2J7QC

Crystal structure of the ubiquitin-specific protease encoded by murine cytomegalovirus tegument protein m48 in complex with a ubquitin-based suicide substrate
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
232
structure length
232
Chain Sequence
MKIVRASRDQSAPVYGPRAGSQCMSNCFTFLHTCYLMGIDPVLDTTSLDAVLDSGARLDAIADEKVKRQALTDHPYRLGTEIPTVIETPAGITGHALSRPFNGTAETQDLGGYKCLGILDFLTYARGKPLPVYIIVTVGVFTRGVIVARGATYVFDPHTTDLSAEAAVYVCDDFTEAISALSFFTEMIGDFYYDAVLVYFTRCRTTLISPSELLVQIMDQYKDPDIDASVMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Herpesvirus-Encoded Cysteine Protease Reveals a Unique Class of Deubiquitinating Enzymes
pubmed doi rcsb
source organism Murine cytomegalovirus
molecule tags Hydrolase
molecule keywords MCMV TEGUMENT PROTEIN M48 ENCODED UBIQUITIN- SPECIFIC PROTEA
total genus 66
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2006-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.120 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2j7qC00
2J7QA 2J7QC
chains in the Genus database with same CATH superfamily
2BDZA 5F02A 2AU1A 3PNRA 2PADA 1MEMA 2HWKA 1QXPA 1YT7A 1POPA 4FJCA 1KXRA 3WXEA 1QMYA 3CBJA 4MZOA 2AYOA 3ERVA 2GHUA 4M0WA 4PT5A 1KHQA 3S3RA 1PE6A 3F75A 4OELA 3KKUA 1YZBA 2DC8A 1GMYA 2AVWA 1NB5A 4YYUA 3K9MA 4YV8A 1CS8A 1U9WA 3MTNA 3ZNHA 2HHNA 1F2CA 3PHUA 1SNKA 3IMAA 2GFOA 2JTCA 4DMXA 3E9SA 4QH6A 3HD3A 1NQCA 4ZUXU 1JQPA 2XU1A 4OW0A 4OVZB 3PSEA 5CVOB 1AU3A 1AYUA 4D8BA 1FH0A 3IV2A 2YJ9A 2C0YA 2O6XA 1Y08A 4XUIA 2CIOA 3C0RA 2R9OA 3OQCA 2G7YA 3C9EA 3PBHA 3P5VA 3KX1A 4BOUA 1MEGA 4G54A 3PT2A 2H7JA 1GLOA 2VHFA 2XU5A 3MTVA 2E01A 1HUCB 1ZCMA 2WBFX 1NPZA 1K3BB 4IUMA 4KLBA 3W31A 2UZJA 3PW3A 2XU4A 3BPFA 4D8EA 3KFQA 3I3TA 3RVVA 2IPPB 1VSNA 3BPMA 3RNVA 1YVBA 2Y6EA 4I07A 5JH3A 3QSDA 1BQIA 3HHAA 4X6IA 3I06A 3AI8A 1U9XA 4RKXA 3S3QA 2OULA 4X6HA 2FRAA 3KSEA 1PPNA 1EF7A 1CVZA 4AXMA 1EWMA 3MHSA 3PDFA 4REZA 1SP4B 1TU6A 1BP4A 4GUAA 2PREA 1F2BA 4XR7A 3OVXA 4QBBA 1U9QX 2HD5A 1ICFA 2DC6A 2B1MA 4IP3A 4I05A 3H89A 2HH5A 2FE8A 1PIPA 1THEA 1O0EA 1AYWA 3USVA 1PADA 5EZQA 1U9VA 2BTWA 2DOSA 5E6JA 2IBIA 4BPVA 3BOWA 3IEJA 3BB7A 2ACTA 2R9FA 4RF0A 4QRGA 1UKFA 1S4VA 2NQDB 3P5XA 5KO3A 1TL9A 3OISA 1ITOA 2FUDA 2HXZA 1PBHA 5JA7A 5CVNB 5A24A 3CH3X 4BOPA 1KHPA 2DCAA 4HWYA 3RVWA 3N4CA 3OVZA 4RNAA 2VHSA 5EGWA 1NL6A 3MJ5A 4ZTBA 2Z84A 3OF9A 4CDDB 4MI7A 4PP1A 2G8EA 4MM3B 5PADA 2G8JA 4RY2A 1BGOA 1M6DA 1AIMA 4D8IA 2OZ2A 4BSQA 4FIPA 3PHWA 2AYNA 3BWKA 1KFXL 2PBHA 3NHEA 1DEUA 4HXDB 4RF1A 4YYSA 3WXFA 3PHXA 3BC3A 1U5IA 3IUTA 3O1GA 2DCBA 1AYVA 3LFYA 3IFUA 4BOQA 4OVZA 9PAPA 3N3GA 3B21A 8PCHA 2ATOA 3IHPA 2AGAA 3OF8A 1CTEA 1DKIA 6PADA 4YYWA 1EWLA 2DC9A 1Q6KA 1BY8A 2F7DA 2J7QC 2FT2A 4PADA 2AUXA 1AU0A 1AECA 3M99A 1EWOA 2R9CA 2DCCA 2FO5A 2AUZA 3TMPA 4BQVA 4PI3A 1A6RA 2ARYA 3B79A 4W4UA 3H7DA 4YYVA 5K16A 4BS5A 1AU4A 1MS6A 4N79A 3KWZA 1ME4A 3K8UA 2P7UA 4BOZA 1PXVA 1NLJA 3E1ZB 4YVAA 3LXSA 4AXLA 2CB5A 2E03A 2NQIA 3RVXA 1GCBA 2R9NA 1STFE 4YYQA 3HWNA 3QT4A 2OP3A 5CHTA 3GCBA 2P86A 1QOLA 1IWDA 2BTWB 2R9MA 3U8EA 3K24A 3QJ3A 3MHHA 3BCNA 2YJBA 1TLOA 4WA6A 2BDLA 3PRPA 1VJVA 3W30A 1AU2A 2AIMA 1CSBB 2F1GA 1XKGA 1PPOA 1YK7A 3H6SA 1QDQA 2YJ2A 1ATKA 1KFUL 4N4ZA 1F29A 2P0RA 2E00A 1EWPA 2DC7A 2DJGB 2NQGA 3F5VA 4P6EA 2BU3A 3IOQA 3KW9A 4QRXA 4Q8GA 1ME3A 1CPJA 3N3KA 3TNXA 4X6JA 4K7CA 1CJLA 4WURA 1F2AA 3H8BA 5EZSA 2R6NA 4QRVA 2J7QA 3MORA 1PCIA 4PP2E 4Q8HA 3P5UA 2FQ9A 3D6SA 3ZUAA 1GECE 1PPPA 2Y5BA 5J94A 4MZSA 2E02A 3KWBX 3V6CA 3MP2A 2DJFB 1Y4HA 1NB3A 3O0UA 2DZYA 4N8WA 4W5BA 4XZXA 3DF0A 2JRIA 2YJ8A 4W5CA 5EF4A 4DMYA 4I04A 1PVJA 3O65A 4CDEB 3CBKA 2YJCA 2JQFR 7PCKA 2PNSA 4A5UA 2FRQA 4P16A 4BS6A 2JQGR 5FPWA 2NQAA 3TRKA 4OEMA 1MHWA 4P6GA 4CDFB 2AS8A 2FYEA 1DF0A 3BY4A 1YALA 5JZEA 5CVMA 1CB5A 2DCDA 4FK5A 4R3DA 2B1NA 2DZZA 2FTDA 3WXGA 3V6EA 4CDCB 1ZIVA 4CZWA 3H8CA 2G6DA 3CH2X 1CQDA 3BBAA 4BOSA 1CV8A 1MDWA 4MSXA 5CHVA 1YK8A 1PPDA 2XU3A 3HHIA 1X9YA 3P5WA 1MIRA 3PRMA 4YYRA
chains in the Genus database with same CATH topology
3BY4A 3PT2A 5E6JA 3PHWA 5JZEA 4RKXA 3MTVA 1YZBA 2BU3A 4OW0A 4RNAA 4A5UA 2BTWB 4OVZB 2J7QC 4R3DA 4HXDB 3BB7A 4P16A 4RF1A 3MJ5A 2HWKA 3PSEA 3PHXA 4IP3A 4RF0A 4IUMA 3W31A 4BOZA 2UZJA 1UKFA 4D8BA 4ZTBA 2Z84A 3BBAA 3E9SA 3MP2A 4MI7A 2FE8A 3PRPA 3TRKA 4WURA 3IFUA 3W30A 4BOSA 4BOQA 4REZA 5EZSA 4D8EA 5KO3A 4OVZA 3ZNHA 2J7QA 3B21A 4XZXA 3RNVA 3TMPA 4MM3B 2JRIA 3PHUA 3C0RA 5EZQA 3OQCA 4GUAA 2JTCA 2AGAA 4M0WA 1DKIA 4BOPA 1PVJA 2BTWA 3PRMA 4PT5A 4D8IA 3O65A 4BOUA 2DOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J7Q A;  2J7Q C; 
#chains in the Genus database with same CATH topology
 2BDZ A;  5F02 A;  2AU1 A;  3PNR A;  2PAD A;  1MEM A;  2HWK A;  1QXP A;  1YT7 A;  1POP A;  4FJC A;  1KXR A;  3WXE A;  1QMY A;  3CBJ A;  4MZO A;  2AYO A;  3ERV A;  2GHU A;  4M0W A;  4PT5 A;  1KHQ A;  3S3R A;  1PE6 A;  3F75 A;  4OEL A;  3KKU A;  1YZB A;  2DC8 A;  1GMY A;  2AVW A;  1NB5 A;  4YYU A;  3K9M A;  4YV8 A;  1CS8 A;  1U9W A;  3MTN A;  3ZNH A;  2HHN A;  1F2C A;  3PHU A;  1SNK A;  3IMA A;  2GFO A;  2JTC A;  4DMX A;  3E9S A;  4QH6 A;  3HD3 A;  1NQC A;  4ZUX U;  1JQP A;  2XU1 A;  4OW0 A;  4OVZ B;  3PSE A;  5CVO B;  1AU3 A;  1AYU A;  4D8B A;  1FH0 A;  3IV2 A;  2YJ9 A;  2C0Y A;  2O6X A;  1Y08 A;  4XUI A;  2CIO A;  3C0R A;  2R9O A;  3OQC A;  2G7Y A;  3C9E A;  3PBH A;  3P5V A;  3KX1 A;  4BOU A;  1MEG A;  4G54 A;  3PT2 A;  2H7J A;  1GLO A;  2VHF A;  2XU5 A;  3MTV A;  2E01 A;  1HUC B;  1ZCM A;  2WBF X;  1NPZ A;  1K3B B;  4IUM A;  4KLB A;  3W31 A;  2UZJ A;  3PW3 A;  2XU4 A;  3BPF A;  4D8E A;  3KFQ A;  3I3T A;  3RVV A;  2IPP B;  1VSN A;  3BPM A;  3RNV A;  1YVB A;  2Y6E A;  4I07 A;  5JH3 A;  3QSD A;  1BQI A;  3HHA A;  4X6I A;  3I06 A;  3AI8 A;  1U9X A;  4RKX A;  3S3Q A;  2OUL A;  4X6H A;  2FRA A;  3KSE A;  1PPN A;  1EF7 A;  1CVZ A;  4AXM A;  1EWM A;  3MHS A;  3PDF A;  4REZ A;  1SP4 B;  1TU6 A;  1BP4 A;  4GUA A;  2PRE A;  1F2B A;  4XR7 A;  3OVX A;  4QBB A;  1U9Q X;  2HD5 A;  1ICF A;  2DC6 A;  2B1M A;  4IP3 A;  4I05 A;  3H89 A;  2HH5 A;  2FE8 A;  1PIP A;  1THE A;  1O0E A;  1AYW A;  3USV A;  1PAD A;  5EZQ A;  1U9V A;  2BTW A;  2DOS A;  5E6J A;  2IBI A;  4BPV A;  3BOW A;  3IEJ A;  3BB7 A;  2ACT A;  2R9F A;  4RF0 A;  4QRG A;  1UKF A;  1S4V A;  2NQD B;  3P5X A;  5KO3 A;  1TL9 A;  3OIS A;  1ITO A;  2FUD A;  2HXZ A;  1PBH A;  5JA7 A;  5CVN B;  5A24 A;  3CH3 X;  4BOP A;  1KHP A;  2DCA A;  4HWY A;  3RVW A;  3N4C A;  3OVZ A;  4RNA A;  2VHS A;  5EGW A;  1NL6 A;  3MJ5 A;  4ZTB A;  2Z84 A;  3OF9 A;  4CDD B;  4MI7 A;  4PP1 A;  2G8E A;  4MM3 B;  5PAD A;  2G8J A;  4RY2 A;  1BGO A;  1M6D A;  1AIM A;  4D8I A;  2OZ2 A;  4BSQ A;  4FIP A;  3PHW A;  2AYN A;  3BWK A;  1KFX L;  2PBH A;  3NHE A;  1DEU A;  4HXD B;  4RF1 A;  4YYS A;  3WXF A;  3PHX A;  3BC3 A;  1U5I A;  3IUT A;  3O1G A;  2DCB A;  1AYV A;  3LFY A;  3IFU A;  4BOQ A;  4OVZ A;  9PAP A;  3N3G A;  3B21 A;  8PCH A;  2ATO A;  3IHP A;  2AGA A;  3OF8 A;  1CTE A;  1DKI A;  6PAD A;  4YYW A;  1EWL A;  2DC9 A;  1Q6K A;  1BY8 A;  2F7D A;  2J7Q C;  2FT2 A;  4PAD A;  2AUX A;  1AU0 A;  1AEC A;  3M99 A;  1EWO A;  2R9C A;  2DCC A;  2FO5 A;  2AUZ A;  3TMP A;  4BQV A;  4PI3 A;  1A6R A;  2ARY A;  3B79 A;  4W4U A;  3H7D A;  4YYV A;  5K16 A;  4BS5 A;  1AU4 A;  1MS6 A;  4N79 A;  3KWZ A;  1ME4 A;  3K8U A;  2P7U A;  4BOZ A;  1PXV A;  1NLJ A;  3E1Z B;  4YVA A;  3LXS A;  4AXL A;  2CB5 A;  2E03 A;  2NQI A;  3RVX A;  1GCB A;  2R9N A;  1STF E;  4YYQ A;  3HWN A;  3QT4 A;  2OP3 A;  5CHT A;  3GCB A;  2P86 A;  1QOL A;  1IWD A;  2BTW B;  2R9M A;  3U8E A;  3K24 A;  3QJ3 A;  3MHH A;  3BCN A;  2YJB A;  1TLO A;  4WA6 A;  2BDL A;  3PRP A;  1VJV A;  3W30 A;  1AU2 A;  2AIM A;  1CSB B;  2F1G A;  1XKG A;  1PPO A;  1YK7 A;  3H6S A;  1QDQ A;  2YJ2 A;  1ATK A;  1KFU L;  4N4Z A;  1F29 A;  2P0R A;  2E00 A;  1EWP A;  2DC7 A;  2DJG B;  2NQG A;  3F5V A;  4P6E A;  2BU3 A;  3IOQ A;  3KW9 A;  4QRX A;  4Q8G A;  1ME3 A;  1CPJ A;  3N3K A;  3TNX A;  4X6J A;  4K7C A;  1CJL A;  4WUR A;  1F2A A;  3H8B A;  5EZS A;  2R6N A;  4QRV A;  2J7Q A;  3MOR A;  1PCI A;  4PP2 E;  4Q8H A;  3P5U A;  2FQ9 A;  3D6S A;  3ZUA A;  1GEC E;  1PPP A;  2Y5B A;  5J94 A;  4MZS A;  2E02 A;  3KWB X;  3V6C A;  3MP2 A;  2DJF B;  1Y4H A;  1NB3 A;  3O0U A;  2DZY A;  4N8W A;  4W5B A;  4XZX A;  3DF0 A;  2JRI A;  2YJ8 A;  4W5C A;  5EF4 A;  4DMY A;  4I04 A;  1PVJ A;  3O65 A;  4CDE B;  3CBK A;  2YJC A;  2JQF R;  7PCK A;  2PNS A;  4A5U A;  2FRQ A;  4P16 A;  4BS6 A;  2JQG R;  5FPW A;  2NQA A;  3TRK A;  4OEM A;  1MHW A;  4P6G A;  4CDF B;  2AS8 A;  2FYE A;  1DF0 A;  3BY4 A;  1YAL A;  5JZE A;  5CVM A;  1CB5 A;  2DCD A;  4FK5 A;  4R3D A;  2B1N A;  2DZZ A;  2FTD A;  3WXG A;  3V6E A;  4CDC B;  1ZIV A;  4CZW A;  3H8C A;  2G6D A;  3CH2 X;  1CQD A;  3BBA A;  4BOS A;  1CV8 A;  1MDW A;  4MSX A;  5CHV A;  1YK8 A;  1PPD A;  2XU3 A;  3HHI A;  1X9Y A;  3P5W A;  1MIR A;  3PRM A;  4YYR A; 
#chains in the Genus database with same CATH homology
 3BY4 A;  3PT2 A;  5E6J A;  3PHW A;  5JZE A;  4RKX A;  3MTV A;  1YZB A;  2BU3 A;  4OW0 A;  4RNA A;  4A5U A;  2BTW B;  4OVZ B;  2J7Q C;  4R3D A;  4HXD B;  3BB7 A;  4P16 A;  4RF1 A;  3MJ5 A;  2HWK A;  3PSE A;  3PHX A;  4IP3 A;  4RF0 A;  4IUM A;  3W31 A;  4BOZ A;  2UZJ A;  1UKF A;  4D8B A;  4ZTB A;  2Z84 A;  3BBA A;  3E9S A;  3MP2 A;  4MI7 A;  2FE8 A;  3PRP A;  3TRK A;  4WUR A;  3IFU A;  3W30 A;  4BOS A;  4BOQ A;  4REZ A;  5EZS A;  4D8E A;  5KO3 A;  4OVZ A;  3ZNH A;  2J7Q A;  3B21 A;  4XZX A;  3RNV A;  3TMP A;  4MM3 B;  2JRI A;  3PHU A;  3C0R A;  5EZQ A;  3OQC A;  4GUA A;  2JTC A;  2AGA A;  4M0W A;  1DKI A;  4BOP A;  1PVJ A;  2BTW A;  3PRM A;  4PT5 A;  4D8I A;  3O65 A;  4BOU A;  2DOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...