2J7QC

Crystal structure of the ubiquitin-specific protease encoded by murine cytomegalovirus tegument protein m48 in complex with a ubquitin-based suicide substrate
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
232
structure length
232
Chain Sequence
MKIVRASRDQSAPVYGPRAGSQCMSNCFTFLHTCYLMGIDPVLDTTSLDAVLDSGARLDAIADEKVKRQALTDHPYRLGTEIPTVIETPAGITGHALSRPFNGTAETQDLGGYKCLGILDFLTYARGKPLPVYIIVTVGVFTRGVIVARGATYVFDPHTTDLSAEAAVYVCDDFTEAISALSFFTEMIGDFYYDAVLVYFTRCRTTLISPSELLVQIMDQYKDPDIDASVMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords MCMV TEGUMENT PROTEIN M48 ENCODED UBIQUITIN- SPECIFIC PROTEA
publication title Structure of a Herpesvirus-Encoded Cysteine Protease Reveals a Unique Class of Deubiquitinating Enzymes
pubmed doi rcsb
source organism Murine cytomegalovirus
total genus 66
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2006-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.120 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2j7qC00
2J7QC 2J7QA
chains in the Genus database with same CATH superfamily
2E00A 4CDCB 1CJLA 3OVXA 2ACTA 1AYUA 1SP4B 3RNVA 2HH5A 4Q8HA 1U9QX 4MSXA 5EZSA 3LXSA 2FT2A 4P16A 2R9MA 4PT5A 3P5VA 2NQAA 3LFYA 4FK5A 4M0WA 4PADA 3E1ZB 3CH2X 4R3DA 4I04A 3V6CA 2JQFR 4BSQA 1Q6KA 4PP1A 1AU3A 1F29A 3KFQA 3PT2A 1AECA 3TMPA 2FYEA 3PSEA 4BS6A 4HXDB 1AYVA 3IV2A 1ME4A 2AU1A 4HWYA 1XKGA 3BBAA 3U8EA 2R6NA 3IHPA 2HHNA 1Y08A 2DC9A 3OF8A 3IUTA 3PBHA 4YV8A 3E9SA 4I07A 3W30A 5JH3A 1X9YA 1PE6A 3BCNA 4CDDB 3OQCA 4BOZA 1CTEA 1A6RA 1AYWA 3NHEA 1QXPA 3P5UA 3RVWA 4N8WA 1ITOA 2YJ2A 4BOPA 2IPPB 2AIMA 4WA6A 2FUDA 2VHSA 1MEMA 1YALA 4W5BA 2GFOA 1VJVA 1YK8A 2DCBA 4ZUXU 4OVZA 5EZQA 3USVA 1HUCB 2C0YA 3MHHA 1F2AA 4QRVA 3F75A 4OW0A 2XU4A 1U5IA 3PDFA 3OVZA 2Y5BA 1MHWA 3ZNHA 4W4UA 5CVNB 2HWKA 3KKUA 2BTWA 3K24A 2HD5A 3PNRA 3TNXA 3N3GA 3C9EA 1S4VA 1STFE 2YJCA 4REZA 4RKXA 2J7QC 5J94A 1KHQA 2Y6EA 3AI8A 2PNSA 1AIMA 4G54A 2E02A 4BPVA 4RF0A 2P7UA 4YYRA 4QRGA 1EF7A 3IEJA 2G8JA 3RVVA 3MJ5A 4PI3A 4KLBA 2DJFB 1KHPA 1PXVA 2AYOA 4YVAA 1PVJA 2R9CA 9PAPA 2ATOA 2AVWA 1VSNA 1NLJA 4D8EA 2IBIA 1IWDA 3WXGA 4XUIA 3QT4A 4OEMA 4RF1A 2UZJA 2R9OA 1PPPA 1Y4HA 2G8EA 1ZCMA 4D8IA 2JQGR 1ATKA 1NB3A 1DEUA 3BPMA 3M99A 4XZXA 4Q8GA 2J7QA 3CBJA 3QSDA 2XU3A 3IMAA 3MTNA 4AXLA 5EF4A 1ZIVA 4I05A 2FO5A 5CHVA 4YYUA 2G7YA 2YJ8A 4FIPA 2E03A 4OVZB 4YYSA 5A24A 1EWPA 3S3RA 2B1NA 3ZUAA 5K16A 2PREA 5FPWA 3RVXA 1CPJA 3TRKA 3N3KA 2PBHA 4A5UA 4CZWA 3MTVA 2BTWB 5EGWA 3GCBA 2XU5A 3CBKA 3PHUA 4FJCA 1BQIA 4MZOA 2JTCA 4W5CA 1BY8A 1BP4A 3BOWA 1TU6A 3BWKA 1DF0A 1DKIA 1NQCA 2CB5A 2DC6A 2G6DA 3F5VA 2YJ9A 3DF0A 4CDFB 1AU4A 1NL6A 3PRMA 5CVMA 4MI7A 2BDZA 3H89A 1CV8A 1QDQA 2FTDA 2ARYA 3P5WA 4P6GA 6PADA 2WBFX 2DJGB 3OF9A 4P6EA 3H6SA 2DC8A 1QOLA 3N4CA 4BQVA 4YYQA 1K3BB 3KSEA 2BU3A 3HHAA 4X6IA 7PCKA 3D6SA 5KO3A 4ZTBA 2VHFA 3BB7A 4YYVA 1NPZA 3B79A 1MIRA 1U9VA 4BOSA 1U9WA 2DCCA 2OULA 1PCIA 1THEA 4CDEB 1EWLA 2P0RA 3H8BA 3H7DA 1QMYA 4D8BA 2NQGA 1PPOA 3MHSA 2DCAA 2FE8A 3O65A 1PPDA 2B1MA 4GUAA 1MDWA 1YK7A 1ME3A 3O0UA 4YYWA 3P5XA 4IUMA 2FRAA 1KXRA 2CIOA 2FQ9A 2JRIA 1F2CA 3I3TA 1YZBA 1CVZA 1AU2A 1PBHA 1CQDA 4N4ZA 1AU0A 1UKFA 2HXZA 4QBBA 3MORA 4WURA 8PCHA 2R9NA 3WXFA 3PRPA 4RY2A 2O6XA 4XR7A 3PW3A 1BGOA 1F2BA 2F7DA 1GMYA 4AXMA 2DOSA 4BS5A 1CSBB 1YT7A 1CB5A 3H8CA 2FRQA 1EWMA 5F02A 1GECE 2AUZA 3BC3A 4MZSA 1PADA 3KWBX 1TL9A 2DCDA 3PHXA 2AS8A 3S3QA 4DMYA 1GLOA 2F1GA 3HWNA 4PP2E 3I06A 2PADA 2AGAA 3W31A 2P86A 1YVBA 2H7JA 2NQIA 3K9MA 2GHUA 2AYNA 3BPFA 3HHIA 3PHWA 2DC7A 1ICFA 3BY4A 3B21A 2OP3A 1TLOA 3OISA 2YJBA 2E01A 4IP3A 4QRXA 4BOQA 1GCBA 5JA7A 1FH0A 1EWOA 2DZZA 4MM3B 2Z84A 2AUXA 3O1GA 5PADA 3C0RA 2R9FA 1M6DA 4N79A 1PIPA 3KX1A 4DMXA 1KFXL 3CH3X 1MS6A 2NQDB 4BOUA 1CS8A 3WXEA 1MEGA 3IFUA 3IOQA 3V6EA 3ERVA 3KWZA 1NB5A 5CVOB 2OZ2A 1PPNA 3MP2A 1SNKA 4K7CA 4QH6A 2XU1A 5CHTA 3HD3A 5JZEA 3K8UA 4RNAA 4X6HA 1O0EA 3KW9A 4OELA 1POPA 2DZYA 1JQPA 1KFUL 3QJ3A 4X6JA 1U9XA 5E6JA 2BDLA
chains in the Genus database with same CATH topology
2DOSA 2JTCA 4REZA 4RKXA 2J7QC 3RNVA 5EZSA 1DKIA 4P16A 4PT5A 4M0WA 3PHXA 4R3DA 4RF0A 3PRMA 4MI7A 3PT2A 3MJ5A 3TMPA 3PSEA 4HXDB 2AGAA 3W31A 1PVJA 3BBAA 3PHWA 3BY4A 3B21A 4D8EA 2BU3A 4IP3A 3E9SA 5KO3A 3W30A 4ZTBA 4BOQA 3BB7A 4RF1A 2UZJA 4BOSA 4MM3B 3OQCA 4BOZA 2Z84A 4D8IA 3C0RA 4BOPA 4D8BA 4XZXA 2J7QA 4BOUA 2FE8A 3O65A 4GUAA 3IFUA 4IUMA 4OVZB 2JRIA 3MP2A 4OVZA 5EZQA 1YZBA 4OW0A 5JZEA 4RNAA 3TRKA 1UKFA 4A5UA 4WURA 3ZNHA 3MTVA 2HWKA 2BTWB 3PRPA 2BTWA 3PHUA 5E6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J7Q C;  2J7Q A; 
#chains in the Genus database with same CATH topology
 2E00 A;  4CDC B;  1CJL A;  3OVX A;  2ACT A;  1AYU A;  1SP4 B;  3RNV A;  2HH5 A;  4Q8H A;  1U9Q X;  4MSX A;  5EZS A;  3LXS A;  2FT2 A;  4P16 A;  2R9M A;  4PT5 A;  3P5V A;  2NQA A;  3LFY A;  4FK5 A;  4M0W A;  4PAD A;  3E1Z B;  3CH2 X;  4R3D A;  4I04 A;  3V6C A;  2JQF R;  4BSQ A;  1Q6K A;  4PP1 A;  1AU3 A;  1F29 A;  3KFQ A;  3PT2 A;  1AEC A;  3TMP A;  2FYE A;  3PSE A;  4BS6 A;  4HXD B;  1AYV A;  3IV2 A;  1ME4 A;  2AU1 A;  4HWY A;  1XKG A;  3BBA A;  3U8E A;  2R6N A;  3IHP A;  2HHN A;  1Y08 A;  2DC9 A;  3OF8 A;  3IUT A;  3PBH A;  4YV8 A;  3E9S A;  4I07 A;  3W30 A;  5JH3 A;  1X9Y A;  1PE6 A;  3BCN A;  4CDD B;  3OQC A;  4BOZ A;  1CTE A;  1A6R A;  1AYW A;  3NHE A;  1QXP A;  3P5U A;  3RVW A;  4N8W A;  1ITO A;  2YJ2 A;  4BOP A;  2IPP B;  2AIM A;  4WA6 A;  2FUD A;  2VHS A;  1MEM A;  1YAL A;  4W5B A;  2GFO A;  1VJV A;  1YK8 A;  2DCB A;  4ZUX U;  4OVZ A;  5EZQ A;  3USV A;  1HUC B;  2C0Y A;  3MHH A;  1F2A A;  4QRV A;  3F75 A;  4OW0 A;  2XU4 A;  1U5I A;  3PDF A;  3OVZ A;  2Y5B A;  1MHW A;  3ZNH A;  4W4U A;  5CVN B;  2HWK A;  3KKU A;  2BTW A;  3K24 A;  2HD5 A;  3PNR A;  3TNX A;  3N3G A;  3C9E A;  1S4V A;  1STF E;  2YJC A;  4REZ A;  4RKX A;  2J7Q C;  5J94 A;  1KHQ A;  2Y6E A;  3AI8 A;  2PNS A;  1AIM A;  4G54 A;  2E02 A;  4BPV A;  4RF0 A;  2P7U A;  4YYR A;  4QRG A;  1EF7 A;  3IEJ A;  2G8J A;  3RVV A;  3MJ5 A;  4PI3 A;  4KLB A;  2DJF B;  1KHP A;  1PXV A;  2AYO A;  4YVA A;  1PVJ A;  2R9C A;  9PAP A;  2ATO A;  2AVW A;  1VSN A;  1NLJ A;  4D8E A;  2IBI A;  1IWD A;  3WXG A;  4XUI A;  3QT4 A;  4OEM A;  4RF1 A;  2UZJ A;  2R9O A;  1PPP A;  1Y4H A;  2G8E A;  1ZCM A;  4D8I A;  2JQG R;  1ATK A;  1NB3 A;  1DEU A;  3BPM A;  3M99 A;  4XZX A;  4Q8G A;  2J7Q A;  3CBJ A;  3QSD A;  2XU3 A;  3IMA A;  3MTN A;  4AXL A;  5EF4 A;  1ZIV A;  4I05 A;  2FO5 A;  5CHV A;  4YYU A;  2G7Y A;  2YJ8 A;  4FIP A;  2E03 A;  4OVZ B;  4YYS A;  5A24 A;  1EWP A;  3S3R A;  2B1N A;  3ZUA A;  5K16 A;  2PRE A;  5FPW A;  3RVX A;  1CPJ A;  3TRK A;  3N3K A;  2PBH A;  4A5U A;  4CZW A;  3MTV A;  2BTW B;  5EGW A;  3GCB A;  2XU5 A;  3CBK A;  3PHU A;  4FJC A;  1BQI A;  4MZO A;  2JTC A;  4W5C A;  1BY8 A;  1BP4 A;  3BOW A;  1TU6 A;  3BWK A;  1DF0 A;  1DKI A;  1NQC A;  2CB5 A;  2DC6 A;  2G6D A;  3F5V A;  2YJ9 A;  3DF0 A;  4CDF B;  1AU4 A;  1NL6 A;  3PRM A;  5CVM A;  4MI7 A;  2BDZ A;  3H89 A;  1CV8 A;  1QDQ A;  2FTD A;  2ARY A;  3P5W A;  4P6G A;  6PAD A;  2WBF X;  2DJG B;  3OF9 A;  4P6E A;  3H6S A;  2DC8 A;  1QOL A;  3N4C A;  4BQV A;  4YYQ A;  1K3B B;  3KSE A;  2BU3 A;  3HHA A;  4X6I A;  7PCK A;  3D6S A;  5KO3 A;  4ZTB A;  2VHF A;  3BB7 A;  4YYV A;  1NPZ A;  3B79 A;  1MIR A;  1U9V A;  4BOS A;  1U9W A;  2DCC A;  2OUL A;  1PCI A;  1THE A;  4CDE B;  1EWL A;  2P0R A;  3H8B A;  3H7D A;  1QMY A;  4D8B A;  2NQG A;  1PPO A;  3MHS A;  2DCA A;  2FE8 A;  3O65 A;  1PPD A;  2B1M A;  4GUA A;  1MDW A;  1YK7 A;  1ME3 A;  3O0U A;  4YYW A;  3P5X A;  4IUM A;  2FRA A;  1KXR A;  2CIO A;  2FQ9 A;  2JRI A;  1F2C A;  3I3T A;  1YZB A;  1CVZ A;  1AU2 A;  1PBH A;  1CQD A;  4N4Z A;  1AU0 A;  1UKF A;  2HXZ A;  4QBB A;  3MOR A;  4WUR A;  8PCH A;  2R9N A;  3WXF A;  3PRP A;  4RY2 A;  2O6X A;  4XR7 A;  3PW3 A;  1BGO A;  1F2B A;  2F7D A;  1GMY A;  4AXM A;  2DOS A;  4BS5 A;  1CSB B;  1YT7 A;  1CB5 A;  3H8C A;  2FRQ A;  1EWM A;  5F02 A;  1GEC E;  2AUZ A;  3BC3 A;  4MZS A;  1PAD A;  3KWB X;  1TL9 A;  2DCD A;  3PHX A;  2AS8 A;  3S3Q A;  4DMY A;  1GLO A;  2F1G A;  3HWN A;  4PP2 E;  3I06 A;  2PAD A;  2AGA A;  3W31 A;  2P86 A;  1YVB A;  2H7J A;  2NQI A;  3K9M A;  2GHU A;  2AYN A;  3BPF A;  3HHI A;  3PHW A;  2DC7 A;  1ICF A;  3BY4 A;  3B21 A;  2OP3 A;  1TLO A;  3OIS A;  2YJB A;  2E01 A;  4IP3 A;  4QRX A;  4BOQ A;  1GCB A;  5JA7 A;  1FH0 A;  1EWO A;  2DZZ A;  4MM3 B;  2Z84 A;  2AUX A;  3O1G A;  5PAD A;  3C0R A;  2R9F A;  1M6D A;  4N79 A;  1PIP A;  3KX1 A;  4DMX A;  1KFX L;  3CH3 X;  1MS6 A;  2NQD B;  4BOU A;  1CS8 A;  3WXE A;  1MEG A;  3IFU A;  3IOQ A;  3V6E A;  3ERV A;  3KWZ A;  1NB5 A;  5CVO B;  2OZ2 A;  1PPN A;  3MP2 A;  1SNK A;  4K7C A;  4QH6 A;  2XU1 A;  5CHT A;  3HD3 A;  5JZE A;  3K8U A;  4RNA A;  4X6H A;  1O0E A;  3KW9 A;  4OEL A;  1POP A;  2DZY A;  1JQP A;  1KFU L;  3QJ3 A;  4X6J A;  1U9X A;  5E6J A;  2BDL A; 
#chains in the Genus database with same CATH homology
 2DOS A;  2JTC A;  4REZ A;  4RKX A;  2J7Q C;  3RNV A;  5EZS A;  1DKI A;  4P16 A;  4PT5 A;  4M0W A;  3PHX A;  4R3D A;  4RF0 A;  3PRM A;  4MI7 A;  3PT2 A;  3MJ5 A;  3TMP A;  3PSE A;  4HXD B;  2AGA A;  3W31 A;  1PVJ A;  3BBA A;  3PHW A;  3BY4 A;  3B21 A;  4D8E A;  2BU3 A;  4IP3 A;  3E9S A;  5KO3 A;  3W30 A;  4ZTB A;  4BOQ A;  3BB7 A;  4RF1 A;  2UZJ A;  4BOS A;  4MM3 B;  3OQC A;  4BOZ A;  2Z84 A;  4D8I A;  3C0R A;  4BOP A;  4D8B A;  4XZX A;  2J7Q A;  4BOU A;  2FE8 A;  3O65 A;  4GUA A;  3IFU A;  4IUM A;  4OVZ B;  2JRI A;  3MP2 A;  4OVZ A;  5EZQ A;  1YZB A;  4OW0 A;  5JZE A;  4RNA A;  3TRK A;  1UKF A;  4A5U A;  4WUR A;  3ZNH A;  3MTV A;  2HWK A;  2BTW B;  3PRP A;  2BTW A;  3PHU A;  5E6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...