2J7QC

Crystal structure of the ubiquitin-specific protease encoded by murine cytomegalovirus tegument protein m48 in complex with a ubquitin-based suicide substrate
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
232
structure length
232
Chain Sequence
MKIVRASRDQSAPVYGPRAGSQCMSNCFTFLHTCYLMGIDPVLDTTSLDAVLDSGARLDAIADEKVKRQALTDHPYRLGTEIPTVIETPAGITGHALSRPFNGTAETQDLGGYKCLGILDFLTYARGKPLPVYIIVTVGVFTRGVIVARGATYVFDPHTTDLSAEAAVYVCDDFTEAISALSFFTEMIGDFYYDAVLVYFTRCRTTLISPSELLVQIMDQYKDPDIDASVMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Herpesvirus-Encoded Cysteine Protease Reveals a Unique Class of Deubiquitinating Enzymes
pubmed doi rcsb
source organism Murine cytomegalovirus
molecule tags Hydrolase
molecule keywords MCMV TEGUMENT PROTEIN M48 ENCODED UBIQUITIN- SPECIFIC PROTEA
total genus 66
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2006-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.120 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2j7qC00
2J7QC 2J7QA
chains in the Genus database with same CATH superfamily
3IOQA 2DCCA 3E9SA 3GCBA 5JH3A 1AECA 4ZTBA 1S4VA 2BU3A 2AIMA 3TMPA 4N4ZA 1YVBA 4PT5A 1BP4A 3BOWA 1MIRA 1PE6A 4IP3A 5PADA 3W30A 2XU1A 3BCNA 2YJ2A 4PI3A 3C0RA 3P5VA 4YYRA 1CB5A 2CIOA 2ARYA 2OP3A 4ZUXU 4N8WA 3PT2A 2CB5A 3K8UA 4AXLA 2GHUA 3AI8A 5EZSA 1AU3A 1KHPA 1QXPA 4X6IA 1ITOA 4GUAA 4MZOA 2IPPB 5FPWA 3RVXA 2HD5A 1KXRA 2JQFR 1F2BA 2OZ2A 1POPA 6PADA 2DCAA 2NQGA 1TL9A 2XU4A 3BBAA 1MDWA 4BOUA 1NPZA 4QH6A 4D8EA 2YJBA 4PP2E 3OISA 1FH0A 5JZEA 2E00A 1CS8A 5CVNB 4RNAA 2P86A 3MORA 5F02A 4DMYA 1O0EA 4P6EA 2P7UA 3P5WA 5E6JA 3IUTA 4XUIA 1F2AA 3HWNA 1DEUA 2DC8A 4BS5A 3CH3X 4BQVA 3H7DA 4CDDB 1PPOA 3N3GA 9PAPA 1BY8A 1QMYA 4N79A 4BPVA 3K9MA 1CJLA 2E02A 3ERVA 5J94A 3N4CA 3DF0A 1EWPA 4BOZA 3RVWA 3OF9A 3PHUA 1BGOA 3MJ5A 4W5BA 4P6GA 3USVA 1AU4A 4XR7A 3B79A 5CVOB 1KFUL 3MTVA 4YYUA 3BPFA 1GECE 2BTWA 2DCBA 3ZUAA 4FJCA 2BDZA 4CZWA 4OVZA 1TLOA 1CPJA 4D8BA 3M99A 2YJ9A 1BQIA 5KO3A 1PBHA 2HH5A 2VHSA 5EGWA 1EF7A 3PSEA 4YYWA 1CV8A 3IMAA 4YYQA 1K3BB 5EF4A 2J7QA 2P0RA 4CDCB 4RKXA 2BTWB 4PADA 4YYVA 2DCDA 1GLOA 4WA6A 1NB5A 4QRXA 3MHSA 4MI7A 2ATOA 2DC6A 2FYEA 4AXMA 3QT4A 2B1NA 3PW3A 5EZQA 2ACTA 2JTCA 1ME3A 1U9XA 1CTEA 2BDLA 1U9VA 2NQIA 4P16A 3WXEA 3BY4A 4FIPA 4REZA 1U9WA 4IUMA 4RF0A 1AIMA 3H6SA 2B1MA 3LXSA 3TNXA 4W4UA 4I04A 2FO5A 4BS6A 1DKIA 2AYOA 4MZSA 3S3RA 1VJVA 4FK5A 1Y08A 4BOPA 1ZCMA 2E03A 4K7CA 1SP4B 4PP1A 1NLJA 2FTDA 3P5UA 3BWKA 3PHXA 1TU6A 3F5VA 1GCBA 2R9FA 3F75A 2AS8A 3TRKA 3I06A 2J7QC 3QJ3A 3O0UA 2AUXA 1PCIA 3N3KA 1VSNA 3IEJA 2PBHA 3KX1A 1PIPA 4CDFB 1QOLA 4I07A 3H8BA 1NB3A 3E1ZB 1THEA 4G54A 1A6RA 1F29A 1ATKA 1SNKA 2R9CA 3WXGA 2Y6EA 3HHAA 3LFYA 3NHEA 4YVAA 1PXVA 4RY2A 1UKFA 2PREA 8PCHA 1IWDA 4OVZB 4YV8A 2UZJA 2F1GA 3V6EA 3PDFA 1AYVA 3O65A 2G8EA 5CVMA 5K16A 2OULA 4BSQA 3I3TA 2FQ9A 3C9EA 3W31A 2VHFA 2FT2A 4QRGA 4Q8GA 3BB7A 3CH2X 4KLBA 3OVZA 3PRPA 3MHHA 1U9QX 1STFE 2Z84A 2H7JA 4I05A 4X6HA 2DOSA 1AU0A 1ME4A 1F2CA 3RNVA 2XU3A 1Q6KA 4MSXA 1M6DA 3HD3A 2R9NA 3CBJA 1YK8A 1NL6A 2AVWA 2R6NA 3MTNA 3PBHA 5CHTA 3WXFA 1NQCA 4HXDB 1MEMA 2HWKA 1XKGA 4X6JA 3BPMA 3OQCA 1PPPA 2G8JA 5A24A 4BOSA 1PADA 2R9MA 5CHVA 2JRIA 4MM3B 1PPDA 1X9YA 2AU1A 3QSDA 2GFOA 2G6DA 1Y4HA 1YK7A 2FRQA 3K24A 2DC7A 1CQDA 4OEMA 1EWMA 3KSEA 2FE8A 1HUCB 2AGAA 4W5CA 1CSBB 1KFXL 4XZXA 3IFUA 4A5UA 2FUDA 4QBBA 2DC9A 2E01A 1EWOA 4BOQA 1PVJA 2HXZA 1CVZA 2PNSA 2NQDB 2F7DA 3H89A 4R3DA 4QRVA 2JQGR 2PADA 2O6XA 1GMYA 4RF1A 2HHNA 4DMXA 3KW9A 3V6CA 2DJFB 1EWLA 1MS6A 3PRMA 2AUZA 3ZNHA 1MHWA 2R9OA 1YALA 3IV2A 2G7YA 3IHPA 1YZBA 7PCKA 1ICFA 4YYSA 1KHQA 5JA7A 4WURA 3D6SA 2FRAA 1PPNA 3H8CA 4CDEB 4Q8HA 1U5IA 2DZYA 2YJ8A 1AYWA 3PNRA 4OW0A 3KFQA 1QDQA 1AU2A 3CBKA 2NQAA 2WBFX 2IBIA 1AYUA 1DF0A 2XU5A 3KWZA 3P5XA 3MP2A 2Y5BA 1JQPA 4D8IA 1YT7A 3O1GA 4M0WA 2YJCA 3RVVA 3S3QA 3B21A 4HWYA 3HHIA 2DJGB 3OVXA 1MEGA 4OELA 2C0YA 3U8EA 3KKUA 2DZZA 3BC3A 3PHWA 2AYNA 1ZIVA 3OF8A 3KWBX
chains in the Genus database with same CATH topology
4OVZB 3E9SA 3MTVA 4D8IA 4RKXA 2UZJA 2BTWA 2Z84A 4RF1A 4WURA 4R3DA 2JTCA 4OW0A 5E6JA 3PT2A 4M0WA 4ZTBA 5EZQA 2AGAA 4BOSA 2DOSA 2BTWB 2BU3A 2JRIA 3TMPA 4OVZA 3O65A 4D8BA 3PRMA 3B21A 4MM3B 3IFUA 4XZXA 4A5UA 5EZSA 3PHXA 4PT5A 3ZNHA 3BBAA 4BOUA 4P16A 3BY4A 4D8EA 4REZA 5KO3A 4IUMA 4RF0A 3RNVA 3TRKA 5JZEA 3PSEA 4GUAA 4BOZA 2J7QC 1YZBA 1UKFA 4IP3A 4RNAA 3PHUA 3PRPA 3W30A 3PHWA 3MJ5A 3OQCA 3W31A 1PVJA 4BOPA 3C0RA 4BOQA 4HXDB 2HWKA 2J7QA 1DKIA 3BB7A 3MP2A 4MI7A 2FE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J7Q C;  2J7Q A; 
#chains in the Genus database with same CATH topology
 3IOQ A;  2DCC A;  3E9S A;  3GCB A;  5JH3 A;  1AEC A;  4ZTB A;  1S4V A;  2BU3 A;  2AIM A;  3TMP A;  4N4Z A;  1YVB A;  4PT5 A;  1BP4 A;  3BOW A;  1MIR A;  1PE6 A;  4IP3 A;  5PAD A;  3W30 A;  2XU1 A;  3BCN A;  2YJ2 A;  4PI3 A;  3C0R A;  3P5V A;  4YYR A;  1CB5 A;  2CIO A;  2ARY A;  2OP3 A;  4ZUX U;  4N8W A;  3PT2 A;  2CB5 A;  3K8U A;  4AXL A;  2GHU A;  3AI8 A;  5EZS A;  1AU3 A;  1KHP A;  1QXP A;  4X6I A;  1ITO A;  4GUA A;  4MZO A;  2IPP B;  5FPW A;  3RVX A;  2HD5 A;  1KXR A;  2JQF R;  1F2B A;  2OZ2 A;  1POP A;  6PAD A;  2DCA A;  2NQG A;  1TL9 A;  2XU4 A;  3BBA A;  1MDW A;  4BOU A;  1NPZ A;  4QH6 A;  4D8E A;  2YJB A;  4PP2 E;  3OIS A;  1FH0 A;  5JZE A;  2E00 A;  1CS8 A;  5CVN B;  4RNA A;  2P86 A;  3MOR A;  5F02 A;  4DMY A;  1O0E A;  4P6E A;  2P7U A;  3P5W A;  5E6J A;  3IUT A;  4XUI A;  1F2A A;  3HWN A;  1DEU A;  2DC8 A;  4BS5 A;  3CH3 X;  4BQV A;  3H7D A;  4CDD B;  1PPO A;  3N3G A;  9PAP A;  1BY8 A;  1QMY A;  4N79 A;  4BPV A;  3K9M A;  1CJL A;  2E02 A;  3ERV A;  5J94 A;  3N4C A;  3DF0 A;  1EWP A;  4BOZ A;  3RVW A;  3OF9 A;  3PHU A;  1BGO A;  3MJ5 A;  4W5B A;  4P6G A;  3USV A;  1AU4 A;  4XR7 A;  3B79 A;  5CVO B;  1KFU L;  3MTV A;  4YYU A;  3BPF A;  1GEC E;  2BTW A;  2DCB A;  3ZUA A;  4FJC A;  2BDZ A;  4CZW A;  4OVZ A;  1TLO A;  1CPJ A;  4D8B A;  3M99 A;  2YJ9 A;  1BQI A;  5KO3 A;  1PBH A;  2HH5 A;  2VHS A;  5EGW A;  1EF7 A;  3PSE A;  4YYW A;  1CV8 A;  3IMA A;  4YYQ A;  1K3B B;  5EF4 A;  2J7Q A;  2P0R A;  4CDC B;  4RKX A;  2BTW B;  4PAD A;  4YYV A;  2DCD A;  1GLO A;  4WA6 A;  1NB5 A;  4QRX A;  3MHS A;  4MI7 A;  2ATO A;  2DC6 A;  2FYE A;  4AXM A;  3QT4 A;  2B1N A;  3PW3 A;  5EZQ A;  2ACT A;  2JTC A;  1ME3 A;  1U9X A;  1CTE A;  2BDL A;  1U9V A;  2NQI A;  4P16 A;  3WXE A;  3BY4 A;  4FIP A;  4REZ A;  1U9W A;  4IUM A;  4RF0 A;  1AIM A;  3H6S A;  2B1M A;  3LXS A;  3TNX A;  4W4U A;  4I04 A;  2FO5 A;  4BS6 A;  1DKI A;  2AYO A;  4MZS A;  3S3R A;  1VJV A;  4FK5 A;  1Y08 A;  4BOP A;  1ZCM A;  2E03 A;  4K7C A;  1SP4 B;  4PP1 A;  1NLJ A;  2FTD A;  3P5U A;  3BWK A;  3PHX A;  1TU6 A;  3F5V A;  1GCB A;  2R9F A;  3F75 A;  2AS8 A;  3TRK A;  3I06 A;  2J7Q C;  3QJ3 A;  3O0U A;  2AUX A;  1PCI A;  3N3K A;  1VSN A;  3IEJ A;  2PBH A;  3KX1 A;  1PIP A;  4CDF B;  1QOL A;  4I07 A;  3H8B A;  1NB3 A;  3E1Z B;  1THE A;  4G54 A;  1A6R A;  1F29 A;  1ATK A;  1SNK A;  2R9C A;  3WXG A;  2Y6E A;  3HHA A;  3LFY A;  3NHE A;  4YVA A;  1PXV A;  4RY2 A;  1UKF A;  2PRE A;  8PCH A;  1IWD A;  4OVZ B;  4YV8 A;  2UZJ A;  2F1G A;  3V6E A;  3PDF A;  1AYV A;  3O65 A;  2G8E A;  5CVM A;  5K16 A;  2OUL A;  4BSQ A;  3I3T A;  2FQ9 A;  3C9E A;  3W31 A;  2VHF A;  2FT2 A;  4QRG A;  4Q8G A;  3BB7 A;  3CH2 X;  4KLB A;  3OVZ A;  3PRP A;  3MHH A;  1U9Q X;  1STF E;  2Z84 A;  2H7J A;  4I05 A;  4X6H A;  2DOS A;  1AU0 A;  1ME4 A;  1F2C A;  3RNV A;  2XU3 A;  1Q6K A;  4MSX A;  1M6D A;  3HD3 A;  2R9N A;  3CBJ A;  1YK8 A;  1NL6 A;  2AVW A;  2R6N A;  3MTN A;  3PBH A;  5CHT A;  3WXF A;  1NQC A;  4HXD B;  1MEM A;  2HWK A;  1XKG A;  4X6J A;  3BPM A;  3OQC A;  1PPP A;  2G8J A;  5A24 A;  4BOS A;  1PAD A;  2R9M A;  5CHV A;  2JRI A;  4MM3 B;  1PPD A;  1X9Y A;  2AU1 A;  3QSD A;  2GFO A;  2G6D A;  1Y4H A;  1YK7 A;  2FRQ A;  3K24 A;  2DC7 A;  1CQD A;  4OEM A;  1EWM A;  3KSE A;  2FE8 A;  1HUC B;  2AGA A;  4W5C A;  1CSB B;  1KFX L;  4XZX A;  3IFU A;  4A5U A;  2FUD A;  4QBB A;  2DC9 A;  2E01 A;  1EWO A;  4BOQ A;  1PVJ A;  2HXZ A;  1CVZ A;  2PNS A;  2NQD B;  2F7D A;  3H89 A;  4R3D A;  4QRV A;  2JQG R;  2PAD A;  2O6X A;  1GMY A;  4RF1 A;  2HHN A;  4DMX A;  3KW9 A;  3V6C A;  2DJF B;  1EWL A;  1MS6 A;  3PRM A;  2AUZ A;  3ZNH A;  1MHW A;  2R9O A;  1YAL A;  3IV2 A;  2G7Y A;  3IHP A;  1YZB A;  7PCK A;  1ICF A;  4YYS A;  1KHQ A;  5JA7 A;  4WUR A;  3D6S A;  2FRA A;  1PPN A;  3H8C A;  4CDE B;  4Q8H A;  1U5I A;  2DZY A;  2YJ8 A;  1AYW A;  3PNR A;  4OW0 A;  3KFQ A;  1QDQ A;  1AU2 A;  3CBK A;  2NQA A;  2WBF X;  2IBI A;  1AYU A;  1DF0 A;  2XU5 A;  3KWZ A;  3P5X A;  3MP2 A;  2Y5B A;  1JQP A;  4D8I A;  1YT7 A;  3O1G A;  4M0W A;  2YJC A;  3RVV A;  3S3Q A;  3B21 A;  4HWY A;  3HHI A;  2DJG B;  3OVX A;  1MEG A;  4OEL A;  2C0Y A;  3U8E A;  3KKU A;  2DZZ A;  3BC3 A;  3PHW A;  2AYN A;  1ZIV A;  3OF8 A;  3KWB X; 
#chains in the Genus database with same CATH homology
 4OVZ B;  3E9S A;  3MTV A;  4D8I A;  4RKX A;  2UZJ A;  2BTW A;  2Z84 A;  4RF1 A;  4WUR A;  4R3D A;  2JTC A;  4OW0 A;  5E6J A;  3PT2 A;  4M0W A;  4ZTB A;  5EZQ A;  2AGA A;  4BOS A;  2DOS A;  2BTW B;  2BU3 A;  2JRI A;  3TMP A;  4OVZ A;  3O65 A;  4D8B A;  3PRM A;  3B21 A;  4MM3 B;  3IFU A;  4XZX A;  4A5U A;  5EZS A;  3PHX A;  4PT5 A;  3ZNH A;  3BBA A;  4BOU A;  4P16 A;  3BY4 A;  4D8E A;  4REZ A;  5KO3 A;  4IUM A;  4RF0 A;  3RNV A;  3TRK A;  5JZE A;  3PSE A;  4GUA A;  4BOZ A;  2J7Q C;  1YZB A;  1UKF A;  4IP3 A;  4RNA A;  3PHU A;  3PRP A;  3W30 A;  3PHW A;  3MJ5 A;  3OQC A;  3W31 A;  1PVJ A;  4BOP A;  3C0R A;  4BOQ A;  4HXD B;  2HWK A;  2J7Q A;  1DKI A;  3BB7 A;  3MP2 A;  4MI7 A;  2FE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...