1CTEA

Crystal structures of recombinant rat cathepsin b and a cathepsin b-inhibitor complex: implications for structure-based inhibitor design
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
253
structure length
253
Chain Sequence
LPESFDAREQWSNCPTIAQIRDQGSCGSCWAFGAVEAMSDRICIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWNFWTRKGLVSGGVYNSHIGCLPYTIPPCEHHVNGARPPCTGEGDTPKCNKMCEAGYSTSYKEDKHYGYTSYSVSDSEKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDVMGGHAIRILGWGIENGVPYWLVANSWNADWGDNGFFKILRGENHCGIESEIVAGIPRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of recombinant rat cathepsin B and a cathepsin B-inhibitor complex. Implications for structure-based inhibitor design.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Thiol protease
molecule keywords CATHEPSIN B
total genus 69
structure length 253
sequence length 253
chains with identical sequence B
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 1995-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1cteA00
2XU5A 1QXPA 2HD5A 4QRXA 5A24A 8PCHA 4PP1A 4Q8GA 1EWMA 4MSXA 4CZWA 1Q6KA 2FRQA 4QBBA 2Y6EA 2FQ9A 3BC3A 2NQGA 2DCCA 3MTNA 4N4ZA 2AVWA 2H7JA 3S3QA 1MIRA 3USVA 3PW3A 3HD3A 2DC9A 2NQDB 5EGWA 2YJBA 4W4UA 5JA7A 3F75A 2FUDA 3H7DA 3KW9A 2GHUA 3E1ZB 4P6GA 2XU4A 3N3KA 4FIPA 1MHWA 1AYUA 4YVAA 3GCBA 3MORA 3PNRA 2FTDA 2NQIA 1CV8A 2FRAA 2DCDA 2AIMA 2B1NA 1ZIVA 4CDEB 2DCBA 1YK8A 3IOQA 3OF8A 1PXVA 1SNKA 1F29A 1AYWA 3P5XA 3BCNA 2DZYA 1TLOA 4K7CA 2PREA 2NQAA 3I06A 3P5WA 2ARYA 2OP3A 2E00A 5CVOB 1AYVA 2E02A 1PE6A 4BS5A 1GLOA 1U9XA 4HWYA 2BDLA 3KSEA 3S3RA 1F2CA 1BGOA 3IV2A 2YJ8A 2DC8A 2CIOA 3B79A 1S4VA 4X6JA 3HHIA 2DC6A 2G8JA 3BOWA 1PPPA 1KFXL 3OF9A 2YJ2A 3V6CA 1KHQA 3V6EA 2GFOA 1U9QX 3WXEA 1BY8A 3K9MA 5FPWA 4QRVA 3IMAA 2YJ9A 4BPVA 1VSNA 1AIMA 3MHHA 3ZUAA 3O0UA 4YYRA 1ME4A 1ITOA 3AI8A 4CDDB 2XU1A 4YYSA 4YYWA 2FYEA 3HHAA 3KWZA 3IUTA 1CQDA 2G6DA 6PADA 3H8CA 3KWBX 1PPDA 3QT4A 3ERVA 1HUCB 4G54A 1NB3A 1MEMA 1PADA 1EWOA 7PCKA 2AUZA 4AXLA 1SP4B 3HWNA 3N4CA 3CBKA 2AS8A 2OULA 2P7UA 2F1GA 1FH0A 2F7DA 2O6XA 5EF4A 3I3TA 1TU6A 3WXGA 3P5UA 1F2AA 4DMYA 1Y4HA 4PADA 2R9CA 4BS6A 4YV8A 5CHVA 2ACTA 1AU3A 2PNSA 2XU3A 2C0YA 1CPJA 1KXRA 1GMYA 1CSBB 2ATOA 4QRGA 2IPPB 2OZ2A 1QOLA 4X6IA 4FK5A 1PCIA 4X6HA 2DJGB 1ME3A 3QSDA 1STFE 3C9EA 5JH3A 3NHEA 2P0RA 4P6EA 4BSQA 1CB5A 4KLBA 3OVZA 3CH2X 4I05A 4I07A 5K16A 2Y5BA 3CH3X 3M99A 1QMYA 1O0EA 1EWPA 1Y08A 2R6NA 4I04A 3PBHA 5F02A 2HXZA 2PADA 4N8WA 4AXMA 3O1GA 1BQIA 2R9MA 2WBFX 1POPA 4FJCA 3P5VA 4W5CA 1NPZA 1NL6A 1CVZA 1THEA 3RVVA 5PADA 1GCBA 1M6DA 3LFYA 3OISA 1PBHA 1BP4A 2AUXA 1VJVA 4XR7A 1GECE 1CS8A 2DC7A 2R9NA 2VHFA 4YYVA 9PAPA 4QH6A 4BQVA 1CTEA 2R9FA 2E01A 2P86A 4XUIA 1AU2A 1QDQA 3H89A 4N79A 3H8BA 2VHSA 1YT7A 3RVXA 2JQGR 2YJCA 1ZCMA 1CJLA 1TL9A 1MS6A 2FT2A 4CDFB 1KFUL 1DEUA 1XKGA 3H6SA 5J94A 4Q8HA 4DMXA 3K24A 4PI3A 4WA6A 4OEMA 3BWKA 3MHSA 1AECA 1JQPA 5CVMA 3BPFA 3DF0A 1A6RA 3IHPA 1NB5A 3BPMA 4CDCB 1NLJA 3U8EA 1PIPA 1U9VA 3IEJA 2DZZA 3K8UA 1ICFA 3N3GA 5CHTA 3TNXA 3KFQA 1PPOA 2JQFR 1YVBA 2BDZA 2HH5A 2AU1A 3PDFA 1EF7A 1KHPA 3KX1A 3OVXA 5CVNB 3D6SA 1MEGA 1DF0A 4W5BA 1YALA 4ZUXU 3F5VA 4OELA 1EWLA 1U5IA 2HHNA 3WXFA 4YYUA 2FO5A 2G8EA 4PP2E 3CBJA 1YK7A 4MZOA 2R9OA 2E03A 1AU4A 3KKUA 3RVWA 1K3BB 1X9YA 1F2BA 3LXSA 2G7YA 4YYQA 2B1MA 3QJ3A 2AYOA 1AU0A 4MZSA 1IWDA 2DCAA 2DJFB 1MDWA 4RY2A 1NQCA 2IBIA 1ATKA 2AYNA 2PBHA 1PPNA 2CB5A 1U9WA
chains in the Genus database with same CATH superfamily
2XU5A 1QXPA 2HD5A 4QRXA 5A24A 8PCHA 4PP1A 2HWKA 4Q8GA 1EWMA 4MSXA 4CZWA 1Q6KA 2FRQA 4QBBA 4D8EA 2Y6EA 2FQ9A 3BC3A 2NQGA 2DCCA 3MTNA 4N4ZA 2AVWA 2H7JA 3S3QA 1MIRA 3USVA 3PW3A 3PHWA 3TMPA 3HD3A 2DC9A 2NQDB 5EGWA 2YJBA 4W4UA 5JA7A 2JRIA 3F75A 2FUDA 3BY4A 3W30A 3H7DA 3KW9A 2GHUA 3E1ZB 4P6GA 4OVZB 2XU4A 3N3KA 4FIPA 1MHWA 4RF1A 4PT5A 1AYUA 4YVAA 3GCBA 3MORA 3PNRA 2FTDA 2NQIA 4GUAA 1CV8A 2FRAA 2DCDA 2AIMA 2B1NA 1ZIVA 4CDEB 2DCBA 1YK8A 3IOQA 3OF8A 1PXVA 1SNKA 1F29A 1AYWA 4OVZA 3P5XA 3BCNA 2DZYA 1TLOA 4K7CA 2PREA 2NQAA 5KO3A 3I06A 3P5WA 2ARYA 2OP3A 2E00A 3PT2A 5CVOB 1AYVA 3MP2A 2E02A 1PE6A 4BS5A 1GLOA 1U9XA 2BU3A 2JTCA 4BOQA 4HWYA 2BDLA 3KSEA 3S3RA 1F2CA 1BGOA 3IV2A 2YJ8A 2DC8A 2CIOA 3B79A 1S4VA 1YZBA 4X6JA 3HHIA 2DC6A 2G8JA 3BOWA 1PPPA 1KFXL 3OF9A 2YJ2A 3V6CA 1KHQA 3V6EA 2GFOA 1U9QX 3WXEA 1BY8A 3C0RA 4REZA 3K9MA 5FPWA 4QRVA 3TRKA 3IMAA 2YJ9A 4BPVA 4RKXA 1VSNA 1AIMA 3MHHA 3ZUAA 3O0UA 4YYRA 4HXDB 1ME4A 4MI7A 1ITOA 3AI8A 4CDDB 2BTWA 2XU1A 4YYSA 4YYWA 2FYEA 3HHAA 3KWZA 3IUTA 2Z84A 1CQDA 2G6DA 6PADA 2J7QA 3H8CA 3KWBX 1PPDA 5EZQA 3QT4A 3ERVA 1HUCB 4G54A 1NB3A 4BOZA 3IFUA 1MEMA 3B21A 1PADA 1EWOA 7PCKA 2AUZA 4AXLA 1SP4B 3HWNA 3N4CA 3CBKA 2AS8A 2OULA 2P7UA 2F1GA 1FH0A 2F7DA 2O6XA 5EF4A 3I3TA 1TU6A 3WXGA 3BBAA 3P5UA 4OW0A 1F2AA 4BOUA 4DMYA 1Y4HA 4PADA 4R3DA 2R9CA 5EZSA 4BS6A 4MM3B 4YV8A 5CHVA 2ACTA 1AU3A 2PNSA 2XU3A 2C0YA 1CPJA 3RNVA 1KXRA 1GMYA 1CSBB 2ATOA 4QRGA 2IPPB 2OZ2A 1QOLA 4X6IA 4FK5A 2J7QC 4D8IA 1PCIA 4X6HA 2DJGB 1ME3A 3QSDA 1STFE 3C9EA 5JH3A 3NHEA 4M0WA 2P0RA 4P6EA 4BSQA 1CB5A 4KLBA 3OVZA 3CH2X 4I05A 4I07A 5K16A 1DKIA 2Y5BA 3CH3X 3M99A 1QMYA 1O0EA 1EWPA 3BB7A 1Y08A 2FE8A 2R6NA 4I04A 3PBHA 5F02A 2HXZA 2PADA 2BTWB 4N8WA 4AXMA 3O1GA 1BQIA 2R9MA 2WBFX 1POPA 3MJ5A 4FJCA 3P5VA 4W5CA 1NPZA 1NL6A 1CVZA 3PSEA 5E6JA 1THEA 3RVVA 5PADA 1GCBA 1M6DA 4P16A 3LFYA 3OISA 3E9SA 1PBHA 1BP4A 2AUXA 1VJVA 4XR7A 1GECE 1CS8A 2DC7A 2R9NA 2VHFA 4D8BA 4YYVA 9PAPA 4QH6A 3ZNHA 4BQVA 1CTEA 2R9FA 4ZTBA 2E01A 2P86A 4WURA 1UKFA 4XUIA 3MTVA 1AU2A 1QDQA 3H89A 4N79A 3H8BA 3W31A 2VHSA 2UZJA 1YT7A 3RVXA 2JQGR 2YJCA 1ZCMA 1CJLA 1TL9A 1MS6A 2FT2A 4CDFB 1KFUL 1DEUA 1XKGA 3H6SA 5J94A 4Q8HA 4DMXA 3K24A 4A5UA 4PI3A 4WA6A 1PVJA 4OEMA 3BWKA 4RNAA 5JZEA 3MHSA 1AECA 1JQPA 5CVMA 3BPFA 3O65A 3DF0A 1A6RA 3IHPA 1NB5A 3BPMA 4CDCB 1NLJA 3U8EA 1PIPA 1U9VA 3PHUA 3IEJA 4RF0A 2DZZA 3K8UA 2DOSA 1ICFA 3OQCA 3N3GA 5CHTA 3TNXA 3PHXA 3KFQA 1PPOA 2JQFR 1YVBA 2BDZA 2HH5A 4IP3A 2AU1A 3PDFA 1EF7A 4XZXA 1KHPA 3KX1A 3OVXA 5CVNB 3D6SA 1MEGA 1DF0A 4W5BA 1YALA 4ZUXU 3F5VA 4OELA 1EWLA 1U5IA 2HHNA 3WXFA 4YYUA 3PRPA 2FO5A 2G8EA 4PP2E 3CBJA 1YK7A 4MZOA 2R9OA 2AGAA 2E03A 1AU4A 3KKUA 3RVWA 1K3BB 1X9YA 1F2BA 4BOSA 3LXSA 2G7YA 4YYQA 2B1MA 3QJ3A 2AYOA 1AU0A 4MZSA 1IWDA 2DCAA 2DJFB 3PRMA 1MDWA 4RY2A 1NQCA 4BOPA 2IBIA 1ATKA 2AYNA 2PBHA 1PPNA 2CB5A 1U9WA 4IUMA
chains in the Genus database with same CATH topology
2XU5A 1QXPA 2HD5A 4QRXA 5A24A 8PCHA 4PP1A 4Q8GA 1EWMA 4MSXA 4CZWA 1Q6KA 2FRQA 4QBBA 2Y6EA 2FQ9A 3BC3A 2NQGA 2DCCA 3MTNA 4N4ZA 2AVWA 2H7JA 3S3QA 1MIRA 3USVA 3PW3A 3HD3A 2VFCA 2DC9A 2NQDB 5EGWA 2YJBA 4W4UA 5JA7A 3F75A 2FUDA 3H7DA 3KW9A 2GHUA 3E1ZB 4P6GA 2XU4A 3N3KA 4FIPA 1MHWA 1AYUA 4YVAA 3GCBA 3MORA 3PNRA 2FTDA 2NQIA 1W4TA 1CV8A 2FRAA 2DCDA 4B55A 2AIMA 2B1NA 1ZIVA 4CDEB 2DCBA 1YK8A 3IOQA 3OF8A 1PXVA 1SNKA 1F29A 1AYWA 3P5XA 3BCNA 2DZYA 1TLOA 4K7CA 2PREA 2NQAA 3I06A 3P5WA 2ARYA 2OP3A 2E00A 5CVOB 1AYVA 2E02A 1PE6A 4BS5A 1GLOA 1W6FA 1U9XA 4HWYA 2BDLA 3KSEA 3S3RA 1F2CA 1BGOA 4BGFA 3IV2A 2YJ8A 2DC8A 2CIOA 3B79A 1S4VA 4X6JA 3HHIA 2DC6A 2G8JA 3BOWA 1PPPA 1KFXL 3OF9A 2YJ2A 3V6CA 1KHQA 3V6EA 2GFOA 1U9QX 3WXEA 1BY8A 3K9MA 5FPWA 4QRVA 3IMAA 2YJ9A 4BPVA 1VSNA 1AIMA 3MHHA 4C5PA 3ZUAA 3O0UA 4YYRA 1ME4A 1ITOA 3AI8A 4CDDB 2XU1A 4YYSA 4YYWA 2FYEA 3HHAA 3KWZA 3IUTA 1CQDA 2G6DA 6PADA 3H8CA 3KWBX 1PPDA 3QT4A 3ERVA 1HUCB 4G54A 1NB3A 1MEMA 1PADA 1EWOA 7PCKA 2AUZA 4AXLA 1SP4B 3HWNA 3N4CA 3CBKA 2AS8A 2OULA 2P7UA 2F1GA 1FH0A 2F7DA 2O6XA 5EF4A 3I3TA 1TU6A 3WXGA 3P5UA 1F2AA 4DMYA 1Y4HA 4PADA 2R9CA 4BS6A 4YV8A 5CHVA 2ACTA 1AU3A 2PNSA 2XU3A 2C0YA 1CPJA 1KXRA 1GMYA 1CSBB 2ATOA 4QRGA 2IPPB 2OZ2A 1QOLA 4X6IA 4FK5A 1PCIA 2BSZA 4X6HA 2DJGB 1ME3A 3QSDA 1STFE 3C9EA 5JH3A 3NHEA 2P0RA 4P6EA 4BSQA 1CB5A 4KLBA 3OVZA 3CH2X 4I05A 3D9WA 4I07A 5K16A 2Y5BA 3CH3X 3M99A 1QMYA 1O0EA 1EWPA 4NV8A 1Y08A 2R6NA 4I04A 3PBHA 5F02A 2HXZA 2PADA 4N8WA 4AXMA 3O1GA 4GUZA 1BQIA 2R9MA 2WBFX 1POPA 4FJCA 3P5VA 4W5CA 1NPZA 1NL6A 1CVZA 1E2TA 1THEA 3RVVA 5PADA 1GCBA 1M6DA 3LFYA 3OISA 1PBHA 1BP4A 2AUXA 1VJVA 4XR7A 1GECE 1CS8A 2DC7A 2R9NA 2VHFA 4YYVA 9PAPA 4QH6A 4BQVA 1CTEA 2R9FA 2E01A 2P86A 4XUIA 1AU2A 1QDQA 3H89A 4N79A 3H8BA 2VHSA 1YT7A 3RVXA 2JQGR 2YJCA 1ZCMA 1CJLA 1TL9A 1MS6A 2FT2A 4CDFB 1KFUL 1DEUA 1XKGA 3H6SA 5J94A 4Q8HA 4DMXA 3K24A 4PI3A 4WA6A 4OEMA 3BWKA 3MHSA 1AECA 1JQPA 5CVMA 3BPFA 3DF0A 1A6RA 3IHPA 1NB5A 3BPMA 4CDCB 1NLJA 3U8EA 1PIPA 1U9VA 3IEJA 2DZZA 3K8UA 1ICFA 3N3GA 5CHTA 3TNXA 3KFQA 1PPOA 2JQFR 1YVBA 2BDZA 2HH5A 2AU1A 3PDFA 1EF7A 1KHPA 3KX1A 3OVXA 5CVNB 3D6SA 3LTWA 1MEGA 1DF0A 4W5BA 1YALA 4ZUXU 3F5VA 4OELA 1EWLA 1U5IA 2HHNA 4NV7A 3WXFA 4YYUA 2FO5A 2G8EA 4PP2E 3CBJA 1YK7A 4MZOA 2R9OA 2E03A 1AU4A 3KKUA 3RVWA 1K3BB 1X9YA 1F2BA 1W5RA 3LXSA 2G7YA 4YYQA 2B1MA 2VFBA 3QJ3A 2AYOA 1AU0A 4MZSA 1IWDA 2DCAA 2DJFB 1MDWA 1GX3A 4RY2A 1NQCA 2IBIA 1ATKA 2AYNA 2PBHA 1PPNA 2CB5A 1U9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XU5 A;  1QXP A;  2HD5 A;  4QRX A;  5A24 A;  8PCH A;  4PP1 A;  4Q8G A;  1EWM A;  4MSX A;  4CZW A;  1Q6K A;  2FRQ A;  4QBB A;  2Y6E A;  2FQ9 A;  3BC3 A;  2NQG A;  2DCC A;  3MTN A;  4N4Z A;  2AVW A;  2H7J A;  3S3Q A;  1MIR A;  3USV A;  3PW3 A;  3HD3 A;  2DC9 A;  2NQD B;  5EGW A;  2YJB A;  4W4U A;  5JA7 A;  3F75 A;  2FUD A;  3H7D A;  3KW9 A;  2GHU A;  3E1Z B;  4P6G A;  2XU4 A;  3N3K A;  4FIP A;  1MHW A;  1AYU A;  4YVA A;  3GCB A;  3MOR A;  3PNR A;  2FTD A;  2NQI A;  1CV8 A;  2FRA A;  2DCD A;  2AIM A;  2B1N A;  1ZIV A;  4CDE B;  2DCB A;  1YK8 A;  3IOQ A;  3OF8 A;  1PXV A;  1SNK A;  1F29 A;  1AYW A;  3P5X A;  3BCN A;  2DZY A;  1TLO A;  4K7C A;  2PRE A;  2NQA A;  3I06 A;  3P5W A;  2ARY A;  2OP3 A;  2E00 A;  5CVO B;  1AYV A;  2E02 A;  1PE6 A;  4BS5 A;  1GLO A;  1U9X A;  4HWY A;  2BDL A;  3KSE A;  3S3R A;  1F2C A;  1BGO A;  3IV2 A;  2YJ8 A;  2DC8 A;  2CIO A;  3B79 A;  1S4V A;  4X6J A;  3HHI A;  2DC6 A;  2G8J A;  3BOW A;  1PPP A;  1KFX L;  3OF9 A;  2YJ2 A;  3V6C A;  1KHQ A;  3V6E A;  2GFO A;  1U9Q X;  3WXE A;  1BY8 A;  3K9M A;  5FPW A;  4QRV A;  3IMA A;  2YJ9 A;  4BPV A;  1VSN A;  1AIM A;  3MHH A;  3ZUA A;  3O0U A;  4YYR A;  1ME4 A;  1ITO A;  3AI8 A;  4CDD B;  2XU1 A;  4YYS A;  4YYW A;  2FYE A;  3HHA A;  3KWZ A;  3IUT A;  1CQD A;  2G6D A;  6PAD A;  3H8C A;  3KWB X;  1PPD A;  3QT4 A;  3ERV A;  1HUC B;  4G54 A;  1NB3 A;  1MEM A;  1PAD A;  1EWO A;  7PCK A;  2AUZ A;  4AXL A;  1SP4 B;  3HWN A;  3N4C A;  3CBK A;  2AS8 A;  2OUL A;  2P7U A;  2F1G A;  1FH0 A;  2F7D A;  2O6X A;  5EF4 A;  3I3T A;  1TU6 A;  3WXG A;  3P5U A;  1F2A A;  4DMY A;  1Y4H A;  4PAD A;  2R9C A;  4BS6 A;  4YV8 A;  5CHV A;  2ACT A;  1AU3 A;  2PNS A;  2XU3 A;  2C0Y A;  1CPJ A;  1KXR A;  1GMY A;  1CSB B;  2ATO A;  4QRG A;  2IPP B;  2OZ2 A;  1QOL A;  4X6I A;  4FK5 A;  1PCI A;  4X6H A;  2DJG B;  1ME3 A;  3QSD A;  1STF E;  3C9E A;  5JH3 A;  3NHE A;  2P0R A;  4P6E A;  4BSQ A;  1CB5 A;  4KLB A;  3OVZ A;  3CH2 X;  4I05 A;  4I07 A;  5K16 A;  2Y5B A;  3CH3 X;  3M99 A;  1QMY A;  1O0E A;  1EWP A;  1Y08 A;  2R6N A;  4I04 A;  3PBH A;  5F02 A;  2HXZ A;  2PAD A;  4N8W A;  4AXM A;  3O1G A;  1BQI A;  2R9M A;  2WBF X;  1POP A;  4FJC A;  3P5V A;  4W5C A;  1NPZ A;  1NL6 A;  1CVZ A;  1THE A;  3RVV A;  5PAD A;  1GCB A;  1M6D A;  3LFY A;  3OIS A;  1PBH A;  1BP4 A;  2AUX A;  1VJV A;  4XR7 A;  1GEC E;  1CS8 A;  2DC7 A;  2R9N A;  2VHF A;  4YYV A;  9PAP A;  4QH6 A;  4BQV A;  1CTE A;  2R9F A;  2E01 A;  2P86 A;  4XUI A;  1AU2 A;  1QDQ A;  3H89 A;  4N79 A;  3H8B A;  2VHS A;  1YT7 A;  3RVX A;  2JQG R;  2YJC A;  1ZCM A;  1CJL A;  1TL9 A;  1MS6 A;  2FT2 A;  4CDF B;  1KFU L;  1DEU A;  1XKG A;  3H6S A;  5J94 A;  4Q8H A;  4DMX A;  3K24 A;  4PI3 A;  4WA6 A;  4OEM A;  3BWK A;  3MHS A;  1AEC A;  1JQP A;  5CVM A;  3BPF A;  3DF0 A;  1A6R A;  3IHP A;  1NB5 A;  3BPM A;  4CDC B;  1NLJ A;  3U8E A;  1PIP A;  1U9V A;  3IEJ A;  2DZZ A;  3K8U A;  1ICF A;  3N3G A;  5CHT A;  3TNX A;  3KFQ A;  1PPO A;  2JQF R;  1YVB A;  2BDZ A;  2HH5 A;  2AU1 A;  3PDF A;  1EF7 A;  1KHP A;  3KX1 A;  3OVX A;  5CVN B;  3D6S A;  1MEG A;  1DF0 A;  4W5B A;  1YAL A;  4ZUX U;  3F5V A;  4OEL A;  1EWL A;  1U5I A;  2HHN A;  3WXF A;  4YYU A;  2FO5 A;  2G8E A;  4PP2 E;  3CBJ A;  1YK7 A;  4MZO A;  2R9O A;  2E03 A;  1AU4 A;  3KKU A;  3RVW A;  1K3B B;  1X9Y A;  1F2B A;  3LXS A;  2G7Y A;  4YYQ A;  2B1M A;  3QJ3 A;  2AYO A;  1AU0 A;  4MZS A;  1IWD A;  2DCA A;  2DJF B;  1MDW A;  4RY2 A;  1NQC A;  2IBI A;  1ATK A;  2AYN A;  2PBH A;  1PPN A;  2CB5 A;  1U9W A; 
#chains in the Genus database with same CATH topology
 2XU5 A;  1QXP A;  2HD5 A;  4QRX A;  5A24 A;  8PCH A;  4PP1 A;  2HWK A;  4Q8G A;  1EWM A;  4MSX A;  4CZW A;  1Q6K A;  2FRQ A;  4QBB A;  4D8E A;  2Y6E A;  2FQ9 A;  3BC3 A;  2NQG A;  2DCC A;  3MTN A;  4N4Z A;  2AVW A;  2H7J A;  3S3Q A;  1MIR A;  3USV A;  3PW3 A;  3PHW A;  3TMP A;  3HD3 A;  2DC9 A;  2NQD B;  5EGW A;  2YJB A;  4W4U A;  5JA7 A;  2JRI A;  3F75 A;  2FUD A;  3BY4 A;  3W30 A;  3H7D A;  3KW9 A;  2GHU A;  3E1Z B;  4P6G A;  4OVZ B;  2XU4 A;  3N3K A;  4FIP A;  1MHW A;  4RF1 A;  4PT5 A;  1AYU A;  4YVA A;  3GCB A;  3MOR A;  3PNR A;  2FTD A;  2NQI A;  4GUA A;  1CV8 A;  2FRA A;  2DCD A;  2AIM A;  2B1N A;  1ZIV A;  4CDE B;  2DCB A;  1YK8 A;  3IOQ A;  3OF8 A;  1PXV A;  1SNK A;  1F29 A;  1AYW A;  4OVZ A;  3P5X A;  3BCN A;  2DZY A;  1TLO A;  4K7C A;  2PRE A;  2NQA A;  5KO3 A;  3I06 A;  3P5W A;  2ARY A;  2OP3 A;  2E00 A;  3PT2 A;  5CVO B;  1AYV A;  3MP2 A;  2E02 A;  1PE6 A;  4BS5 A;  1GLO A;  1U9X A;  2BU3 A;  2JTC A;  4BOQ A;  4HWY A;  2BDL A;  3KSE A;  3S3R A;  1F2C A;  1BGO A;  3IV2 A;  2YJ8 A;  2DC8 A;  2CIO A;  3B79 A;  1S4V A;  1YZB A;  4X6J A;  3HHI A;  2DC6 A;  2G8J A;  3BOW A;  1PPP A;  1KFX L;  3OF9 A;  2YJ2 A;  3V6C A;  1KHQ A;  3V6E A;  2GFO A;  1U9Q X;  3WXE A;  1BY8 A;  3C0R A;  4REZ A;  3K9M A;  5FPW A;  4QRV A;  3TRK A;  3IMA A;  2YJ9 A;  4BPV A;  4RKX A;  1VSN A;  1AIM A;  3MHH A;  3ZUA A;  3O0U A;  4YYR A;  4HXD B;  1ME4 A;  4MI7 A;  1ITO A;  3AI8 A;  4CDD B;  2BTW A;  2XU1 A;  4YYS A;  4YYW A;  2FYE A;  3HHA A;  3KWZ A;  3IUT A;  2Z84 A;  1CQD A;  2G6D A;  6PAD A;  2J7Q A;  3H8C A;  3KWB X;  1PPD A;  5EZQ A;  3QT4 A;  3ERV A;  1HUC B;  4G54 A;  1NB3 A;  4BOZ A;  3IFU A;  1MEM A;  3B21 A;  1PAD A;  1EWO A;  7PCK A;  2AUZ A;  4AXL A;  1SP4 B;  3HWN A;  3N4C A;  3CBK A;  2AS8 A;  2OUL A;  2P7U A;  2F1G A;  1FH0 A;  2F7D A;  2O6X A;  5EF4 A;  3I3T A;  1TU6 A;  3WXG A;  3BBA A;  3P5U A;  4OW0 A;  1F2A A;  4BOU A;  4DMY A;  1Y4H A;  4PAD A;  4R3D A;  2R9C A;  5EZS A;  4BS6 A;  4MM3 B;  4YV8 A;  5CHV A;  2ACT A;  1AU3 A;  2PNS A;  2XU3 A;  2C0Y A;  1CPJ A;  3RNV A;  1KXR A;  1GMY A;  1CSB B;  2ATO A;  4QRG A;  2IPP B;  2OZ2 A;  1QOL A;  4X6I A;  4FK5 A;  2J7Q C;  4D8I A;  1PCI A;  4X6H A;  2DJG B;  1ME3 A;  3QSD A;  1STF E;  3C9E A;  5JH3 A;  3NHE A;  4M0W A;  2P0R A;  4P6E A;  4BSQ A;  1CB5 A;  4KLB A;  3OVZ A;  3CH2 X;  4I05 A;  4I07 A;  5K16 A;  1DKI A;  2Y5B A;  3CH3 X;  3M99 A;  1QMY A;  1O0E A;  1EWP A;  3BB7 A;  1Y08 A;  2FE8 A;  2R6N A;  4I04 A;  3PBH A;  5F02 A;  2HXZ A;  2PAD A;  2BTW B;  4N8W A;  4AXM A;  3O1G A;  1BQI A;  2R9M A;  2WBF X;  1POP A;  3MJ5 A;  4FJC A;  3P5V A;  4W5C A;  1NPZ A;  1NL6 A;  1CVZ A;  3PSE A;  5E6J A;  1THE A;  3RVV A;  5PAD A;  1GCB A;  1M6D A;  4P16 A;  3LFY A;  3OIS A;  3E9S A;  1PBH A;  1BP4 A;  2AUX A;  1VJV A;  4XR7 A;  1GEC E;  1CS8 A;  2DC7 A;  2R9N A;  2VHF A;  4D8B A;  4YYV A;  9PAP A;  4QH6 A;  3ZNH A;  4BQV A;  1CTE A;  2R9F A;  4ZTB A;  2E01 A;  2P86 A;  4WUR A;  1UKF A;  4XUI A;  3MTV A;  1AU2 A;  1QDQ A;  3H89 A;  4N79 A;  3H8B A;  3W31 A;  2VHS A;  2UZJ A;  1YT7 A;  3RVX A;  2JQG R;  2YJC A;  1ZCM A;  1CJL A;  1TL9 A;  1MS6 A;  2FT2 A;  4CDF B;  1KFU L;  1DEU A;  1XKG A;  3H6S A;  5J94 A;  4Q8H A;  4DMX A;  3K24 A;  4A5U A;  4PI3 A;  4WA6 A;  1PVJ A;  4OEM A;  3BWK A;  4RNA A;  5JZE A;  3MHS A;  1AEC A;  1JQP A;  5CVM A;  3BPF A;  3O65 A;  3DF0 A;  1A6R A;  3IHP A;  1NB5 A;  3BPM A;  4CDC B;  1NLJ A;  3U8E A;  1PIP A;  1U9V A;  3PHU A;  3IEJ A;  4RF0 A;  2DZZ A;  3K8U A;  2DOS A;  1ICF A;  3OQC A;  3N3G A;  5CHT A;  3TNX A;  3PHX A;  3KFQ A;  1PPO A;  2JQF R;  1YVB A;  2BDZ A;  2HH5 A;  4IP3 A;  2AU1 A;  3PDF A;  1EF7 A;  4XZX A;  1KHP A;  3KX1 A;  3OVX A;  5CVN B;  3D6S A;  1MEG A;  1DF0 A;  4W5B A;  1YAL A;  4ZUX U;  3F5V A;  4OEL A;  1EWL A;  1U5I A;  2HHN A;  3WXF A;  4YYU A;  3PRP A;  2FO5 A;  2G8E A;  4PP2 E;  3CBJ A;  1YK7 A;  4MZO A;  2R9O A;  2AGA A;  2E03 A;  1AU4 A;  3KKU A;  3RVW A;  1K3B B;  1X9Y A;  1F2B A;  4BOS A;  3LXS A;  2G7Y A;  4YYQ A;  2B1M A;  3QJ3 A;  2AYO A;  1AU0 A;  4MZS A;  1IWD A;  2DCA A;  2DJF B;  3PRM A;  1MDW A;  4RY2 A;  1NQC A;  4BOP A;  2IBI A;  1ATK A;  2AYN A;  2PBH A;  1PPN A;  2CB5 A;  1U9W A;  4IUM A; 
#chains in the Genus database with same CATH homology
 2XU5 A;  1QXP A;  2HD5 A;  4QRX A;  5A24 A;  8PCH A;  4PP1 A;  4Q8G A;  1EWM A;  4MSX A;  4CZW A;  1Q6K A;  2FRQ A;  4QBB A;  2Y6E A;  2FQ9 A;  3BC3 A;  2NQG A;  2DCC A;  3MTN A;  4N4Z A;  2AVW A;  2H7J A;  3S3Q A;  1MIR A;  3USV A;  3PW3 A;  3HD3 A;  2VFC A;  2DC9 A;  2NQD B;  5EGW A;  2YJB A;  4W4U A;  5JA7 A;  3F75 A;  2FUD A;  3H7D A;  3KW9 A;  2GHU A;  3E1Z B;  4P6G A;  2XU4 A;  3N3K A;  4FIP A;  1MHW A;  1AYU A;  4YVA A;  3GCB A;  3MOR A;  3PNR A;  2FTD A;  2NQI A;  1W4T A;  1CV8 A;  2FRA A;  2DCD A;  4B55 A;  2AIM A;  2B1N A;  1ZIV A;  4CDE B;  2DCB A;  1YK8 A;  3IOQ A;  3OF8 A;  1PXV A;  1SNK A;  1F29 A;  1AYW A;  3P5X A;  3BCN A;  2DZY A;  1TLO A;  4K7C A;  2PRE A;  2NQA A;  3I06 A;  3P5W A;  2ARY A;  2OP3 A;  2E00 A;  5CVO B;  1AYV A;  2E02 A;  1PE6 A;  4BS5 A;  1GLO A;  1W6F A;  1U9X A;  4HWY A;  2BDL A;  3KSE A;  3S3R A;  1F2C A;  1BGO A;  4BGF A;  3IV2 A;  2YJ8 A;  2DC8 A;  2CIO A;  3B79 A;  1S4V A;  4X6J A;  3HHI A;  2DC6 A;  2G8J A;  3BOW A;  1PPP A;  1KFX L;  3OF9 A;  2YJ2 A;  3V6C A;  1KHQ A;  3V6E A;  2GFO A;  1U9Q X;  3WXE A;  1BY8 A;  3K9M A;  5FPW A;  4QRV A;  3IMA A;  2YJ9 A;  4BPV A;  1VSN A;  1AIM A;  3MHH A;  4C5P A;  3ZUA A;  3O0U A;  4YYR A;  1ME4 A;  1ITO A;  3AI8 A;  4CDD B;  2XU1 A;  4YYS A;  4YYW A;  2FYE A;  3HHA A;  3KWZ A;  3IUT A;  1CQD A;  2G6D A;  6PAD A;  3H8C A;  3KWB X;  1PPD A;  3QT4 A;  3ERV A;  1HUC B;  4G54 A;  1NB3 A;  1MEM A;  1PAD A;  1EWO A;  7PCK A;  2AUZ A;  4AXL A;  1SP4 B;  3HWN A;  3N4C A;  3CBK A;  2AS8 A;  2OUL A;  2P7U A;  2F1G A;  1FH0 A;  2F7D A;  2O6X A;  5EF4 A;  3I3T A;  1TU6 A;  3WXG A;  3P5U A;  1F2A A;  4DMY A;  1Y4H A;  4PAD A;  2R9C A;  4BS6 A;  4YV8 A;  5CHV A;  2ACT A;  1AU3 A;  2PNS A;  2XU3 A;  2C0Y A;  1CPJ A;  1KXR A;  1GMY A;  1CSB B;  2ATO A;  4QRG A;  2IPP B;  2OZ2 A;  1QOL A;  4X6I A;  4FK5 A;  1PCI A;  2BSZ A;  4X6H A;  2DJG B;  1ME3 A;  3QSD A;  1STF E;  3C9E A;  5JH3 A;  3NHE A;  2P0R A;  4P6E A;  4BSQ A;  1CB5 A;  4KLB A;  3OVZ A;  3CH2 X;  4I05 A;  3D9W A;  4I07 A;  5K16 A;  2Y5B A;  3CH3 X;  3M99 A;  1QMY A;  1O0E A;  1EWP A;  4NV8 A;  1Y08 A;  2R6N A;  4I04 A;  3PBH A;  5F02 A;  2HXZ A;  2PAD A;  4N8W A;  4AXM A;  3O1G A;  4GUZ A;  1BQI A;  2R9M A;  2WBF X;  1POP A;  4FJC A;  3P5V A;  4W5C A;  1NPZ A;  1NL6 A;  1CVZ A;  1E2T A;  1THE A;  3RVV A;  5PAD A;  1GCB A;  1M6D A;  3LFY A;  3OIS A;  1PBH A;  1BP4 A;  2AUX A;  1VJV A;  4XR7 A;  1GEC E;  1CS8 A;  2DC7 A;  2R9N A;  2VHF A;  4YYV A;  9PAP A;  4QH6 A;  4BQV A;  1CTE A;  2R9F A;  2E01 A;  2P86 A;  4XUI A;  1AU2 A;  1QDQ A;  3H89 A;  4N79 A;  3H8B A;  2VHS A;  1YT7 A;  3RVX A;  2JQG R;  2YJC A;  1ZCM A;  1CJL A;  1TL9 A;  1MS6 A;  2FT2 A;  4CDF B;  1KFU L;  1DEU A;  1XKG A;  3H6S A;  5J94 A;  4Q8H A;  4DMX A;  3K24 A;  4PI3 A;  4WA6 A;  4OEM A;  3BWK A;  3MHS A;  1AEC A;  1JQP A;  5CVM A;  3BPF A;  3DF0 A;  1A6R A;  3IHP A;  1NB5 A;  3BPM A;  4CDC B;  1NLJ A;  3U8E A;  1PIP A;  1U9V A;  3IEJ A;  2DZZ A;  3K8U A;  1ICF A;  3N3G A;  5CHT A;  3TNX A;  3KFQ A;  1PPO A;  2JQF R;  1YVB A;  2BDZ A;  2HH5 A;  2AU1 A;  3PDF A;  1EF7 A;  1KHP A;  3KX1 A;  3OVX A;  5CVN B;  3D6S A;  3LTW A;  1MEG A;  1DF0 A;  4W5B A;  1YAL A;  4ZUX U;  3F5V A;  4OEL A;  1EWL A;  1U5I A;  2HHN A;  4NV7 A;  3WXF A;  4YYU A;  2FO5 A;  2G8E A;  4PP2 E;  3CBJ A;  1YK7 A;  4MZO A;  2R9O A;  2E03 A;  1AU4 A;  3KKU A;  3RVW A;  1K3B B;  1X9Y A;  1F2B A;  1W5R A;  3LXS A;  2G7Y A;  4YYQ A;  2B1M A;  2VFB A;  3QJ3 A;  2AYO A;  1AU0 A;  4MZS A;  1IWD A;  2DCA A;  2DJF B;  1MDW A;  1GX3 A;  4RY2 A;  1NQC A;  2IBI A;  1ATK A;  2AYN A;  2PBH A;  1PPN A;  2CB5 A;  1U9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...