1CTEA

Crystal structures of recombinant rat cathepsin b and a cathepsin b-inhibitor complex: implications for structure-based inhibitor design
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
253
structure length
253
Chain Sequence
LPESFDAREQWSNCPTIAQIRDQGSCGSCWAFGAVEAMSDRICIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWNFWTRKGLVSGGVYNSHIGCLPYTIPPCEHHVNGARPPCTGEGDTPKCNKMCEAGYSTSYKEDKHYGYTSYSVSDSEKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDVMGGHAIRILGWGIENGVPYWLVANSWNADWGDNGFFKILRGENHCGIESEIVAGIPRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Thiol protease
molecule keywords CATHEPSIN B
publication title Crystal structures of recombinant rat cathepsin B and a cathepsin B-inhibitor complex. Implications for structure-based inhibitor design.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 69
structure length 253
sequence length 253
chains with identical sequence B
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 1995-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1cteA00
3CH2X 2XU5A 3O1GA 2E00A 2PADA 1NB3A 2GFOA 2DCDA 3K24A 3ERVA 4CDFB 1EWPA 3OVXA 2FO5A 4QH6A 2ATOA 2DC7A 3RVXA 2AYOA 3RVWA 3IUTA 4P6EA 2DC8A 2VHSA 3NHEA 3V6CA 2E01A 2FUDA 2BDZA 4YVAA 2OZ2A 4PI3A 3OF8A 1PADA 4X6IA 5JA7A 1AYUA 3BPFA 1F2AA 3H8CA 4ZUXU 4KLBA 3F5VA 2YJ9A 1CS8A 3KX1A 4P6GA 3QT4A 2DC6A 1BQIA 4FIPA 4BS6A 3PBHA 1NQCA 3KKUA 1PCIA 1MEGA 3IEJA 2AIMA 3RVVA 1ATKA 5K16A 3CBJA 5A24A 1QMYA 2NQGA 3S3QA 4HWYA 4W4UA 1U9WA 1GCBA 3KFQA 1PBHA 2B1MA 1Y08A 3KSEA 4W5CA 1CJLA 3P5WA 2FTDA 3B79A 3IMAA 4AXLA 2BDLA 3HD3A 1U9VA 2DC9A 4CDEB 3WXEA 2XU4A 1KFXL 1ME4A 4I05A 4QRGA 5F02A 2Y5BA 4YV8A 1IWDA 1JQPA 1KHPA 2YJ8A 3HWNA 3OVZA 2AS8A 3PDFA 1QDQA 5FPWA 4DMXA 2FYEA 1HUCB 2VHFA 3U8EA 1EF7A 2FRAA 5EF4A 1EWOA 2PREA 1EWMA 2C0YA 1GMYA 1F2BA 1BY8A 3DF0A 1CSBB 2HD5A 4N4ZA 4I04A 1QOLA 1POPA 1YK8A 2FRQA 4X6HA 2AUXA 2CB5A 3MHHA 3OISA 4K7CA 1AYVA 2AUZA 1SNKA 2P86A 1PPNA 2E02A 4MZOA 2G6DA 2ACTA 1M6DA 1O0EA 4CZWA 4RY2A 3GCBA 1YK7A 2B1NA 1DEUA 3PW3A 1AECA 2R9MA 3O0UA 1ME3A 1STFE 1ICFA 2E03A 3BC3A 4YYSA 1NB5A 3KWZA 2ARYA 4YYWA 3IV2A 2R9NA 4PP1A 2DCBA 1AYWA 3CH3X 1YVBA 5J94A 2FT2A 3WXFA 2H7JA 4G54A 3LFYA 1TL9A 3BWKA 2AYNA 4OEMA 2F1GA 8PCHA 3P5XA 4X6JA 1CQDA 3QJ3A 1F2CA 1CPJA 2OP3A 2G8EA 1X9YA 1CB5A 1U5IA 3CBKA 1SP4B 4AXMA 1KXRA 9PAPA 4BQVA 2HHNA 3MTNA 3IHPA 1PPDA 3H8BA 1PPPA 1AU3A 3N3KA 4FK5A 4N8WA 1BGOA 1MHWA 4QBBA 2PBHA 2O6XA 4MSXA 1AIMA 1AU0A 3BOWA 3USVA 3IOQA 1CTEA 3TNXA 3F75A 2YJBA 4YYQA 3N3GA 3C9EA 4CDCB 1AU4A 3HHIA 1YALA 3HHAA 1MDWA 1PE6A 5CVMA 1ZIVA 3I3TA 6PADA 5EGWA 5CVOB 1K3BB 3E1ZB 1FH0A 1KHQA 2HH5A 3H89A 2AVWA 3BCNA 2XU1A 1TU6A 2F7DA 2R9CA 5CVNB 3KWBX 4OELA 1ZCMA 3PNRA 1NL6A 2P7UA 2DCAA 1ITOA 1XKGA 4BPVA 1VJVA 2CIOA 2G7YA 1KFUL 4WA6A 2R9FA 4BSQA 1GECE 1S4VA 3D6SA 2YJ2A 2YJCA 1BP4A 2DZZA 1MIRA 2PNSA 3K8UA 5JH3A 1TLOA 1A6RA 1DF0A 4FJCA 5PADA 3OF9A 3BPMA 1EWLA 2OULA 3MHSA 1MEMA 2NQIA 2DJGB 3MORA 2FQ9A 1VSNA 5CHTA 1U9XA 2G8JA 3M99A 4W5BA 1PPOA 1AU2A 2XU3A 3V6EA 2NQDB 1F29A 1YT7A 2R9OA 4DMYA 7PCKA 3WXGA 2IBIA 4YYRA 3P5VA 4CDDB 2NQAA 2AU1A 2P0RA 1U9QX 3N4CA 3ZUAA 3QSDA 3H6SA 2JQFR 2GHUA 4YYVA 1Q6KA 1NLJA 4PADA 4YYUA 1CVZA 4Q8HA 2IPPB 3H7DA 2DJFB 4QRXA 5CHVA 4XUIA 4N79A 1Y4HA 2JQGR 1PIPA 1QXPA 1THEA 3S3RA 4XR7A 3K9MA 2WBFX 1NPZA 2Y6EA 3P5UA 2HXZA 1MS6A 4QRVA 1GLOA 4I07A 2DCCA 4MZSA 4BS5A 1PXVA 2R6NA 4Q8GA 1CV8A 3LXSA 4PP2E 3I06A 3KW9A 3AI8A 2DZYA
chains in the Genus database with same CATH superfamily
4BOQA 3CH2X 2XU5A 3O1GA 2E00A 2PADA 2UZJA 1NB3A 2GFOA 2DCDA 3K24A 3BB7A 3ERVA 4CDFB 1EWPA 3OVXA 2FO5A 4QH6A 2ATOA 2DC7A 3MJ5A 3RVXA 3B21A 2AYOA 3RVWA 2BTWB 3IUTA 4P6EA 2DC8A 2VHSA 3NHEA 3V6CA 2E01A 2FUDA 2BDZA 4YVAA 2OZ2A 4PI3A 3OF8A 1PADA 4X6IA 4P16A 5JA7A 1AYUA 4XZXA 3BPFA 1F2AA 2DOSA 3H8CA 4ZUXU 4KLBA 3F5VA 2YJ9A 3PRMA 1CS8A 3KX1A 4P6GA 3QT4A 2DC6A 3BBAA 1BQIA 4FIPA 4BS6A 3PBHA 1NQCA 3KKUA 1PCIA 1MEGA 3IEJA 2AIMA 3RVVA 3W31A 4R3DA 1ATKA 5K16A 3CBJA 5A24A 1QMYA 2NQGA 3S3QA 4HWYA 4W4UA 1U9WA 1GCBA 3KFQA 4RF1A 1PBHA 2B1MA 1Y08A 3KSEA 4W5CA 1CJLA 3P5WA 2FTDA 3B79A 4D8IA 3PRPA 3IMAA 4AXLA 2BDLA 3HD3A 1U9VA 4RNAA 2DC9A 4CDEB 3WXEA 2XU4A 1KFXL 1ME4A 4I05A 4QRGA 5F02A 2Y5BA 4YV8A 4OW0A 1IWDA 1JQPA 1KHPA 4BOPA 2YJ8A 3HWNA 3W30A 3OVZA 2AS8A 3PDFA 1QDQA 5FPWA 4DMXA 2FYEA 1HUCB 2VHFA 3U8EA 1EF7A 2FRAA 5EF4A 1EWOA 2PREA 4D8BA 1EWMA 2C0YA 3PHWA 1GMYA 1F2BA 1BY8A 3DF0A 1CSBB 2HD5A 4N4ZA 4I04A 1QOLA 1POPA 1YK8A 2FRQA 4X6HA 2AUXA 2CB5A 3MHHA 3OISA 4K7CA 1AYVA 2AUZA 2FE8A 1SNKA 4RF0A 2P86A 1PPNA 2E02A 4MZOA 2G6DA 2ACTA 1M6DA 1O0EA 4CZWA 4RY2A 3GCBA 1YK7A 2B1NA 4MM3B 1DEUA 3PW3A 1AECA 2BU3A 3TRKA 2R9MA 3O0UA 1ME3A 3PT2A 1STFE 1ICFA 2E03A 3BC3A 4YYSA 1NB5A 3KWZA 4ZTBA 2ARYA 4YYWA 4MI7A 3IV2A 2R9NA 4PP1A 2DCBA 1AYWA 3CH3X 1YVBA 5J94A 2FT2A 3WXFA 2H7JA 4G54A 1DKIA 3LFYA 1TL9A 3BWKA 2AYNA 4OEMA 2F1GA 8PCHA 3P5XA 4X6JA 1CQDA 4PT5A 3QJ3A 1F2CA 1CPJA 2OP3A 2G8EA 1X9YA 1CB5A 1U5IA 3CBKA 3RNVA 1SP4B 4AXMA 1KXRA 9PAPA 4BQVA 2HHNA 3MTNA 3IHPA 1PPDA 5JZEA 3H8BA 4OVZA 3MTVA 1PPPA 1AU3A 3N3KA 4FK5A 4N8WA 1BGOA 1MHWA 4QBBA 2PBHA 2O6XA 4MSXA 5KO3A 1AIMA 1AU0A 3BOWA 3MP2A 3IOQA 3USVA 1CTEA 3TNXA 3F75A 2J7QC 2YJBA 4YYQA 3N3GA 3C9EA 3PHUA 5E6JA 4CDCB 1AU4A 3HHIA 4D8EA 1YALA 3HHAA 1MDWA 5EZQA 1PE6A 5CVMA 2J7QA 1ZIVA 3I3TA 6PADA 5EGWA 5CVOB 1K3BB 3E1ZB 2Z84A 1FH0A 1KHQA 2HH5A 3H89A 3PHXA 2AVWA 3BCNA 4OVZB 2XU1A 3C0RA 1TU6A 2AGAA 2F7DA 2R9CA 5CVNB 3KWBX 4OELA 3TMPA 1ZCMA 3PNRA 1NL6A 2P7UA 2DCAA 1ITOA 4M0WA 4BOZA 1XKGA 4BPVA 1VJVA 2CIOA 2G7YA 2HWKA 1KFUL 4WA6A 2R9FA 4BSQA 1GECE 1S4VA 3D6SA 2YJ2A 4GUAA 2YJCA 1BP4A 1YZBA 1PVJA 2DZZA 1MIRA 2PNSA 3BY4A 3K8UA 1TLOA 5JH3A 1A6RA 1DF0A 4FJCA 5PADA 3OF9A 3BPMA 1EWLA 2OULA 3MHSA 1MEMA 4A5UA 2NQIA 2DJGB 3MORA 2FQ9A 1VSNA 5CHTA 1U9XA 2G8JA 3M99A 4REZA 4W5BA 1PPOA 1AU2A 4RKXA 2XU3A 3V6EA 2NQDB 1F29A 1YT7A 2R9OA 4DMYA 1UKFA 4IUMA 7PCKA 3IFUA 3WXGA 2IBIA 3ZNHA 4BOUA 3P5VA 4YYRA 4CDDB 4BOSA 2NQAA 2AU1A 2P0RA 1U9QX 3N4CA 3ZUAA 4WURA 3QSDA 3H6SA 2JQFR 2GHUA 4YYVA 1Q6KA 4IP3A 1NLJA 4HXDB 4PADA 3PSEA 4YYUA 1CVZA 4Q8HA 2IPPB 3H7DA 2DJFB 4QRXA 5CHVA 4XUIA 4N79A 1Y4HA 2JQGR 1PIPA 1QXPA 1THEA 3S3RA 2BTWA 3OQCA 5EZSA 4XR7A 3K9MA 2WBFX 1NPZA 2Y6EA 3P5UA 2HXZA 1MS6A 4QRVA 1GLOA 4I07A 2JRIA 2DCCA 4MZSA 4BS5A 1PXVA 2R6NA 4Q8GA 2JTCA 1CV8A 3LXSA 3O65A 4PP2E 3I06A 3E9SA 3KW9A 3AI8A 2DZYA
chains in the Genus database with same CATH topology
3CH2X 2XU5A 3O1GA 2E00A 2PADA 1NB3A 2GFOA 2DCDA 3K24A 3ERVA 4CDFB 1EWPA 3OVXA 2FO5A 4QH6A 4B55A 2ATOA 2DC7A 3RVXA 2AYOA 3RVWA 3IUTA 4P6EA 2DC8A 2VHSA 3NHEA 3V6CA 2E01A 2FUDA 2BDZA 4YVAA 2OZ2A 4PI3A 3OF8A 1PADA 4X6IA 5JA7A 1AYUA 3BPFA 1F2AA 3H8CA 4ZUXU 4KLBA 3F5VA 2YJ9A 1CS8A 3KX1A 4P6GA 3QT4A 2DC6A 1BQIA 4FIPA 4BS6A 3PBHA 1NQCA 3KKUA 1PCIA 1MEGA 3IEJA 2AIMA 3RVVA 1ATKA 5K16A 3CBJA 5A24A 1QMYA 2NQGA 3S3QA 4HWYA 4W4UA 1W6FA 1U9WA 1GCBA 3KFQA 1PBHA 2B1MA 1Y08A 3KSEA 4W5CA 1CJLA 3P5WA 2FTDA 3B79A 3IMAA 4AXLA 2BDLA 3HD3A 1U9VA 2DC9A 4CDEB 3WXEA 2XU4A 1KFXL 1ME4A 4I05A 4QRGA 5F02A 2Y5BA 4YV8A 1IWDA 1JQPA 1KHPA 2YJ8A 3HWNA 3OVZA 2AS8A 3PDFA 1QDQA 5FPWA 4BGFA 2FYEA 1HUCB 2VHFA 4DMXA 1W5RA 3U8EA 1EF7A 2FRAA 5EF4A 1EWOA 2PREA 1EWMA 2C0YA 1GMYA 1F2BA 1BY8A 3DF0A 1CSBB 2HD5A 4N4ZA 4I04A 1QOLA 1POPA 1YK8A 2FRQA 4X6HA 2AUXA 2CB5A 3MHHA 3OISA 4K7CA 1AYVA 2AUZA 1SNKA 2VFBA 2P86A 1PPNA 2E02A 4MZOA 2G6DA 2ACTA 1M6DA 1O0EA 1W4TA 4CZWA 4RY2A 3GCBA 1YK7A 2B1NA 1DEUA 3PW3A 1AECA 2R9MA 3O0UA 1ME3A 1STFE 1ICFA 2E03A 3BC3A 4YYSA 1NB5A 3KWZA 2ARYA 4C5PA 4YYWA 3IV2A 2R9NA 4PP1A 2DCBA 1AYWA 3CH3X 1YVBA 5J94A 2FT2A 3WXFA 2H7JA 4G54A 3LFYA 1TL9A 3BWKA 2AYNA 4OEMA 2F1GA 8PCHA 3P5XA 4X6JA 1CQDA 3QJ3A 1F2CA 1CPJA 2OP3A 2G8EA 1X9YA 1CB5A 1U5IA 3CBKA 1SP4B 4AXMA 1KXRA 9PAPA 4BQVA 2HHNA 3MTNA 3IHPA 1PPDA 3H8BA 1PPPA 1AU3A 3N3KA 4FK5A 4N8WA 1BGOA 1MHWA 4QBBA 2PBHA 2O6XA 4MSXA 1AIMA 1AU0A 3BOWA 3USVA 3IOQA 1CTEA 3TNXA 3F75A 2YJBA 4YYQA 3N3GA 3C9EA 4CDCB 1AU4A 3HHIA 1YALA 3HHAA 1MDWA 1PE6A 5CVMA 1ZIVA 3I3TA 6PADA 1GX3A 5EGWA 5CVOB 1K3BB 3E1ZB 1FH0A 1KHQA 2HH5A 3H89A 4NV7A 2AVWA 3BCNA 2XU1A 1TU6A 2F7DA 2R9CA 5CVNB 3KWBX 4OELA 1ZCMA 3PNRA 1NL6A 2P7UA 2DCAA 1ITOA 2BSZA 3D9WA 1XKGA 4BPVA 1VJVA 2CIOA 2G7YA 1KFUL 4WA6A 2R9FA 4BSQA 1GECE 1S4VA 3D6SA 2YJ2A 2YJCA 1BP4A 2DZZA 1MIRA 2PNSA 2VFCA 3K8UA 5JH3A 1TLOA 1A6RA 1DF0A 4FJCA 5PADA 3OF9A 3BPMA 1EWLA 2OULA 3MHSA 1MEMA 2NQIA 2DJGB 3MORA 2FQ9A 1VSNA 5CHTA 1U9XA 2G8JA 3M99A 4W5BA 4NV8A 1PPOA 1AU2A 2XU3A 3V6EA 2NQDB 1F29A 1YT7A 2R9OA 4DMYA 7PCKA 3WXGA 2IBIA 4YYRA 3P5VA 4CDDB 2NQAA 2AU1A 2P0RA 1U9QX 3N4CA 3ZUAA 3LTWA 3QSDA 3H6SA 2JQFR 2GHUA 4GUZA 4YYVA 1Q6KA 1NLJA 4PADA 4YYUA 1CVZA 4Q8HA 2IPPB 3H7DA 2DJFB 4QRXA 5CHVA 4XUIA 4N79A 1Y4HA 2JQGR 1PIPA 1QXPA 1THEA 3S3RA 4XR7A 3K9MA 2WBFX 1NPZA 2Y6EA 3P5UA 1E2TA 2HXZA 1MS6A 4QRVA 1GLOA 4I07A 2DCCA 4MZSA 4BS5A 1PXVA 2R6NA 4Q8GA 1CV8A 3LXSA 4PP2E 3I06A 3KW9A 3AI8A 2DZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CH2 X;  2XU5 A;  3O1G A;  2E00 A;  2PAD A;  1NB3 A;  2GFO A;  2DCD A;  3K24 A;  3ERV A;  4CDF B;  1EWP A;  3OVX A;  2FO5 A;  4QH6 A;  2ATO A;  2DC7 A;  3RVX A;  2AYO A;  3RVW A;  3IUT A;  4P6E A;  2DC8 A;  2VHS A;  3NHE A;  3V6C A;  2E01 A;  2FUD A;  2BDZ A;  4YVA A;  2OZ2 A;  4PI3 A;  3OF8 A;  1PAD A;  4X6I A;  5JA7 A;  1AYU A;  3BPF A;  1F2A A;  3H8C A;  4ZUX U;  4KLB A;  3F5V A;  2YJ9 A;  1CS8 A;  3KX1 A;  4P6G A;  3QT4 A;  2DC6 A;  1BQI A;  4FIP A;  4BS6 A;  3PBH A;  1NQC A;  3KKU A;  1PCI A;  1MEG A;  3IEJ A;  2AIM A;  3RVV A;  1ATK A;  5K16 A;  3CBJ A;  5A24 A;  1QMY A;  2NQG A;  3S3Q A;  4HWY A;  4W4U A;  1U9W A;  1GCB A;  3KFQ A;  1PBH A;  2B1M A;  1Y08 A;  3KSE A;  4W5C A;  1CJL A;  3P5W A;  2FTD A;  3B79 A;  3IMA A;  4AXL A;  2BDL A;  3HD3 A;  1U9V A;  2DC9 A;  4CDE B;  3WXE A;  2XU4 A;  1KFX L;  1ME4 A;  4I05 A;  4QRG A;  5F02 A;  2Y5B A;  4YV8 A;  1IWD A;  1JQP A;  1KHP A;  2YJ8 A;  3HWN A;  3OVZ A;  2AS8 A;  3PDF A;  1QDQ A;  5FPW A;  4DMX A;  2FYE A;  1HUC B;  2VHF A;  3U8E A;  1EF7 A;  2FRA A;  5EF4 A;  1EWO A;  2PRE A;  1EWM A;  2C0Y A;  1GMY A;  1F2B A;  1BY8 A;  3DF0 A;  1CSB B;  2HD5 A;  4N4Z A;  4I04 A;  1QOL A;  1POP A;  1YK8 A;  2FRQ A;  4X6H A;  2AUX A;  2CB5 A;  3MHH A;  3OIS A;  4K7C A;  1AYV A;  2AUZ A;  1SNK A;  2P86 A;  1PPN A;  2E02 A;  4MZO A;  2G6D A;  2ACT A;  1M6D A;  1O0E A;  4CZW A;  4RY2 A;  3GCB A;  1YK7 A;  2B1N A;  1DEU A;  3PW3 A;  1AEC A;  2R9M A;  3O0U A;  1ME3 A;  1STF E;  1ICF A;  2E03 A;  3BC3 A;  4YYS A;  1NB5 A;  3KWZ A;  2ARY A;  4YYW A;  3IV2 A;  2R9N A;  4PP1 A;  2DCB A;  1AYW A;  3CH3 X;  1YVB A;  5J94 A;  2FT2 A;  3WXF A;  2H7J A;  4G54 A;  3LFY A;  1TL9 A;  3BWK A;  2AYN A;  4OEM A;  2F1G A;  8PCH A;  3P5X A;  4X6J A;  1CQD A;  3QJ3 A;  1F2C A;  1CPJ A;  2OP3 A;  2G8E A;  1X9Y A;  1CB5 A;  1U5I A;  3CBK A;  1SP4 B;  4AXM A;  1KXR A;  9PAP A;  4BQV A;  2HHN A;  3MTN A;  3IHP A;  1PPD A;  3H8B A;  1PPP A;  1AU3 A;  3N3K A;  4FK5 A;  4N8W A;  1BGO A;  1MHW A;  4QBB A;  2PBH A;  2O6X A;  4MSX A;  1AIM A;  1AU0 A;  3BOW A;  3USV A;  3IOQ A;  1CTE A;  3TNX A;  3F75 A;  2YJB A;  4YYQ A;  3N3G A;  3C9E A;  4CDC B;  1AU4 A;  3HHI A;  1YAL A;  3HHA A;  1MDW A;  1PE6 A;  5CVM A;  1ZIV A;  3I3T A;  6PAD A;  5EGW A;  5CVO B;  1K3B B;  3E1Z B;  1FH0 A;  1KHQ A;  2HH5 A;  3H89 A;  2AVW A;  3BCN A;  2XU1 A;  1TU6 A;  2F7D A;  2R9C A;  5CVN B;  3KWB X;  4OEL A;  1ZCM A;  3PNR A;  1NL6 A;  2P7U A;  2DCA A;  1ITO A;  1XKG A;  4BPV A;  1VJV A;  2CIO A;  2G7Y A;  1KFU L;  4WA6 A;  2R9F A;  4BSQ A;  1GEC E;  1S4V A;  3D6S A;  2YJ2 A;  2YJC A;  1BP4 A;  2DZZ A;  1MIR A;  2PNS A;  3K8U A;  5JH3 A;  1TLO A;  1A6R A;  1DF0 A;  4FJC A;  5PAD A;  3OF9 A;  3BPM A;  1EWL A;  2OUL A;  3MHS A;  1MEM A;  2NQI A;  2DJG B;  3MOR A;  2FQ9 A;  1VSN A;  5CHT A;  1U9X A;  2G8J A;  3M99 A;  4W5B A;  1PPO A;  1AU2 A;  2XU3 A;  3V6E A;  2NQD B;  1F29 A;  1YT7 A;  2R9O A;  4DMY A;  7PCK A;  3WXG A;  2IBI A;  4YYR A;  3P5V A;  4CDD B;  2NQA A;  2AU1 A;  2P0R A;  1U9Q X;  3N4C A;  3ZUA A;  3QSD A;  3H6S A;  2JQF R;  2GHU A;  4YYV A;  1Q6K A;  1NLJ A;  4PAD A;  4YYU A;  1CVZ A;  4Q8H A;  2IPP B;  3H7D A;  2DJF B;  4QRX A;  5CHV A;  4XUI A;  4N79 A;  1Y4H A;  2JQG R;  1PIP A;  1QXP A;  1THE A;  3S3R A;  4XR7 A;  3K9M A;  2WBF X;  1NPZ A;  2Y6E A;  3P5U A;  2HXZ A;  1MS6 A;  4QRV A;  1GLO A;  4I07 A;  2DCC A;  4MZS A;  4BS5 A;  1PXV A;  2R6N A;  4Q8G A;  1CV8 A;  3LXS A;  4PP2 E;  3I06 A;  3KW9 A;  3AI8 A;  2DZY A; 
#chains in the Genus database with same CATH topology
 4BOQ A;  3CH2 X;  2XU5 A;  3O1G A;  2E00 A;  2PAD A;  2UZJ A;  1NB3 A;  2GFO A;  2DCD A;  3K24 A;  3BB7 A;  3ERV A;  4CDF B;  1EWP A;  3OVX A;  2FO5 A;  4QH6 A;  2ATO A;  2DC7 A;  3MJ5 A;  3RVX A;  3B21 A;  2AYO A;  3RVW A;  2BTW B;  3IUT A;  4P6E A;  2DC8 A;  2VHS A;  3NHE A;  3V6C A;  2E01 A;  2FUD A;  2BDZ A;  4YVA A;  2OZ2 A;  4PI3 A;  3OF8 A;  1PAD A;  4X6I A;  4P16 A;  5JA7 A;  1AYU A;  4XZX A;  3BPF A;  1F2A A;  2DOS A;  3H8C A;  4ZUX U;  4KLB A;  3F5V A;  2YJ9 A;  3PRM A;  1CS8 A;  3KX1 A;  4P6G A;  3QT4 A;  2DC6 A;  3BBA A;  1BQI A;  4FIP A;  4BS6 A;  3PBH A;  1NQC A;  3KKU A;  1PCI A;  1MEG A;  3IEJ A;  2AIM A;  3RVV A;  3W31 A;  4R3D A;  1ATK A;  5K16 A;  3CBJ A;  5A24 A;  1QMY A;  2NQG A;  3S3Q A;  4HWY A;  4W4U A;  1U9W A;  1GCB A;  3KFQ A;  4RF1 A;  1PBH A;  2B1M A;  1Y08 A;  3KSE A;  4W5C A;  1CJL A;  3P5W A;  2FTD A;  3B79 A;  4D8I A;  3PRP A;  3IMA A;  4AXL A;  2BDL A;  3HD3 A;  1U9V A;  4RNA A;  2DC9 A;  4CDE B;  3WXE A;  2XU4 A;  1KFX L;  1ME4 A;  4I05 A;  4QRG A;  5F02 A;  2Y5B A;  4YV8 A;  4OW0 A;  1IWD A;  1JQP A;  1KHP A;  4BOP A;  2YJ8 A;  3HWN A;  3W30 A;  3OVZ A;  2AS8 A;  3PDF A;  1QDQ A;  5FPW A;  4DMX A;  2FYE A;  1HUC B;  2VHF A;  3U8E A;  1EF7 A;  2FRA A;  5EF4 A;  1EWO A;  2PRE A;  4D8B A;  1EWM A;  2C0Y A;  3PHW A;  1GMY A;  1F2B A;  1BY8 A;  3DF0 A;  1CSB B;  2HD5 A;  4N4Z A;  4I04 A;  1QOL A;  1POP A;  1YK8 A;  2FRQ A;  4X6H A;  2AUX A;  2CB5 A;  3MHH A;  3OIS A;  4K7C A;  1AYV A;  2AUZ A;  2FE8 A;  1SNK A;  4RF0 A;  2P86 A;  1PPN A;  2E02 A;  4MZO A;  2G6D A;  2ACT A;  1M6D A;  1O0E A;  4CZW A;  4RY2 A;  3GCB A;  1YK7 A;  2B1N A;  4MM3 B;  1DEU A;  3PW3 A;  1AEC A;  2BU3 A;  3TRK A;  2R9M A;  3O0U A;  1ME3 A;  3PT2 A;  1STF E;  1ICF A;  2E03 A;  3BC3 A;  4YYS A;  1NB5 A;  3KWZ A;  4ZTB A;  2ARY A;  4YYW A;  4MI7 A;  3IV2 A;  2R9N A;  4PP1 A;  2DCB A;  1AYW A;  3CH3 X;  1YVB A;  5J94 A;  2FT2 A;  3WXF A;  2H7J A;  4G54 A;  1DKI A;  3LFY A;  1TL9 A;  3BWK A;  2AYN A;  4OEM A;  2F1G A;  8PCH A;  3P5X A;  4X6J A;  1CQD A;  4PT5 A;  3QJ3 A;  1F2C A;  1CPJ A;  2OP3 A;  2G8E A;  1X9Y A;  1CB5 A;  1U5I A;  3CBK A;  3RNV A;  1SP4 B;  4AXM A;  1KXR A;  9PAP A;  4BQV A;  2HHN A;  3MTN A;  3IHP A;  1PPD A;  5JZE A;  3H8B A;  4OVZ A;  3MTV A;  1PPP A;  1AU3 A;  3N3K A;  4FK5 A;  4N8W A;  1BGO A;  1MHW A;  4QBB A;  2PBH A;  2O6X A;  4MSX A;  5KO3 A;  1AIM A;  1AU0 A;  3BOW A;  3MP2 A;  3IOQ A;  3USV A;  1CTE A;  3TNX A;  3F75 A;  2J7Q C;  2YJB A;  4YYQ A;  3N3G A;  3C9E A;  3PHU A;  5E6J A;  4CDC B;  1AU4 A;  3HHI A;  4D8E A;  1YAL A;  3HHA A;  1MDW A;  5EZQ A;  1PE6 A;  5CVM A;  2J7Q A;  1ZIV A;  3I3T A;  6PAD A;  5EGW A;  5CVO B;  1K3B B;  3E1Z B;  2Z84 A;  1FH0 A;  1KHQ A;  2HH5 A;  3H89 A;  3PHX A;  2AVW A;  3BCN A;  4OVZ B;  2XU1 A;  3C0R A;  1TU6 A;  2AGA A;  2F7D A;  2R9C A;  5CVN B;  3KWB X;  4OEL A;  3TMP A;  1ZCM A;  3PNR A;  1NL6 A;  2P7U A;  2DCA A;  1ITO A;  4M0W A;  4BOZ A;  1XKG A;  4BPV A;  1VJV A;  2CIO A;  2G7Y A;  2HWK A;  1KFU L;  4WA6 A;  2R9F A;  4BSQ A;  1GEC E;  1S4V A;  3D6S A;  2YJ2 A;  4GUA A;  2YJC A;  1BP4 A;  1YZB A;  1PVJ A;  2DZZ A;  1MIR A;  2PNS A;  3BY4 A;  3K8U A;  1TLO A;  5JH3 A;  1A6R A;  1DF0 A;  4FJC A;  5PAD A;  3OF9 A;  3BPM A;  1EWL A;  2OUL A;  3MHS A;  1MEM A;  4A5U A;  2NQI A;  2DJG B;  3MOR A;  2FQ9 A;  1VSN A;  5CHT A;  1U9X A;  2G8J A;  3M99 A;  4REZ A;  4W5B A;  1PPO A;  1AU2 A;  4RKX A;  2XU3 A;  3V6E A;  2NQD B;  1F29 A;  1YT7 A;  2R9O A;  4DMY A;  1UKF A;  4IUM A;  7PCK A;  3IFU A;  3WXG A;  2IBI A;  3ZNH A;  4BOU A;  3P5V A;  4YYR A;  4CDD B;  4BOS A;  2NQA A;  2AU1 A;  2P0R A;  1U9Q X;  3N4C A;  3ZUA A;  4WUR A;  3QSD A;  3H6S A;  2JQF R;  2GHU A;  4YYV A;  1Q6K A;  4IP3 A;  1NLJ A;  4HXD B;  4PAD A;  3PSE A;  4YYU A;  1CVZ A;  4Q8H A;  2IPP B;  3H7D A;  2DJF B;  4QRX A;  5CHV A;  4XUI A;  4N79 A;  1Y4H A;  2JQG R;  1PIP A;  1QXP A;  1THE A;  3S3R A;  2BTW A;  3OQC A;  5EZS A;  4XR7 A;  3K9M A;  2WBF X;  1NPZ A;  2Y6E A;  3P5U A;  2HXZ A;  1MS6 A;  4QRV A;  1GLO A;  4I07 A;  2JRI A;  2DCC A;  4MZS A;  4BS5 A;  1PXV A;  2R6N A;  4Q8G A;  2JTC A;  1CV8 A;  3LXS A;  3O65 A;  4PP2 E;  3I06 A;  3E9S A;  3KW9 A;  3AI8 A;  2DZY A; 
#chains in the Genus database with same CATH homology
 3CH2 X;  2XU5 A;  3O1G A;  2E00 A;  2PAD A;  1NB3 A;  2GFO A;  2DCD A;  3K24 A;  3ERV A;  4CDF B;  1EWP A;  3OVX A;  2FO5 A;  4QH6 A;  4B55 A;  2ATO A;  2DC7 A;  3RVX A;  2AYO A;  3RVW A;  3IUT A;  4P6E A;  2DC8 A;  2VHS A;  3NHE A;  3V6C A;  2E01 A;  2FUD A;  2BDZ A;  4YVA A;  2OZ2 A;  4PI3 A;  3OF8 A;  1PAD A;  4X6I A;  5JA7 A;  1AYU A;  3BPF A;  1F2A A;  3H8C A;  4ZUX U;  4KLB A;  3F5V A;  2YJ9 A;  1CS8 A;  3KX1 A;  4P6G A;  3QT4 A;  2DC6 A;  1BQI A;  4FIP A;  4BS6 A;  3PBH A;  1NQC A;  3KKU A;  1PCI A;  1MEG A;  3IEJ A;  2AIM A;  3RVV A;  1ATK A;  5K16 A;  3CBJ A;  5A24 A;  1QMY A;  2NQG A;  3S3Q A;  4HWY A;  4W4U A;  1W6F A;  1U9W A;  1GCB A;  3KFQ A;  1PBH A;  2B1M A;  1Y08 A;  3KSE A;  4W5C A;  1CJL A;  3P5W A;  2FTD A;  3B79 A;  3IMA A;  4AXL A;  2BDL A;  3HD3 A;  1U9V A;  2DC9 A;  4CDE B;  3WXE A;  2XU4 A;  1KFX L;  1ME4 A;  4I05 A;  4QRG A;  5F02 A;  2Y5B A;  4YV8 A;  1IWD A;  1JQP A;  1KHP A;  2YJ8 A;  3HWN A;  3OVZ A;  2AS8 A;  3PDF A;  1QDQ A;  5FPW A;  4BGF A;  2FYE A;  1HUC B;  2VHF A;  4DMX A;  1W5R A;  3U8E A;  1EF7 A;  2FRA A;  5EF4 A;  1EWO A;  2PRE A;  1EWM A;  2C0Y A;  1GMY A;  1F2B A;  1BY8 A;  3DF0 A;  1CSB B;  2HD5 A;  4N4Z A;  4I04 A;  1QOL A;  1POP A;  1YK8 A;  2FRQ A;  4X6H A;  2AUX A;  2CB5 A;  3MHH A;  3OIS A;  4K7C A;  1AYV A;  2AUZ A;  1SNK A;  2VFB A;  2P86 A;  1PPN A;  2E02 A;  4MZO A;  2G6D A;  2ACT A;  1M6D A;  1O0E A;  1W4T A;  4CZW A;  4RY2 A;  3GCB A;  1YK7 A;  2B1N A;  1DEU A;  3PW3 A;  1AEC A;  2R9M A;  3O0U A;  1ME3 A;  1STF E;  1ICF A;  2E03 A;  3BC3 A;  4YYS A;  1NB5 A;  3KWZ A;  2ARY A;  4C5P A;  4YYW A;  3IV2 A;  2R9N A;  4PP1 A;  2DCB A;  1AYW A;  3CH3 X;  1YVB A;  5J94 A;  2FT2 A;  3WXF A;  2H7J A;  4G54 A;  3LFY A;  1TL9 A;  3BWK A;  2AYN A;  4OEM A;  2F1G A;  8PCH A;  3P5X A;  4X6J A;  1CQD A;  3QJ3 A;  1F2C A;  1CPJ A;  2OP3 A;  2G8E A;  1X9Y A;  1CB5 A;  1U5I A;  3CBK A;  1SP4 B;  4AXM A;  1KXR A;  9PAP A;  4BQV A;  2HHN A;  3MTN A;  3IHP A;  1PPD A;  3H8B A;  1PPP A;  1AU3 A;  3N3K A;  4FK5 A;  4N8W A;  1BGO A;  1MHW A;  4QBB A;  2PBH A;  2O6X A;  4MSX A;  1AIM A;  1AU0 A;  3BOW A;  3USV A;  3IOQ A;  1CTE A;  3TNX A;  3F75 A;  2YJB A;  4YYQ A;  3N3G A;  3C9E A;  4CDC B;  1AU4 A;  3HHI A;  1YAL A;  3HHA A;  1MDW A;  1PE6 A;  5CVM A;  1ZIV A;  3I3T A;  6PAD A;  1GX3 A;  5EGW A;  5CVO B;  1K3B B;  3E1Z B;  1FH0 A;  1KHQ A;  2HH5 A;  3H89 A;  4NV7 A;  2AVW A;  3BCN A;  2XU1 A;  1TU6 A;  2F7D A;  2R9C A;  5CVN B;  3KWB X;  4OEL A;  1ZCM A;  3PNR A;  1NL6 A;  2P7U A;  2DCA A;  1ITO A;  2BSZ A;  3D9W A;  1XKG A;  4BPV A;  1VJV A;  2CIO A;  2G7Y A;  1KFU L;  4WA6 A;  2R9F A;  4BSQ A;  1GEC E;  1S4V A;  3D6S A;  2YJ2 A;  2YJC A;  1BP4 A;  2DZZ A;  1MIR A;  2PNS A;  2VFC A;  3K8U A;  5JH3 A;  1TLO A;  1A6R A;  1DF0 A;  4FJC A;  5PAD A;  3OF9 A;  3BPM A;  1EWL A;  2OUL A;  3MHS A;  1MEM A;  2NQI A;  2DJG B;  3MOR A;  2FQ9 A;  1VSN A;  5CHT A;  1U9X A;  2G8J A;  3M99 A;  4W5B A;  4NV8 A;  1PPO A;  1AU2 A;  2XU3 A;  3V6E A;  2NQD B;  1F29 A;  1YT7 A;  2R9O A;  4DMY A;  7PCK A;  3WXG A;  2IBI A;  4YYR A;  3P5V A;  4CDD B;  2NQA A;  2AU1 A;  2P0R A;  1U9Q X;  3N4C A;  3ZUA A;  3LTW A;  3QSD A;  3H6S A;  2JQF R;  2GHU A;  4GUZ A;  4YYV A;  1Q6K A;  1NLJ A;  4PAD A;  4YYU A;  1CVZ A;  4Q8H A;  2IPP B;  3H7D A;  2DJF B;  4QRX A;  5CHV A;  4XUI A;  4N79 A;  1Y4H A;  2JQG R;  1PIP A;  1QXP A;  1THE A;  3S3R A;  4XR7 A;  3K9M A;  2WBF X;  1NPZ A;  2Y6E A;  3P5U A;  1E2T A;  2HXZ A;  1MS6 A;  4QRV A;  1GLO A;  4I07 A;  2DCC A;  4MZS A;  4BS5 A;  1PXV A;  2R6N A;  4Q8G A;  1CV8 A;  3LXS A;  4PP2 E;  3I06 A;  3KW9 A;  3AI8 A;  2DZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...