2G6D A;  2JQG R;  2HH5 A;  2NQA A;  3N3K A;  4I07 A;  5FPW A;  3K8U A;  2G8E A;  3RVW A;  2ARY A;  2IPP B;  5J94 A;  1SNK A;  4YYV A;  3P5X A;  2BDZ A;  1QDQ A;  2E02 A;  3QT4 A;  1CB5 A;  3K9M A;  2DC9 A;  3KWB X;  2DCC A;  1BY8 A;  3BPF A;  1TU6 A;  3IEJ A;  2PAD A;  1MEM A;  2FO5 A;  4RY2 A;  3D6S A;  1KFU L;  3NHE A;  4MZS A;  3KW9 A;  4PP1 A;  2OZ2 A;  1ME4 A;  2AYN A;  2P7U A;  3LXS A;  4I05 A;  9PAP A;  2E00 A;  5F02 A;  1CVZ A;  2F1G A;  1BGO A;  3GCB A;  3QSD A;  1THE A;  3AI8 A;  1IWD A;  2CIO A;  3BCN A;  2PNS A;  1DEU A;  1AU3 A;  2GHU A;  2NQG A;  1AEC A;  3BC3 A;  2PRE A;  3MOR A;  1NLJ A;  1YK7 A;  2ACT A;  1AU4 A;  4QRX A;  3U8E A;  2XU1 A;  3O0U A;  2WBF X;  2YJC A;  3B79 A;  3H8B A;  3P5V A;  1U9X A;  3KFQ A;  1ZCM A;  3CH3 X;  4QRV A;  1HUC B;  1PPD A;  1F2A A;  2PBH A;  2R9C A;  4YYU A;  3OIS A;  1NQC A;  2FRA A;  3DF0 A;  4W5B A;  2JQF R;  2Y5B A;  2DJF B;  4KLB A;  1CS8 A;  4YYW A;  1EWP A;  2G8J A;  1EWO A;  2DC7 A;  3CBJ A;  2B1N A;  1NL6 A;  1PBH A;  4PP2 E;  4QBB A;  1ATK A;  1NB5 A;  1PIP A;  2FQ9 A;  1CJL A;  2F7D A;  3P5W A;  3BWK A;  2FTD A;  3PNR A;  4FIP A;  4N79 A;  4DMY A; 
#chains in the Genus database with same CATH topology
 1U5I A;  1JQP A;  3PRM A;  1U9V A;  1U9Q X;  1UKF A;  4PI3 A;  4AXM A;  2JTC A;  3C0R A;  2GFO A;  1CSB B;  1DF0 A;  3PSE A;  2AUZ A;  4D8B A;  4QH6 A;  1DKI A;  3OF8 A;  4REZ A;  3PW3 A;  1MDW A;  3MJ5 A;  2R6N A;  1S4V A;  2DCD A;  4G54 A;  3LFY A;  2AS8 A;  2OUL A;  3V6E A;  4CDC B;  1PXV A;  1XKG A;  3PT2 A;  4CZW A;  1U9W A;  1GLO A;  1GEC E;  1MS6 A;  1PCI A;  2FT2 A;  4I04 A;  1PE6 A;  5CVM A;  1ZIV A;  3B21 A;  4N8W A;  3BPM A;  3HD3 A;  2XU4 A;  1YAL A;  4X6J A;  2IBI A;  3H6S A;  3MHS A;  1EF7 A;  4OW0 A;  1AU2 A;  2AUX A;  3PBH A;  5EF4 A;  3HWN A;  3MTN A;  5CHV A;  4YV8 A;  3V6C A;  2DOS A;  3HHA A;  2C0Y A;  4D8I A;  2VHF A;  5JH3 A;  2DCB A;  2O6X A;  2R9N A;  1A6R A;  2Y6E A;  4QRG A;  4W5C A;  3W31 A;  4PAD A;  2FE8 A;  4BSQ A;  3IMA A;  1EWL A;  2AIM A;  1ICF A;  4DMX A;  3IHP A;  1AYV A;  4FJC A;  2E01 A;  1VJV A;  1PPN A;  4P6E A;  1SP4 B;  1GCB A;  1MEG A;  3CBK A;  3WXE A;  4RNA A;  3H8C A;  1O0E A;  2NQD B;  1MIR A;  5K16 A;  1F2B A;  3K24 A;  1PPO A;  3BBA A;  1F2C A;  4W4U A;  1CTE A;  1ME3 A;  3TMP A;  1X9Y A;  4K7C A;  4BS6 A;  3KWZ A;  2R9M A;  4YYR A;  1AYW A;  2NQI A;  1AYU A;  4RF1 A;  2H7J A;  3F5V A;  4BOP A;  2DCA A;  3PHU A;  3KSE A;  4MI7 A;  1BP4 A;  1YZB A;  3O1G A;  4P6G A;  6PAD A;  4MZO A;  2DZY A;  1KHQ A;  1BQI A;  4AXL A;  3ERV A;  3USV A;  1YK8 A;  4MSX A;  2FUD A;  4YYS A;  1PPP A;  4OVZ A;  3WXG A;  2YJ9 A;  1CV8 A;  1GMY A;  2FYE A;  4OEM A;  8PCH A;  2G7Y A;  1Y4H A;  2HHN A;  2ATO A;  1F29 A;  4R3D A;  1NPZ A;  3H89 A;  3KX1 A;  1QMY A;  2YJ2 A;  4N4Z A;  4Q8G A;  3ZNH A;  3I3T A;  3IOQ A;  2AVW A;  4BS5 A;  1TLO A;  4OEL A;  4XR7 A;  1CPJ A;  5CHT A;  3BY4 A;  3W30 A;  3RVV A;  2AYO A;  2OP3 A;  4CDF B;  4X6H A;  3IUT A;  4CDE B;  1QOL A;  3PDF A;  1YT7 A;  1AIM A;  1Q6K A;  1FH0 A;  2P0R A;  4HWY A;  3C9E A;  2B1M A;  2BTW B;  2R9O A;  3BB7 A;  3BOW A;  1YVB A;  3MTV A;  3F75 A;  2UZJ A;  3ZUA A;  5JA7 A;  4BPV A;  3M99 A;  3N3G A;  3E1Z B;  2VHS A;  2R9F A;  7PCK A;  4FK5 A;  3MHH A;  1QXP A;  1MHW A;  5KO3 A;  4X6I A;  3H7D A;  3HHI A;  3S3Q A;  2DJG B;  4WA6 A;  4GUA A;  3S3R A;  2JRI A;  5PAD A;  2FRQ A;  3IV2 A;  5CVN B;  5EZS A;  1KXR A;  2HXZ A;  1EWM A;  1M6D A;  5EGW A;  3OF9 A;  3TNX A;  3OVZ A;  3I06 A;  2BDL A;  3N4C A;  4CDD B;  4RKX A;  5CVO B;  5A24 A;  4D8E A;  4XUI A;  3KKU A;  2E03 A;  2XU5 A;  2YJ8 A;  1STF E;  4BOZ A;  2DC8 A;  1PAD A;  2P86 A;  1Y08 A;  2HD5 A;  2CB5 A;  4BQV A;  3RNV A;  1AU0 A;  3QJ3 A;  4Q8H A;  1VSN A;  2XU3 A;  4YYQ A;  1ITO A;  2YJB A;  1POP A;  4XZX A;  3CH2 X;  2DC6 A;  4YVA A;  3P5U A;  2AU1 A;  1KHP A;  3WXF A;  1KFX L;  1NB3 A;  4ZUX U;  4P16 A;  1TL9 A;  1K3B B;  1CQD A;  2DZZ A;  3RVX A;  3OVX A;  2AGA A;  2G6D A;  2HWK A;  2JQG R;  2HH5 A;  2NQA A;  3N3K A;  2Z84 A;  4I07 A;  1PVJ A;  4A5U A;  3OQC A;  5FPW A;  3K8U A;  4BOU A;  2G8E A;  3RVW A;  3O65 A;  2ARY A;  2IPP B;  5J94 A;  1SNK A;  4YYV A;  3P5X A;  3MP2 A;  3PHX A;  2BDZ A;  4ZTB A;  1QDQ A;  2E02 A;  3QT4 A;  4HXD B;  1CB5 A;  4BOS A;  3K9M A;  4MM3 B;  4M0W A;  2DC9 A;  3KWB X;  2DCC A;  1BY8 A;  3BPF A;  3PRP A;  1TU6 A;  3IEJ A;  2PAD A;  1MEM A;  2FO5 A;  4RY2 A;  3D6S A;  1KFU L;  3NHE A;  4MZS A;  3KW9 A;  4IUM A;  4PP1 A;  2OZ2 A;  1ME4 A;  2AYN A;  4IP3 A;  2P7U A;  3LXS A;  2BU3 A;  4I05 A;  9PAP A;  2E00 A;  5F02 A;  1CVZ A;  2F1G A;  1BGO A;  3GCB A;  3QSD A;  5E6J A;  1THE A;  3AI8 A;  3TRK A;  5EZQ A;  1IWD A;  3IFU A;  2CIO A;  3BCN A;  2PNS A;  4OVZ B;  5JZE A;  1DEU A;  1AU3 A;  2GHU A;  2NQG A;  1AEC A;  3BC3 A;  4BOQ A;  2PRE A;  4WUR A;  3MOR A;  1NLJ A;  1YK7 A;  2ACT A;  1AU4 A;  4QRX A;  3U8E A;  2XU1 A;  3O0U A;  2WBF X;  2YJC A;  3B79 A;  3H8B A;  3P5V A;  3E9S A;  1U9X A;  3KFQ A;  1ZCM A;  3CH3 X;  4QRV A;  1HUC B;  1PPD A;  4PT5 A;  1F2A A;  2PBH A;  2R9C A;  2BTW A;  2J7Q C;  4YYU A;  3OIS A;  1NQC A;  2FRA A;  3DF0 A;  4W5B A;  2JQF R;  2Y5B A;  2DJF B;  4KLB A;  3PHW A;  1CS8 A;  4YYW A;  1EWP A;  2J7Q A;  2G8J A;  1EWO A;  2DC7 A;  3CBJ A;  4RF0 A;  2B1N A;  1NL6 A;  1PBH A;  4PP2 E;  4QBB A;  1ATK A;  1NB5 A;  1PIP A;  2FQ9 A;  1CJL A;  2F7D A;  3P5W A;  3BWK A;  2FTD A;  3PNR A;  4FIP A;  4N79 A;  4DMY A; 
#chains in the Genus database with same CATH homology
 1U5I A;  1JQP A;  1U9V A;  1U9Q X;  4PI3 A;  4AXM A;  2GFO A;  1CSB B;  1DF0 A;  2AUZ A;  4QH6 A;  3OF8 A;  3PW3 A;  1MDW A;  2R6N A;  1S4V A;  2DCD A;  4G54 A;  3LFY A;  2AS8 A;  2OUL A;  3V6E A;  4CDC B;  1PXV A;  1XKG A;  4CZW A;  1GX3 A;  1U9W A;  1GLO A;  1GEC E;  1MS6 A;  1PCI A;  2FT2 A;  4I04 A;  1PE6 A;  5CVM A;  1ZIV A;  4N8W A;  3BPM A;  3HD3 A;  2XU4 A;  1YAL A;  4X6J A;  2IBI A;  3H6S A;  3MHS A;  1EF7 A;  1AU2 A;  2AUX A;  3PBH A;  5EF4 A;  3HWN A;  3MTN A;  5CHV A;  4YV8 A;  3V6C A;  3HHA A;  2C0Y A;  5JH3 A;  2VHF A;  2DCB A;  2O6X A;  2R9N A;  1A6R A;  2Y6E A;  4QRG A;  4W5C A;  4PAD A;  2VFC A;  4BSQ A;  3IMA A;  1EWL A;  2AIM A;  1ICF A;  4DMX A;  1W5R A;  3IHP A;  1AYV A;  4FJC A;  2E01 A;  1VJV A;  1PPN A;  4P6E A;  1SP4 B;  1GCB A;  1MEG A;  3CBK A;  3WXE A;  3H8C A;  1O0E A;  2NQD B;  1MIR A;  5K16 A;  1F2B A;  3K24 A;  1PPO A;  1F2C A;  4W4U A;  1CTE A;  1ME3 A;  1X9Y A;  4K7C A;  4BS6 A;  1W4T A;  2R9M A;  3KWZ A;  4YYR A;  1AYW A;  2NQI A;  1AYU A;  2H7J A;  3F5V A;  2DCA A;  3KSE A;  1BP4 A;  3O1G A;  4P6G A;  6PAD A;  4MZO A;  2DZY A;  1KHQ A;  1BQI A;  4AXL A;  3ERV A;  3USV A;  1YK8 A;  4MSX A;  2FUD A;  4YYS A;  1PPP A;  3WXG A;  2YJ9 A;  1CV8 A;  1GMY A;  2FYE A;  4OEM A;  8PCH A;  2G7Y A;  1Y4H A;  2HHN A;  2ATO A;  1F29 A;  4C5P A;  1NPZ A;  3H89 A;  3KX1 A;  1QMY A;  2YJ2 A;  4N4Z A;  4Q8G A;  3I3T A;  3IOQ A;  2AVW A;  4BS5 A;  1TLO A;  4OEL A;  4XR7 A;  1CPJ A;  5CHT A;  3RVV A;  2AYO A;  2OP3 A;  4CDF B;  4X6H A;  3IUT A;  4CDE B;  1QOL A;  3PDF A;  1YT7 A;  1AIM A;  1Q6K A;  1FH0 A;  2P0R A;  4HWY A;  3C9E A;  2B1M A;  2R9O A;  3BOW A;  1YVB A;  3F75 A;  3ZUA A;  5JA7 A;  4BPV A;  3M99 A;  3N3G A;  3E1Z B;  2VHS A;  2R9F A;  7PCK A;  4FK5 A;  4NV7 A;  3MHH A;  1QXP A;  1MHW A;  4X6I A;  3H7D A;  3HHI A;  3S3Q A;  2DJG B;  4WA6 A;  3S3R A;  2BSZ A;  5PAD A;  2FRQ A;  3IV2 A;  5CVN B;  1KXR A;  2HXZ A;  1EWM A;  1M6D A;  5EGW A;  3OF9 A;  3TNX A;  3OVZ A;  3I06 A;  4GUZ A;  2BDL A;  3N4C A;  4CDD B;  5CVO B;  1W6F A;  5A24 A;  4XUI A;  3KKU A;  2E03 A;  3D9W A;  2XU5 A;  2YJ8 A;  1STF E;  2DC8 A;  1PAD A;  2P86 A;  1Y08 A;  2HD5 A;  2CB5 A;  4BQV A;  1AU0 A;  2VFB A;  3QJ3 A;  4Q8H A;  1VSN A;  2XU3 A;  4YYQ A;  1ITO A;  2YJB A;  1POP A;  4BGF A;  3CH2 X;  2DC6 A;  4YVA A;  3P5U A;  2AU1 A;  1KHP A;  3WXF A;  1KFX L;  1NB3 A;  4NV8 A;  4ZUX U;  1TL9 A;  1K3B B;  1CQD A;  2DZZ A;  3RVX A;  3OVX A;  2G6D A;  2JQG R;  2HH5 A;  2NQA A;  3N3K A;  4I07 A;  3LTW A;  5FPW A;  3K8U A;  2G8E A;  3RVW A;  2ARY A;  2IPP B;  5J94 A;  1E2T A;  1SNK A;  4YYV A;  3P5X A;  2BDZ A;  1QDQ A;  2E02 A;  3QT4 A;  1CB5 A;  3K9M A;  2DC9 A;  3KWB X;  2DCC A;  1BY8 A;  3BPF A;  1TU6 A;  3IEJ A;  2PAD A;  1MEM A;  2FO5 A;  4RY2 A;  3D6S A;  1KFU L;  3NHE A;  4MZS A;  3KW9 A;  4PP1 A;  2OZ2 A;  1ME4 A;  2AYN A;  2P7U A;  3LXS A;  4I05 A;  9PAP A;  2E00 A;  5F02 A;  1CVZ A;  2F1G A;  1BGO A;  3GCB A;  3QSD A;  1THE A;  3AI8 A;  1IWD A;  2CIO A;  3BCN A;  2PNS A;  1DEU A;  1AU3 A;  2GHU A;  2NQG A;  1AEC A;  3BC3 A;  2PRE A;  3MOR A;  1NLJ A;  1YK7 A;  2ACT A;  1AU4 A;  4QRX A;  3U8E A;  2XU1 A;  3O0U A;  2WBF X;  2YJC A;  3B79 A;  3H8B A;  3P5V A;  1U9X A;  3KFQ A;  1ZCM A;  3CH3 X;  4QRV A;  1HUC B;  1PPD A;  1F2A A;  2PBH A;  2R9C A;  4YYU A;  4B55 A;  3OIS A;  1NQC A;  2FRA A;  3DF0 A;  4W5B A;  2JQF R;  2Y5B A;  2DJF B;  4KLB A;  1CS8 A;  4YYW A;  1EWP A;  2G8J A;  1EWO A;  2DC7 A;  3CBJ A;  2B1N A;  1NL6 A;  1PBH A;  4PP2 E;  4QBB A;  1ATK A;  1NB5 A;  1PIP A;  2FQ9 A;  1CJL A;  2F7D A;  3P5W A;  3BWK A;  2FTD A;  3PNR A;  4FIP A;  4N79 A;  4DMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...