2J7QC

Crystal structure of the ubiquitin-specific protease encoded by murine cytomegalovirus tegument protein m48 in complex with a ubquitin-based suicide substrate
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
232
structure length
232
Chain Sequence
MKIVRASRDQSAPVYGPRAGSQCMSNCFTFLHTCYLMGIDPVLDTTSLDAVLDSGARLDAIADEKVKRQALTDHPYRLGTEIPTVIETPAGITGHALSRPFNGTAETQDLGGYKCLGILDFLTYARGKPLPVYIIVTVGVFTRGVIVARGATYVFDPHTTDLSAEAAVYVCDDFTEAISALSFFTEMIGDFYYDAVLVYFTRCRTTLISPSELLVQIMDQYKDPDIDASVMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MCMV TEGUMENT PROTEIN M48 ENCODED UBIQUITIN- SPECIFIC PROTEA
publication title Structure of a Herpesvirus-Encoded Cysteine Protease Reveals a Unique Class of Deubiquitinating Enzymes
pubmed doi rcsb
source organism Murine cytomegalovirus
molecule tags Hydrolase
total genus 66
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2006-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.120 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2j7qC00
2J7QC 2J7QA
chains in the Genus database with same CATH superfamily
1BGOA 4HWYA 4PI3A 3WXFA 4RKXA 4RY2A 6PADA 3KW9A 4N79A 4RNAA 1ATKA 1PCIA 3MJ5A 2YJ8A 4X6HA 5CVOB 5FPWA 2BU3A 3B79A 3QT4A 2CIOA 4RF1A 4BS6A 2OULA 2ARYA 1THEA 2P7UA 3MTVA 1KXRA 4KLBA 3PT2A 5CVNB 1XKGA 4DMXA 3GCBA 1KFXL 3QSDA 2FTDA 2FUDA 1QOLA 1AU3A 2DZYA 2DCDA 3K24A 3W30A 1YZBA 1CV8A 3HD3A 1NQCA 2AUXA 1DKIA 4YYVA 2XU1A 1POPA 1AU4A 4OEMA 5CHVA 2AYOA 2OP3A 2R9MA 2PREA 2OZ2A 4I05A 2DJFB 1Y08A 4MM3B 2E01A 1U5IA 3PDFA 1MDWA 4PP1A 2P86A 3IEJA 2DCCA 2XU5A 3U8EA 1CJLA 4N8WA 2AGAA 1F2BA 4OW0A 1O0EA 4W5CA 1JQPA 3ZNHA 1CB5A 4BOQA 2G6DA 4D8IA 4BPVA 1VSNA 1CS8A 1BP4A 4CDFB 3WXEA 3TNXA 3H7DA 4BOZA 4QBBA 4YYWA 3KFQA 3N4CA 2FT2A 3BPFA 4MZOA 4Q8HA 3OVZA 2AYNA 1YVBA 1PE6A 4ZTBA 7PCKA 4P6EA 2DCBA 2BDLA 3IV2A 4A5UA 3OVXA 4BS5A 4BSQA 1ICFA 1U9QX 3MTNA 2R9CA 2J7QC 2BDZA 2UZJA 3BOWA 3H89A 1PXVA 1TL9A 4I07A 5JH3A 1PVJA 4QRGA 3V6EA 3OF8A 4CDEB 3KWZA 3IHPA 4XR7A 4HXDB 1STFE 4Q8GA 1YK7A 2HXZA 4IUMA 4WURA 3P5UA 3OISA 1PPPA 3BCNA 4YYSA 3BPMA 2E02A 2HH5A 1NLJA 3BB7A 3O1GA 1PBHA 3E9SA 5KO3A 3OQCA 4R3DA 4REZA 3ERVA 3OF9A 3O65A 4AXLA 1QMYA 4X6IA 2AUZA 1AYWA 4G54A 3LXSA 3BY4A 2NQDB 3H6SA 3MHSA 1K3BB 1EWLA 1A6RA 3BC3A 3S3RA 2Y5BA 2PNSA 4WA6A 3MORA 2HWKA 4X6JA 3CBKA 1AYVA 2DC6A 4BOPA 3PHUA 1AU2A 3KKUA 4BQVA 3USVA 5EZSA 2NQGA 3PNRA 2G8EA 1FH0A 1MHWA 3RVXA 2Y6EA 4MZSA 4ZUXU 1BY8A 1NPZA 1CQDA 1EWPA 1S4VA 3I06A 2DCAA 2E03A 3ZUAA 3BBAA 2CB5A 2E00A 5CHTA 3QJ3A 3D6SA 3IUTA 1PIPA 2AIMA 4PADA 3DF0A 2Z84A 3PW3A 2FE8A 3RNVA 5EF4A 5E6JA 4YYRA 1ZIVA 2AU1A 3H8BA 3P5XA 1U9VA 2AVWA 1ITOA 3RVWA 4QRXA 1DF0A 4QRVA 1KHQA 4CDCB 2DC8A 3N3KA 3I3TA 1NB3A 1TU6A 1YALA 2B1MA 1UKFA 1EF7A 5EGWA 2VHSA 2BTWA 3TMPA 1M6DA 2IBIA 2DC9A 3F75A 1F2AA 1ME3A 4I04A 2JTCA 2DZZA 4OVZB 2ATOA 1KHPA 4K7CA 3BWKA 4FIPA 5EZQA 9PAPA 4AXMA 3W31A 2HD5A 1X9YA 3S3QA 3K8UA 3CBJA 3IFUA 1CVZA 3PHXA 3P5WA 1PADA 3KWBX 4GUAA 1PPDA 3IOQA 4M0WA 1F29A 4YYQA 3M99A 1CTEA 1YK8A 1U9XA 1MIRA 2P0RA 3HHIA 4PP2E 2BTWB 8PCHA 2HHNA 2FRQA 3PRPA 2FQ9A 2VHFA 5K16A 4BOUA 3CH3X 2YJ9A 1NL6A 2XU4A 1YT7A 2XU3A 1AIMA 1CSBB 1ME4A 2B1NA 2AS8A 4CDDB 2GFOA 3NHEA 4BOSA 3IMAA 4FK5A 3HHAA 1NB5A 5CVMA 4CZWA 3C9EA 1U9WA 3KX1A 2ACTA 2J7QA 4FJCA 2DJGB 5F02A 2H7JA 2DC7A 2JRIA 1Y4HA 1ZCMA 3CH2X 1IWDA 1AU0A 2DOSA 1QXPA 3LFYA 2FO5A 1BQIA 1HUCB 2R9NA 1TLOA 2NQAA 4P16A 2JQGR 2FYEA 4PT5A 4W4UA 4MSXA 1GCBA 3PHWA 3N3GA 1PPOA 2C0YA 4OVZA 5PADA 1GMYA 4YV8A 3HWNA 3RVVA 5J94A 3KSEA 4OELA 2O6XA 4W5BA 3P5VA 2FRAA 1MEGA 1EWMA 4YYUA 1GLOA 3B21A 2WBFX 3AI8A 2G7YA 2YJ2A 4XZXA 3MP2A 3MHHA 4P6GA 2PADA 5JA7A 3C0RA 2R6NA 1PPNA 2GHUA 2F1GA 4D8EA 2NQIA 4DMYA 4XUIA 1EWOA 2JQFR 1SP4B 4MI7A 4QH6A 3H8CA 2F7DA 1VJVA 2R9FA 4RF0A 3WXGA 1KFUL 1AECA 1Q6KA 1DEUA 1F2CA 3PSEA 4YVAA 5JZEA 1SNKA 4N4ZA 1QDQA 4IP3A 5A24A 1MEMA 1CPJA 3E1ZB 2R9OA 1AYUA 3PBHA 3V6CA 3F5VA 3O0UA 1GECE 3TRKA 4D8BA 1MS6A 2YJBA 2IPPB 2PBHA 2YJCA 3K9MA 3PRMA 2G8JA
chains in the Genus database with same CATH topology
2FE8A 3RNVA 2J7QC 5E6JA 2UZJA 2JRIA 4RKXA 4RNAA 1PVJA 3MJ5A 2DOSA 2BU3A 4RF1A 4HXDB 4IUMA 4WURA 3MTVA 4P16A 4PT5A 1UKFA 3PT2A 3PHWA 2BTWA 3TMPA 4OVZA 3BB7A 3W30A 1YZBA 3E9SA 5KO3A 3OQCA 2JTCA 4R3DA 4REZA 1DKIA 3O65A 4OVZB 3B21A 5EZQA 3W31A 4XZXA 3BY4A 3MP2A 4MM3B 3IFUA 3C0RA 3PHXA 4GUAA 4M0WA 2HWKA 4D8EA 2AGAA 4MI7A 2BTWB 4OW0A 3PRPA 4RF0A 4BOPA 3ZNHA 3PHUA 4BOQA 4D8IA 4BOUA 5EZSA 3PSEA 5JZEA 4BOZA 4IP3A 4BOSA 3BBAA 4ZTBA 3TRKA 4D8BA 4A5UA 3PRMA 2Z84A 2J7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J7Q C;  2J7Q A; 
#chains in the Genus database with same CATH topology
 1BGO A;  4HWY A;  4PI3 A;  3WXF A;  4RKX A;  4RY2 A;  6PAD A;  3KW9 A;  4N79 A;  4RNA A;  1ATK A;  1PCI A;  3MJ5 A;  2YJ8 A;  4X6H A;  5CVO B;  5FPW A;  2BU3 A;  3B79 A;  3QT4 A;  2CIO A;  4RF1 A;  4BS6 A;  2OUL A;  2ARY A;  1THE A;  2P7U A;  3MTV A;  1KXR A;  4KLB A;  3PT2 A;  5CVN B;  1XKG A;  4DMX A;  3GCB A;  1KFX L;  3QSD A;  2FTD A;  2FUD A;  1QOL A;  1AU3 A;  2DZY A;  2DCD A;  3K24 A;  3W30 A;  1YZB A;  1CV8 A;  3HD3 A;  1NQC A;  2AUX A;  1DKI A;  4YYV A;  2XU1 A;  1POP A;  1AU4 A;  4OEM A;  5CHV A;  2AYO A;  2OP3 A;  2R9M A;  2PRE A;  2OZ2 A;  4I05 A;  2DJF B;  1Y08 A;  4MM3 B;  2E01 A;  1U5I A;  3PDF A;  1MDW A;  4PP1 A;  2P86 A;  3IEJ A;  2DCC A;  2XU5 A;  3U8E A;  1CJL A;  4N8W A;  2AGA A;  1F2B A;  4OW0 A;  1O0E A;  4W5C A;  1JQP A;  3ZNH A;  1CB5 A;  4BOQ A;  2G6D A;  4D8I A;  4BPV A;  1VSN A;  1CS8 A;  1BP4 A;  4CDF B;  3WXE A;  3TNX A;  3H7D A;  4BOZ A;  4QBB A;  4YYW A;  3KFQ A;  3N4C A;  2FT2 A;  3BPF A;  4MZO A;  4Q8H A;  3OVZ A;  2AYN A;  1YVB A;  1PE6 A;  4ZTB A;  7PCK A;  4P6E A;  2DCB A;  2BDL A;  3IV2 A;  4A5U A;  3OVX A;  4BS5 A;  4BSQ A;  1ICF A;  1U9Q X;  3MTN A;  2R9C A;  2J7Q C;  2BDZ A;  2UZJ A;  3BOW A;  3H89 A;  1PXV A;  1TL9 A;  4I07 A;  5JH3 A;  1PVJ A;  4QRG A;  3V6E A;  3OF8 A;  4CDE B;  3KWZ A;  3IHP A;  4XR7 A;  4HXD B;  1STF E;  4Q8G A;  1YK7 A;  2HXZ A;  4IUM A;  4WUR A;  3P5U A;  3OIS A;  1PPP A;  3BCN A;  4YYS A;  3BPM A;  2E02 A;  2HH5 A;  1NLJ A;  3BB7 A;  3O1G A;  1PBH A;  3E9S A;  5KO3 A;  3OQC A;  4R3D A;  4REZ A;  3ERV A;  3OF9 A;  3O65 A;  4AXL A;  1QMY A;  4X6I A;  2AUZ A;  1AYW A;  4G54 A;  3LXS A;  3BY4 A;  2NQD B;  3H6S A;  3MHS A;  1K3B B;  1EWL A;  1A6R A;  3BC3 A;  3S3R A;  2Y5B A;  2PNS A;  4WA6 A;  3MOR A;  2HWK A;  4X6J A;  3CBK A;  1AYV A;  2DC6 A;  4BOP A;  3PHU A;  1AU2 A;  3KKU A;  4BQV A;  3USV A;  5EZS A;  2NQG A;  3PNR A;  2G8E A;  1FH0 A;  1MHW A;  3RVX A;  2Y6E A;  4MZS A;  4ZUX U;  1BY8 A;  1NPZ A;  1CQD A;  1EWP A;  1S4V A;  3I06 A;  2DCA A;  2E03 A;  3ZUA A;  3BBA A;  2CB5 A;  2E00 A;  5CHT A;  3QJ3 A;  3D6S A;  3IUT A;  1PIP A;  2AIM A;  4PAD A;  3DF0 A;  2Z84 A;  3PW3 A;  2FE8 A;  3RNV A;  5EF4 A;  5E6J A;  4YYR A;  1ZIV A;  2AU1 A;  3H8B A;  3P5X A;  1U9V A;  2AVW A;  1ITO A;  3RVW A;  4QRX A;  1DF0 A;  4QRV A;  1KHQ A;  4CDC B;  2DC8 A;  3N3K A;  3I3T A;  1NB3 A;  1TU6 A;  1YAL A;  2B1M A;  1UKF A;  1EF7 A;  5EGW A;  2VHS A;  2BTW A;  3TMP A;  1M6D A;  2IBI A;  2DC9 A;  3F75 A;  1F2A A;  1ME3 A;  4I04 A;  2JTC A;  2DZZ A;  4OVZ B;  2ATO A;  1KHP A;  4K7C A;  3BWK A;  4FIP A;  5EZQ A;  9PAP A;  4AXM A;  3W31 A;  2HD5 A;  1X9Y A;  3S3Q A;  3K8U A;  3CBJ A;  3IFU A;  1CVZ A;  3PHX A;  3P5W A;  1PAD A;  3KWB X;  4GUA A;  1PPD A;  3IOQ A;  4M0W A;  1F29 A;  4YYQ A;  3M99 A;  1CTE A;  1YK8 A;  1U9X A;  1MIR A;  2P0R A;  3HHI A;  4PP2 E;  2BTW B;  8PCH A;  2HHN A;  2FRQ A;  3PRP A;  2FQ9 A;  2VHF A;  5K16 A;  4BOU A;  3CH3 X;  2YJ9 A;  1NL6 A;  2XU4 A;  1YT7 A;  2XU3 A;  1AIM A;  1CSB B;  1ME4 A;  2B1N A;  2AS8 A;  4CDD B;  2GFO A;  3NHE A;  4BOS A;  3IMA A;  4FK5 A;  3HHA A;  1NB5 A;  5CVM A;  4CZW A;  3C9E A;  1U9W A;  3KX1 A;  2ACT A;  2J7Q A;  4FJC A;  2DJG B;  5F02 A;  2H7J A;  2DC7 A;  2JRI A;  1Y4H A;  1ZCM A;  3CH2 X;  1IWD A;  1AU0 A;  2DOS A;  1QXP A;  3LFY A;  2FO5 A;  1BQI A;  1HUC B;  2R9N A;  1TLO A;  2NQA A;  4P16 A;  2JQG R;  2FYE A;  4PT5 A;  4W4U A;  4MSX A;  1GCB A;  3PHW A;  3N3G A;  1PPO A;  2C0Y A;  4OVZ A;  5PAD A;  1GMY A;  4YV8 A;  3HWN A;  3RVV A;  5J94 A;  3KSE A;  4OEL A;  2O6X A;  4W5B A;  3P5V A;  2FRA A;  1MEG A;  1EWM A;  4YYU A;  1GLO A;  3B21 A;  2WBF X;  3AI8 A;  2G7Y A;  2YJ2 A;  4XZX A;  3MP2 A;  3MHH A;  4P6G A;  2PAD A;  5JA7 A;  3C0R A;  2R6N A;  1PPN A;  2GHU A;  2F1G A;  4D8E A;  2NQI A;  4DMY A;  4XUI A;  1EWO A;  2JQF R;  1SP4 B;  4MI7 A;  4QH6 A;  3H8C A;  2F7D A;  1VJV A;  2R9F A;  4RF0 A;  3WXG A;  1KFU L;  1AEC A;  1Q6K A;  1DEU A;  1F2C A;  3PSE A;  4YVA A;  5JZE A;  1SNK A;  4N4Z A;  1QDQ A;  4IP3 A;  5A24 A;  1MEM A;  1CPJ A;  3E1Z B;  2R9O A;  1AYU A;  3PBH A;  3V6C A;  3F5V A;  3O0U A;  1GEC E;  3TRK A;  4D8B A;  1MS6 A;  2YJB A;  2IPP B;  2PBH A;  2YJC A;  3K9M A;  3PRM A;  2G8J A; 
#chains in the Genus database with same CATH homology
 2FE8 A;  3RNV A;  2J7Q C;  5E6J A;  2UZJ A;  2JRI A;  4RKX A;  4RNA A;  1PVJ A;  3MJ5 A;  2DOS A;  2BU3 A;  4RF1 A;  4HXD B;  4IUM A;  4WUR A;  3MTV A;  4P16 A;  4PT5 A;  1UKF A;  3PT2 A;  3PHW A;  2BTW A;  3TMP A;  4OVZ A;  3BB7 A;  3W30 A;  1YZB A;  3E9S A;  5KO3 A;  3OQC A;  2JTC A;  4R3D A;  4REZ A;  1DKI A;  3O65 A;  4OVZ B;  3B21 A;  5EZQ A;  3W31 A;  4XZX A;  3BY4 A;  3MP2 A;  4MM3 B;  3IFU A;  3C0R A;  3PHX A;  4GUA A;  4M0W A;  2HWK A;  4D8E A;  2AGA A;  4MI7 A;  2BTW B;  4OW0 A;  3PRP A;  4RF0 A;  4BOP A;  3ZNH A;  3PHU A;  4BOQ A;  4D8I A;  4BOU A;  5EZS A;  3PSE A;  5JZE A;  4BOZ A;  4IP3 A;  4BOS A;  3BBA A;  4ZTB A;  3TRK A;  4D8B A;  4A5U A;  3PRM A;  2Z84 A;  2J7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...