1NB3A

Crystal structure of stefin a in complex with cathepsin h: n-terminal residues of inhibitors can adapt to the active sites of endo-and exopeptidases
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
220
structure length
220
Chain Sequence
b'YPPSMDWRKKGNFVSPVKNQGSCGSCWTFSTTGALESAVAIATGKMLSLAEQQLVDCAQNFNNHGCQGGLPSQAFEYIRYNKGIMGEDTYPYKGQDDHCKFQPDKAIAFVKDVANITMNDEEAMVEAVALYNPVSFAFEVTNDFLMYRKGIYSSTSCHKTPDKVNHAVLAVGYGEENGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAACASYPIPLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin H
molecule tags Hydrolase
source organism Homo sapiens
publication title Crystal structure of stefin A in complex with cathepsin H: N-terminal residues of inhibitors can adapt to the active sites of endo- and exopeptidases
pubmed doi rcsb
total genus 57
structure length 220
sequence length 220
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.16: Cathepsin H.
pdb deposition date 2002-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1nb3A00
3BCNA 3PNRA 5CVOB 3MTNA 4YYRA 3OVZA 1GMYA 2DC8A 5EGWA 3O1GA 5CVNB 4W5CA 1ZCMA 3MHSA 1JQPA 3IEJA 3KKUA 1AIMA 4CDDB 1POPA 3K9MA 1VJVA 2DJFB 3PBHA 1MDWA 1TLOA 2OP3A 1KHPA 1CS8A 2CIOA 1AECA 3P5WA 2E00A 1QDQA 3BC3A 1O0EA 3LFYA 2P7UA 2DC9A 2BDLA 4OELA 1AU0A 1STFE 1MS6A 1CPJA 2C0YA 1MEGA 1THEA 3N4CA 3KX1A 1CSBB 3E1ZB 4BSQA 1NB5A 1FH0A 2YJBA 1F2CA 3CBJA 3N3GA 1ME4A 1PE6A 3BPFA 2FRAA 2IBIA 3OVXA 4YYUA 1QXPA 2DJGB 2R9FA 2HHNA 4BS5A 3BPMA 3CH2X 1A6RA 4P6GA 1F2BA 1EWOA 1YALA 4FIPA 1Y4HA 2H7JA 1S4VA 2R9CA 1CQDA 1SNKA 5FPWA 1ATKA 3QSDA 2F1GA 4X6JA 1VSNA 2ARYA 2PBHA 1MHWA 2HH5A 4WA6A 1U9XA 3CBKA 2B1NA 2AVWA 2GHUA 4HWYA 4X6IA 3H8BA 4W5BA 1YVBA 1NPZA 2YJ8A 2OULA 4BPVA 1Q6KA 2DCAA 3H89A 3GCBA 3IOQA 1U9VA 3KWBX 1EWLA 3OF9A 4YYSA 1BY8A 1EWMA 3HHIA 3V6CA 4CZWA 4QBBA 5J94A 4BS6A 3QJ3A 3B79A 4KLBA 1U9QX 1QMYA 9PAPA 3IMAA 2IPPB 4YYVA 3K8UA 2DCBA 1PPNA 3IHPA 2AS8A 3OF8A 4K7CA 3HD3A 1EWPA 3P5UA 5JH3A 3TNXA 2FQ9A 1IWDA 4DMXA 2FO5A 3WXGA 4RY2A 2DC7A 1GECE 1PBHA 1PPPA 1NL6A 1NLJA 4YVAA 4CDCB 1F29A 2FUDA 2R9OA 3PDFA 3RVWA 1X9YA 4OEMA 2GFOA 1AU2A 5K16A 4ZUXU 4YYWA 3BOWA 1MEMA 4PI3A 1ME3A 3KSEA 1CVZA 2E02A 1BQIA 4QH6A 1MIRA 3CH3X 3RVXA 2PNSA 3C9EA 2FT2A 4PP2E 2ACTA 4XUIA 4AXLA 4N4ZA 2E01A 2NQGA 5F02A 2O6XA 4QRXA 2NQDB 3KWZA 4FK5A 1TU6A 1AU3A 2ATOA 2YJ9A 3ERVA 1KHQA 4BQVA 2AYOA 1PPDA 3D6SA 2VHSA 2G7YA 4X6HA 4I04A 4N8WA 4DMYA 2AYNA 1CV8A 1PXVA 3IV2A 2NQAA 2FTDA 1AU4A 1KFXL 3USVA 3PW3A 1M6DA 2G8EA 4XR7A 1AYWA 3U8EA 1HUCB 1SP4B 2XU3A 1AYVA 1PCIA 3P5XA 3WXEA 1U5IA 2AUXA 3K24A 2PADA 5CHVA 3AI8A 1NQCA 1BGOA 1YT7A 2JQGR 1F2AA 2XU5A 1U9WA 2PREA 4P6EA 4MZOA 1QOLA 2WBFX 2P0RA 1TL9A 1CJLA 3N3KA 3LXSA 3F5VA 3V6EA 1NB3A 2R9NA 4N79A 4QRVA 4AXMA 2R9MA 4CDFB 2P86A 2AU1A 3MHHA 4I05A 3IUTA 2DC6A 1GLOA 1AYUA 2VHFA 1CB5A 3I06A 2R6NA 1DEUA 2BDZA 2F7DA 2CB5A 1PADA 3I3TA 1KFUL 2DCCA 3RVVA 2XU4A 3ZUAA 5JA7A 1ZIVA 2HD5A 3H7DA 2FRQA 2AUZA 1BP4A 2YJCA 1PIPA 1GCBA 1Y08A 3S3QA 3NHEA 2YJ2A 1ICFA 3H6SA 3S3RA 6PADA 4PADA 1KXRA 1XKGA 4MZSA 1YK7A 3BWKA 5EF4A 4G54A 1PPOA 3WXFA 3O0UA 3H8CA 4Q8GA 3DF0A 2G8JA 3KW9A 2FYEA 1YK8A 2G6DA 2JQFR 1K3BB 5A24A 2DCDA 3M99A 4PP1A 2Y6EA 2DZZA 2AIMA 5CVMA 3QT4A 2XU1A 1CTEA 2OZ2A 2DZYA 2E03A 4Q8HA 2NQIA 3HWNA 4YYQA 7PCKA 3HHAA 5CHTA 4MSXA 4FJCA 3KFQA 2Y5BA 2B1MA 3MORA 3P5VA 5PADA 4CDEB 1DF0A 3OISA 4I07A 4YV8A 8PCHA 4QRGA 2HXZA 1ITOA 4W4UA 1EF7A 3F75A
chains in the Genus database with same CATH superfamily
3BCNA 3PNRA 5CVOB 4HXDB 3MTNA 4YYRA 3OVZA 1GMYA 2DC8A 5EGWA 3O1GA 5CVNB 4GUAA 4W5CA 1ZCMA 3MHSA 1JQPA 3IEJA 3KKUA 1AIMA 4CDDB 1POPA 3K9MA 1VJVA 2DJFB 3PBHA 1MDWA 1TLOA 2OP3A 1KHPA 1CS8A 2CIOA 3BBAA 1AECA 3P5WA 4BOUA 2E00A 1QDQA 3BC3A 1O0EA 3LFYA 2P7UA 2DC9A 2BDLA 4OELA 1AU0A 1STFE 1MS6A 1CPJA 2C0YA 1MEGA 1THEA 3PRPA 3N4CA 3KX1A 1CSBB 3PHXA 3E1ZB 4BSQA 1NB5A 1FH0A 2YJBA 4D8EA 1F2CA 3CBJA 3N3GA 2HWKA 1ME4A 3RNVA 1PE6A 4A5UA 3BPFA 2FRAA 2IBIA 3OVXA 4YYUA 1QXPA 2DJGB 2R9FA 4D8BA 2HHNA 4BS5A 3BPMA 3CH2X 1A6RA 4P6GA 1F2BA 1EWOA 1YALA 4FIPA 1Y4HA 4BOQA 5EZQA 2H7JA 1S4VA 2R9CA 1CQDA 1SNKA 4RKXA 5FPWA 1ATKA 3QSDA 2J7QC 5KO3A 2F1GA 4X6JA 1VSNA 2ARYA 2PBHA 4PT5A 1MHWA 1UKFA 2HH5A 4WA6A 1U9XA 3CBKA 2B1NA 2AVWA 2GHUA 4HWYA 4REZA 4X6IA 3H8BA 4W5BA 1YVBA 1NPZA 2YJ8A 2OULA 4BPVA 1Q6KA 2DCAA 3H89A 3GCBA 3IOQA 1U9VA 4D8IA 3W30A 3KWBX 1EWLA 3OF9A 4ZTBA 4YYSA 1BY8A 1EWMA 3HHIA 3V6CA 4CZWA 4QBBA 5J94A 4BS6A 2BTWB 3QJ3A 3B79A 4KLBA 1U9QX 1QMYA 9PAPA 3IMAA 2IPPB 4YYVA 3K8UA 4M0WA 2DCBA 1PPNA 3IHPA 2AS8A 3OF8A 4K7CA 3HD3A 3MP2A 1EWPA 3P5UA 5JH3A 2FQ9A 5EZSA 2DOSA 1IWDA 3TNXA 4DMXA 2AGAA 2FO5A 1PVJA 3WXGA 4RY2A 2DC7A 1GECE 1PBHA 1PPPA 3BB7A 1NL6A 1NLJA 4YVAA 3TMPA 4CDCB 1F29A 4MM3B 2FUDA 2R9OA 3PDFA 3RVWA 1X9YA 4OEMA 2GFOA 3PT2A 3IFUA 1AU2A 5K16A 2UZJA 4ZUXU 4YYWA 4BOPA 3BOWA 1MEMA 4PI3A 1ME3A 4XZXA 3KSEA 1CVZA 2E02A 1BQIA 4QH6A 3PHWA 3E9SA 1MIRA 4P16A 3CH3X 3RVXA 3PHUA 2PNSA 3C9EA 2FT2A 4PP2E 2ACTA 4XUIA 2Z84A 3PRMA 4AXLA 4N4ZA 2E01A 2NQGA 5F02A 2O6XA 4QRXA 2NQDB 3KWZA 4FK5A 1TU6A 1AU3A 2BTWA 2ATOA 2YJ9A 3ERVA 1KHQA 4BQVA 2AYOA 4RF1A 1PPDA 3D6SA 3TRKA 2VHSA 2G7YA 3C0RA 4X6HA 4I04A 4N8WA 4DMYA 2AYNA 2JTCA 1CV8A 1PXVA 4MI7A 3IV2A 4R3DA 2NQAA 2FTDA 1AU4A 1KFXL 5E6JA 3USVA 3PW3A 1M6DA 2G8EA 4XR7A 1AYWA 3U8EA 1HUCB 5JZEA 4IUMA 1SP4B 2XU3A 1AYVA 3B21A 1PCIA 3P5XA 3WXEA 3K24A 1U5IA 2AUXA 2PADA 5CHVA 3AI8A 1NQCA 1BGOA 1YT7A 2JQGR 1F2AA 2XU5A 1U9WA 3BY4A 2PREA 4P6EA 4MZOA 1QOLA 2WBFX 2P0RA 3OQCA 1TL9A 1CJLA 3N3KA 3LXSA 3F5VA 2BU3A 3PSEA 3V6EA 1NB3A 2R9NA 4N79A 4QRVA 4AXMA 2R9MA 4CDFB 2P86A 2AU1A 3MHHA 4I05A 3O65A 3IUTA 3W31A 2DC6A 1GLOA 1AYUA 2VHFA 2JRIA 1CB5A 3I06A 2R6NA 1DEUA 2BDZA 2F7DA 2CB5A 1PADA 3I3TA 1KFUL 2DCCA 3RVVA 2XU4A 3ZUAA 5JA7A 1ZIVA 2HD5A 3H7DA 4RNAA 2FRQA 3MTVA 3ZNHA 2AUZA 4OW0A 4IP3A 4OVZB 1BP4A 2YJCA 1PIPA 1GCBA 4OVZA 1Y08A 3MJ5A 3NHEA 3S3QA 2YJ2A 1ICFA 3H6SA 3S3RA 6PADA 4PADA 1KXRA 1XKGA 4MZSA 1YK7A 2FE8A 3BWKA 5EF4A 4G54A 1PPOA 3WXFA 3O0UA 3H8CA 4Q8GA 3DF0A 2G8JA 3KW9A 2FYEA 4WURA 1YK8A 1DKIA 2G6DA 2JQFR 1K3BB 4BOSA 5A24A 2DCDA 4RF0A 3M99A 2J7QA 4PP1A 2Y6EA 2DZZA 2AIMA 5CVMA 3QT4A 2XU1A 1CTEA 2OZ2A 2DZYA 2E03A 4Q8HA 2NQIA 3HWNA 4YYQA 7PCKA 3HHAA 5CHTA 4MSXA 4FJCA 3KFQA 2Y5BA 2B1MA 3MORA 3P5VA 5PADA 4CDEB 1DF0A 1YZBA 3OISA 4I07A 4YV8A 8PCHA 4QRGA 2HXZA 1ITOA 4W4UA 1EF7A 3F75A 4BOZA
chains in the Genus database with same CATH topology
3BCNA 3PNRA 5CVOB 3MTNA 4YYRA 3OVZA 1GMYA 2DC8A 5EGWA 3O1GA 5CVNB 4W5CA 1ZCMA 3MHSA 1JQPA 3IEJA 3KKUA 1AIMA 4CDDB 1POPA 3K9MA 1VJVA 2DJFB 3PBHA 1MDWA 1TLOA 4NV7A 2OP3A 1KHPA 1CS8A 2CIOA 1AECA 3P5WA 2E00A 1QDQA 3BC3A 1O0EA 3LFYA 2P7UA 2DC9A 2BDLA 4OELA 1AU0A 1STFE 1MS6A 1CPJA 2C0YA 1MEGA 1THEA 3N4CA 3KX1A 1CSBB 3E1ZB 4BSQA 1NB5A 1FH0A 2YJBA 1F2CA 3CBJA 3N3GA 1ME4A 1PE6A 3BPFA 2FRAA 2IBIA 3OVXA 4YYUA 1QXPA 2DJGB 2R9FA 2HHNA 4BS5A 3BPMA 3CH2X 1A6RA 4P6GA 1F2BA 1EWOA 1YALA 4FIPA 1Y4HA 2H7JA 1S4VA 2R9CA 1CQDA 1SNKA 5FPWA 1ATKA 3QSDA 2F1GA 4X6JA 1VSNA 2ARYA 2PBHA 1MHWA 2HH5A 4WA6A 1U9XA 3CBKA 2B1NA 2AVWA 2GHUA 4HWYA 4X6IA 3H8BA 4W5BA 1YVBA 1NPZA 2YJ8A 2OULA 4BPVA 1Q6KA 2DCAA 3H89A 3GCBA 3IOQA 1U9VA 4GUZA 3KWBX 1EWLA 3OF9A 4YYSA 1BY8A 1EWMA 3HHIA 3V6CA 4CZWA 4QBBA 5J94A 4BS6A 3QJ3A 3B79A 4KLBA 1U9QX 1QMYA 9PAPA 3IMAA 2IPPB 4YYVA 3K8UA 2DCBA 1PPNA 3IHPA 2AS8A 3OF8A 4K7CA 3HD3A 1EWPA 3P5UA 5JH3A 2FQ9A 3TNXA 1IWDA 4DMXA 2FO5A 3WXGA 4RY2A 2DC7A 1GECE 1PBHA 1PPPA 1NL6A 1NLJA 4YVAA 4CDCB 1F29A 2FUDA 4B55A 2R9OA 1W5RA 3PDFA 3RVWA 1X9YA 4OEMA 2GFOA 1AU2A 5K16A 4ZUXU 4YYWA 3BOWA 1MEMA 4PI3A 1ME3A 3KSEA 1CVZA 2E02A 1BQIA 4QH6A 1MIRA 3CH3X 3RVXA 2VFBA 2PNSA 3C9EA 2FT2A 4PP2E 2ACTA 4XUIA 4AXLA 4N4ZA 4BGFA 2E01A 2NQGA 5F02A 2O6XA 4QRXA 2NQDB 3KWZA 4FK5A 1TU6A 1AU3A 2ATOA 2YJ9A 3ERVA 1KHQA 4BQVA 2AYOA 1PPDA 3D6SA 2VHSA 2G7YA 4X6HA 4I04A 4N8WA 4DMYA 2AYNA 1CV8A 1PXVA 3IV2A 2NQAA 2FTDA 1AU4A 1KFXL 3USVA 3PW3A 1M6DA 2G8EA 4XR7A 1AYWA 3U8EA 1HUCB 1E2TA 1SP4B 2XU3A 1AYVA 1PCIA 3P5XA 3WXEA 1U5IA 2AUXA 3K24A 2PADA 5CHVA 3AI8A 1NQCA 1BGOA 1YT7A 2JQGR 1F2AA 2XU5A 1U9WA 2PREA 4P6EA 4MZOA 1QOLA 2WBFX 2P0RA 2VFCA 1TL9A 1CJLA 3N3KA 3LXSA 3F5VA 3V6EA 1NB3A 2R9NA 4N79A 4QRVA 4AXMA 4NV8A 2R9MA 4CDFB 2P86A 2AU1A 3MHHA 4I05A 3IUTA 4C5PA 2DC6A 1GLOA 1AYUA 2VHFA 1CB5A 3I06A 2R6NA 1DEUA 2BDZA 2F7DA 2CB5A 1PADA 3I3TA 1KFUL 2DCCA 3RVVA 2XU4A 3ZUAA 5JA7A 1ZIVA 2HD5A 3H7DA 2FRQA 2AUZA 1BP4A 2YJCA 1PIPA 3LTWA 1GCBA 3D9WA 1Y08A 3S3QA 3NHEA 1W6FA 2YJ2A 1ICFA 3H6SA 1GX3A 1W4TA 3S3RA 6PADA 4PADA 1KXRA 1XKGA 4MZSA 1YK7A 3BWKA 5EF4A 4G54A 1PPOA 3WXFA 3O0UA 3H8CA 4Q8GA 3DF0A 2G8JA 3KW9A 2FYEA 1YK8A 2G6DA 2JQFR 1K3BB 5A24A 2DCDA 3M99A 4PP1A 2Y6EA 2BSZA 2DZZA 2AIMA 5CVMA 3QT4A 2XU1A 1CTEA 2OZ2A 2DZYA 2E03A 4Q8HA 2NQIA 3HWNA 4YYQA 7PCKA 3HHAA 5CHTA 4MSXA 4FJCA 3KFQA 2Y5BA 2B1MA 3MORA 3P5VA 5PADA 4CDEB 1DF0A 3OISA 4I07A 4YV8A 8PCHA 4QRGA 2HXZA 1ITOA 4W4UA 1EF7A 3F75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BCN A;  3PNR A;  5CVO B;  3MTN A;  4YYR A;  3OVZ A;  1GMY A;  2DC8 A;  5EGW A;  3O1G A;  5CVN B;  4W5C A;  1ZCM A;  3MHS A;  1JQP A;  3IEJ A;  3KKU A;  1AIM A;  4CDD B;  1POP A;  3K9M A;  1VJV A;  2DJF B;  3PBH A;  1MDW A;  1TLO A;  2OP3 A;  1KHP A;  1CS8 A;  2CIO A;  1AEC A;  3P5W A;  2E00 A;  1QDQ A;  3BC3 A;  1O0E A;  3LFY A;  2P7U A;  2DC9 A;  2BDL A;  4OEL A;  1AU0 A;  1STF E;  1MS6 A;  1CPJ A;  2C0Y A;  1MEG A;  1THE A;  3N4C A;  3KX1 A;  1CSB B;  3E1Z B;  4BSQ A;  1NB5 A;  1FH0 A;  2YJB A;  1F2C A;  3CBJ A;  3N3G A;  1ME4 A;  1PE6 A;  3BPF A;  2FRA A;  2IBI A;  3OVX A;  4YYU A;  1QXP A;  2DJG B;  2R9F A;  2HHN A;  4BS5 A;  3BPM A;  3CH2 X;  1A6R A;  4P6G A;  1F2B A;  1EWO A;  1YAL A;  4FIP A;  1Y4H A;  2H7J A;  1S4V A;  2R9C A;  1CQD A;  1SNK A;  5FPW A;  1ATK A;  3QSD A;  2F1G A;  4X6J A;  1VSN A;  2ARY A;  2PBH A;  1MHW A;  2HH5 A;  4WA6 A;  1U9X A;  3CBK A;  2B1N A;  2AVW A;  2GHU A;  4HWY A;  4X6I A;  3H8B A;  4W5B A;  1YVB A;  1NPZ A;  2YJ8 A;  2OUL A;  4BPV A;  1Q6K A;  2DCA A;  3H89 A;  3GCB A;  3IOQ A;  1U9V A;  3KWB X;  1EWL A;  3OF9 A;  4YYS A;  1BY8 A;  1EWM A;  3HHI A;  3V6C A;  4CZW A;  4QBB A;  5J94 A;  4BS6 A;  3QJ3 A;  3B79 A;  4KLB A;  1U9Q X;  1QMY A;  9PAP A;  3IMA A;  2IPP B;  4YYV A;  3K8U A;  2DCB A;  1PPN A;  3IHP A;  2AS8 A;  3OF8 A;  4K7C A;  3HD3 A;  1EWP A;  3P5U A;  5JH3 A;  3TNX A;  2FQ9 A;  1IWD A;  4DMX A;  2FO5 A;  3WXG A;  4RY2 A;  2DC7 A;  1GEC E;  1PBH A;  1PPP A;  1NL6 A;  1NLJ A;  4YVA A;  4CDC B;  1F29 A;  2FUD A;  2R9O A;  3PDF A;  3RVW A;  1X9Y A;  4OEM A;  2GFO A;  1AU2 A;  5K16 A;  4ZUX U;  4YYW A;  3BOW A;  1MEM A;  4PI3 A;  1ME3 A;  3KSE A;  1CVZ A;  2E02 A;  1BQI A;  4QH6 A;  1MIR A;  3CH3 X;  3RVX A;  2PNS A;  3C9E A;  2FT2 A;  4PP2 E;  2ACT A;  4XUI A;  4AXL A;  4N4Z A;  2E01 A;  2NQG A;  5F02 A;  2O6X A;  4QRX A;  2NQD B;  3KWZ A;  4FK5 A;  1TU6 A;  1AU3 A;  2ATO A;  2YJ9 A;  3ERV A;  1KHQ A;  4BQV A;  2AYO A;  1PPD A;  3D6S A;  2VHS A;  2G7Y A;  4X6H A;  4I04 A;  4N8W A;  4DMY A;  2AYN A;  1CV8 A;  1PXV A;  3IV2 A;  2NQA A;  2FTD A;  1AU4 A;  1KFX L;  3USV A;  3PW3 A;  1M6D A;  2G8E A;  4XR7 A;  1AYW A;  3U8E A;  1HUC B;  1SP4 B;  2XU3 A;  1AYV A;  1PCI A;  3P5X A;  3WXE A;  1U5I A;  2AUX A;  3K24 A;  2PAD A;  5CHV A;  3AI8 A;  1NQC A;  1BGO A;  1YT7 A;  2JQG R;  1F2A A;  2XU5 A;  1U9W A;  2PRE A;  4P6E A;  4MZO A;  1QOL A;  2WBF X;  2P0R A;  1TL9 A;  1CJL A;  3N3K A;  3LXS A;  3F5V A;  3V6E A;  1NB3 A;  2R9N A;  4N79 A;  4QRV A;  4AXM A;  2R9M A;  4CDF B;  2P86 A;  2AU1 A;  3MHH A;  4I05 A;  3IUT A;  2DC6 A;  1GLO A;  1AYU A;  2VHF A;  1CB5 A;  3I06 A;  2R6N A;  1DEU A;  2BDZ A;  2F7D A;  2CB5 A;  1PAD A;  3I3T A;  1KFU L;  2DCC A;  3RVV A;  2XU4 A;  3ZUA A;  5JA7 A;  1ZIV A;  2HD5 A;  3H7D A;  2FRQ A;  2AUZ A;  1BP4 A;  2YJC A;  1PIP A;  1GCB A;  1Y08 A;  3S3Q A;  3NHE A;  2YJ2 A;  1ICF A;  3H6S A;  3S3R A;  6PAD A;  4PAD A;  1KXR A;  1XKG A;  4MZS A;  1YK7 A;  3BWK A;  5EF4 A;  4G54 A;  1PPO A;  3WXF A;  3O0U A;  3H8C A;  4Q8G A;  3DF0 A;  2G8J A;  3KW9 A;  2FYE A;  1YK8 A;  2G6D A;  2JQF R;  1K3B B;  5A24 A;  2DCD A;  3M99 A;  4PP1 A;  2Y6E A;  2DZZ A;  2AIM A;  5CVM A;  3QT4 A;  2XU1 A;  1CTE A;  2OZ2 A;  2DZY A;  2E03 A;  4Q8H A;  2NQI A;  3HWN A;  4YYQ A;  7PCK A;  3HHA A;  5CHT A;  4MSX A;  4FJC A;  3KFQ A;  2Y5B A;  2B1M A;  3MOR A;  3P5V A;  5PAD A;  4CDE B;  1DF0 A;  3OIS A;  4I07 A;  4YV8 A;  8PCH A;  4QRG A;  2HXZ A;  1ITO A;  4W4U A;  1EF7 A;  3F75 A; 
#chains in the Genus database with same CATH topology
 3BCN A;  3PNR A;  5CVO B;  4HXD B;  3MTN A;  4YYR A;  3OVZ A;  1GMY A;  2DC8 A;  5EGW A;  3O1G A;  5CVN B;  4GUA A;  4W5C A;  1ZCM A;  3MHS A;  1JQP A;  3IEJ A;  3KKU A;  1AIM A;  4CDD B;  1POP A;  3K9M A;  1VJV A;  2DJF B;  3PBH A;  1MDW A;  1TLO A;  2OP3 A;  1KHP A;  1CS8 A;  2CIO A;  3BBA A;  1AEC A;  3P5W A;  4BOU A;  2E00 A;  1QDQ A;  3BC3 A;  1O0E A;  3LFY A;  2P7U A;  2DC9 A;  2BDL A;  4OEL A;  1AU0 A;  1STF E;  1MS6 A;  1CPJ A;  2C0Y A;  1MEG A;  1THE A;  3PRP A;  3N4C A;  3KX1 A;  1CSB B;  3PHX A;  3E1Z B;  4BSQ A;  1NB5 A;  1FH0 A;  2YJB A;  4D8E A;  1F2C A;  3CBJ A;  3N3G A;  2HWK A;  1ME4 A;  3RNV A;  1PE6 A;  4A5U A;  3BPF A;  2FRA A;  2IBI A;  3OVX A;  4YYU A;  1QXP A;  2DJG B;  2R9F A;  4D8B A;  2HHN A;  4BS5 A;  3BPM A;  3CH2 X;  1A6R A;  4P6G A;  1F2B A;  1EWO A;  1YAL A;  4FIP A;  1Y4H A;  4BOQ A;  5EZQ A;  2H7J A;  1S4V A;  2R9C A;  1CQD A;  1SNK A;  4RKX A;  5FPW A;  1ATK A;  3QSD A;  2J7Q C;  5KO3 A;  2F1G A;  4X6J A;  1VSN A;  2ARY A;  2PBH A;  4PT5 A;  1MHW A;  1UKF A;  2HH5 A;  4WA6 A;  1U9X A;  3CBK A;  2B1N A;  2AVW A;  2GHU A;  4HWY A;  4REZ A;  4X6I A;  3H8B A;  4W5B A;  1YVB A;  1NPZ A;  2YJ8 A;  2OUL A;  4BPV A;  1Q6K A;  2DCA A;  3H89 A;  3GCB A;  3IOQ A;  1U9V A;  4D8I A;  3W30 A;  3KWB X;  1EWL A;  3OF9 A;  4ZTB A;  4YYS A;  1BY8 A;  1EWM A;  3HHI A;  3V6C A;  4CZW A;  4QBB A;  5J94 A;  4BS6 A;  2BTW B;  3QJ3 A;  3B79 A;  4KLB A;  1U9Q X;  1QMY A;  9PAP A;  3IMA A;  2IPP B;  4YYV A;  3K8U A;  4M0W A;  2DCB A;  1PPN A;  3IHP A;  2AS8 A;  3OF8 A;  4K7C A;  3HD3 A;  3MP2 A;  1EWP A;  3P5U A;  5JH3 A;  2FQ9 A;  5EZS A;  2DOS A;  1IWD A;  3TNX A;  4DMX A;  2AGA A;  2FO5 A;  1PVJ A;  3WXG A;  4RY2 A;  2DC7 A;  1GEC E;  1PBH A;  1PPP A;  3BB7 A;  1NL6 A;  1NLJ A;  4YVA A;  3TMP A;  4CDC B;  1F29 A;  4MM3 B;  2FUD A;  2R9O A;  3PDF A;  3RVW A;  1X9Y A;  4OEM A;  2GFO A;  3PT2 A;  3IFU A;  1AU2 A;  5K16 A;  2UZJ A;  4ZUX U;  4YYW A;  4BOP A;  3BOW A;  1MEM A;  4PI3 A;  1ME3 A;  4XZX A;  3KSE A;  1CVZ A;  2E02 A;  1BQI A;  4QH6 A;  3PHW A;  3E9S A;  1MIR A;  4P16 A;  3CH3 X;  3RVX A;  3PHU A;  2PNS A;  3C9E A;  2FT2 A;  4PP2 E;  2ACT A;  4XUI A;  2Z84 A;  3PRM A;  4AXL A;  4N4Z A;  2E01 A;  2NQG A;  5F02 A;  2O6X A;  4QRX A;  2NQD B;  3KWZ A;  4FK5 A;  1TU6 A;  1AU3 A;  2BTW A;  2ATO A;  2YJ9 A;  3ERV A;  1KHQ A;  4BQV A;  2AYO A;  4RF1 A;  1PPD A;  3D6S A;  3TRK A;  2VHS A;  2G7Y A;  3C0R A;  4X6H A;  4I04 A;  4N8W A;  4DMY A;  2AYN A;  2JTC A;  1CV8 A;  1PXV A;  4MI7 A;  3IV2 A;  4R3D A;  2NQA A;  2FTD A;  1AU4 A;  1KFX L;  5E6J A;  3USV A;  3PW3 A;  1M6D A;  2G8E A;  4XR7 A;  1AYW A;  3U8E A;  1HUC B;  5JZE A;  4IUM A;  1SP4 B;  2XU3 A;  1AYV A;  3B21 A;  1PCI A;  3P5X A;  3WXE A;  3K24 A;  1U5I A;  2AUX A;  2PAD A;  5CHV A;  3AI8 A;  1NQC A;  1BGO A;  1YT7 A;  2JQG R;  1F2A A;  2XU5 A;  1U9W A;  3BY4 A;  2PRE A;  4P6E A;  4MZO A;  1QOL A;  2WBF X;  2P0R A;  3OQC A;  1TL9 A;  1CJL A;  3N3K A;  3LXS A;  3F5V A;  2BU3 A;  3PSE A;  3V6E A;  1NB3 A;  2R9N A;  4N79 A;  4QRV A;  4AXM A;  2R9M A;  4CDF B;  2P86 A;  2AU1 A;  3MHH A;  4I05 A;  3O65 A;  3IUT A;  3W31 A;  2DC6 A;  1GLO A;  1AYU A;  2VHF A;  2JRI A;  1CB5 A;  3I06 A;  2R6N A;  1DEU A;  2BDZ A;  2F7D A;  2CB5 A;  1PAD A;  3I3T A;  1KFU L;  2DCC A;  3RVV A;  2XU4 A;  3ZUA A;  5JA7 A;  1ZIV A;  2HD5 A;  3H7D A;  4RNA A;  2FRQ A;  3MTV A;  3ZNH A;  2AUZ A;  4OW0 A;  4IP3 A;  4OVZ B;  1BP4 A;  2YJC A;  1PIP A;  1GCB A;  4OVZ A;  1Y08 A;  3MJ5 A;  3NHE A;  3S3Q A;  2YJ2 A;  1ICF A;  3H6S A;  3S3R A;  6PAD A;  4PAD A;  1KXR A;  1XKG A;  4MZS A;  1YK7 A;  2FE8 A;  3BWK A;  5EF4 A;  4G54 A;  1PPO A;  3WXF A;  3O0U A;  3H8C A;  4Q8G A;  3DF0 A;  2G8J A;  3KW9 A;  2FYE A;  4WUR A;  1YK8 A;  1DKI A;  2G6D A;  2JQF R;  1K3B B;  4BOS A;  5A24 A;  2DCD A;  4RF0 A;  3M99 A;  2J7Q A;  4PP1 A;  2Y6E A;  2DZZ A;  2AIM A;  5CVM A;  3QT4 A;  2XU1 A;  1CTE A;  2OZ2 A;  2DZY A;  2E03 A;  4Q8H A;  2NQI A;  3HWN A;  4YYQ A;  7PCK A;  3HHA A;  5CHT A;  4MSX A;  4FJC A;  3KFQ A;  2Y5B A;  2B1M A;  3MOR A;  3P5V A;  5PAD A;  4CDE B;  1DF0 A;  1YZB A;  3OIS A;  4I07 A;  4YV8 A;  8PCH A;  4QRG A;  2HXZ A;  1ITO A;  4W4U A;  1EF7 A;  3F75 A;  4BOZ A; 
#chains in the Genus database with same CATH homology
 3BCN A;  3PNR A;  5CVO B;  3MTN A;  4YYR A;  3OVZ A;  1GMY A;  2DC8 A;  5EGW A;  3O1G A;  5CVN B;  4W5C A;  1ZCM A;  3MHS A;  1JQP A;  3IEJ A;  3KKU A;  1AIM A;  4CDD B;  1POP A;  3K9M A;  1VJV A;  2DJF B;  3PBH A;  1MDW A;  1TLO A;  4NV7 A;  2OP3 A;  1KHP A;  1CS8 A;  2CIO A;  1AEC A;  3P5W A;  2E00 A;  1QDQ A;  3BC3 A;  1O0E A;  3LFY A;  2P7U A;  2DC9 A;  2BDL A;  4OEL A;  1AU0 A;  1STF E;  1MS6 A;  1CPJ A;  2C0Y A;  1MEG A;  1THE A;  3N4C A;  3KX1 A;  1CSB B;  3E1Z B;  4BSQ A;  1NB5 A;  1FH0 A;  2YJB A;  1F2C A;  3CBJ A;  3N3G A;  1ME4 A;  1PE6 A;  3BPF A;  2FRA A;  2IBI A;  3OVX A;  4YYU A;  1QXP A;  2DJG B;  2R9F A;  2HHN A;  4BS5 A;  3BPM A;  3CH2 X;  1A6R A;  4P6G A;  1F2B A;  1EWO A;  1YAL A;  4FIP A;  1Y4H A;  2H7J A;  1S4V A;  2R9C A;  1CQD A;  1SNK A;  5FPW A;  1ATK A;  3QSD A;  2F1G A;  4X6J A;  1VSN A;  2ARY A;  2PBH A;  1MHW A;  2HH5 A;  4WA6 A;  1U9X A;  3CBK A;  2B1N A;  2AVW A;  2GHU A;  4HWY A;  4X6I A;  3H8B A;  4W5B A;  1YVB A;  1NPZ A;  2YJ8 A;  2OUL A;  4BPV A;  1Q6K A;  2DCA A;  3H89 A;  3GCB A;  3IOQ A;  1U9V A;  4GUZ A;  3KWB X;  1EWL A;  3OF9 A;  4YYS A;  1BY8 A;  1EWM A;  3HHI A;  3V6C A;  4CZW A;  4QBB A;  5J94 A;  4BS6 A;  3QJ3 A;  3B79 A;  4KLB A;  1U9Q X;  1QMY A;  9PAP A;  3IMA A;  2IPP B;  4YYV A;  3K8U A;  2DCB A;  1PPN A;  3IHP A;  2AS8 A;  3OF8 A;  4K7C A;  3HD3 A;  1EWP A;  3P5U A;  5JH3 A;  2FQ9 A;  3TNX A;  1IWD A;  4DMX A;  2FO5 A;  3WXG A;  4RY2 A;  2DC7 A;  1GEC E;  1PBH A;  1PPP A;  1NL6 A;  1NLJ A;  4YVA A;  4CDC B;  1F29 A;  2FUD A;  4B55 A;  2R9O A;  1W5R A;  3PDF A;  3RVW A;  1X9Y A;  4OEM A;  2GFO A;  1AU2 A;  5K16 A;  4ZUX U;  4YYW A;  3BOW A;  1MEM A;  4PI3 A;  1ME3 A;  3KSE A;  1CVZ A;  2E02 A;  1BQI A;  4QH6 A;  1MIR A;  3CH3 X;  3RVX A;  2VFB A;  2PNS A;  3C9E A;  2FT2 A;  4PP2 E;  2ACT A;  4XUI A;  4AXL A;  4N4Z A;  4BGF A;  2E01 A;  2NQG A;  5F02 A;  2O6X A;  4QRX A;  2NQD B;  3KWZ A;  4FK5 A;  1TU6 A;  1AU3 A;  2ATO A;  2YJ9 A;  3ERV A;  1KHQ A;  4BQV A;  2AYO A;  1PPD A;  3D6S A;  2VHS A;  2G7Y A;  4X6H A;  4I04 A;  4N8W A;  4DMY A;  2AYN A;  1CV8 A;  1PXV A;  3IV2 A;  2NQA A;  2FTD A;  1AU4 A;  1KFX L;  3USV A;  3PW3 A;  1M6D A;  2G8E A;  4XR7 A;  1AYW A;  3U8E A;  1HUC B;  1E2T A;  1SP4 B;  2XU3 A;  1AYV A;  1PCI A;  3P5X A;  3WXE A;  1U5I A;  2AUX A;  3K24 A;  2PAD A;  5CHV A;  3AI8 A;  1NQC A;  1BGO A;  1YT7 A;  2JQG R;  1F2A A;  2XU5 A;  1U9W A;  2PRE A;  4P6E A;  4MZO A;  1QOL A;  2WBF X;  2P0R A;  2VFC A;  1TL9 A;  1CJL A;  3N3K A;  3LXS A;  3F5V A;  3V6E A;  1NB3 A;  2R9N A;  4N79 A;  4QRV A;  4AXM A;  4NV8 A;  2R9M A;  4CDF B;  2P86 A;  2AU1 A;  3MHH A;  4I05 A;  3IUT A;  4C5P A;  2DC6 A;  1GLO A;  1AYU A;  2VHF A;  1CB5 A;  3I06 A;  2R6N A;  1DEU A;  2BDZ A;  2F7D A;  2CB5 A;  1PAD A;  3I3T A;  1KFU L;  2DCC A;  3RVV A;  2XU4 A;  3ZUA A;  5JA7 A;  1ZIV A;  2HD5 A;  3H7D A;  2FRQ A;  2AUZ A;  1BP4 A;  2YJC A;  1PIP A;  3LTW A;  1GCB A;  3D9W A;  1Y08 A;  3S3Q A;  3NHE A;  1W6F A;  2YJ2 A;  1ICF A;  3H6S A;  1GX3 A;  1W4T A;  3S3R A;  6PAD A;  4PAD A;  1KXR A;  1XKG A;  4MZS A;  1YK7 A;  3BWK A;  5EF4 A;  4G54 A;  1PPO A;  3WXF A;  3O0U A;  3H8C A;  4Q8G A;  3DF0 A;  2G8J A;  3KW9 A;  2FYE A;  1YK8 A;  2G6D A;  2JQF R;  1K3B B;  5A24 A;  2DCD A;  3M99 A;  4PP1 A;  2Y6E A;  2BSZ A;  2DZZ A;  2AIM A;  5CVM A;  3QT4 A;  2XU1 A;  1CTE A;  2OZ2 A;  2DZY A;  2E03 A;  4Q8H A;  2NQI A;  3HWN A;  4YYQ A;  7PCK A;  3HHA A;  5CHT A;  4MSX A;  4FJC A;  3KFQ A;  2Y5B A;  2B1M A;  3MOR A;  3P5V A;  5PAD A;  4CDE B;  1DF0 A;  3OIS A;  4I07 A;  4YV8 A;  8PCH A;  4QRG A;  2HXZ A;  1ITO A;  4W4U A;  1EF7 A;  3F75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...