1M6DA

Crystal structure of human cathepsin f
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
214
structure length
214
Chain Sequence
APPEWDWRSKGAVTKVKDQGMCGSCWAFSVTGNVEGQWFLNQGTLLSLSEQELLDCDKMDKACMGGLPSNAYSAIKNLGGLETEDDYSYQGHMQSCQFSAEKAKVYIQDSVELSQNEQKLAAWLAKRGPISVAINAFGMQFYRHGISRPLRPLCSPWLIDHAVLLVGYGQRSDVPFWAIKNSWGTDWGEKGYYYLHRGSGACGVNTMASSAVVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin F
publication title The crystal structure of human cathepsin F and its implications for the development of novel immunomodulators
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 63
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 3.4.22.41: Cathepsin F.
pdb deposition date 2002-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1m6dA00
2AU1A 1Y08A 3QT4A 3RVVA 3PDFA 2R6NA 1MS6A 2CB5A 1NLJA 4N79A 3HHAA 1AU2A 3N4CA 1KHQA 2DCBA 4YV8A 2CIOA 1NB5A 1DEUA 4W5BA 1CV8A 1QOLA 2YJ9A 1K3BB 3IMAA 5CVOB 7PCKA 4KLBA 4BS6A 3MORA 2AS8A 2P7UA 4Q8HA 2ARYA 3MHHA 4DMXA 6PADA 2C0YA 3OVZA 1ME3A 4BS5A 4FIPA 2BDLA 2PNSA 1EWLA 1KFUL 2PBHA 1CQDA 3IV2A 3CH2X 2G8JA 1MEMA 1S4VA 5EF4A 1ITOA 1EF7A 3CBJA 4QBBA 4OELA 2FO5A 2PREA 1BGOA 2FRQA 2R9OA 1AU4A 3C9EA 4XR7A 3PBHA 4ZUXU 5CHTA 2FT2A 3WXEA 4QRXA 1KXRA 4YYRA 2BDZA 3WXGA 1U9XA 2AIMA 4W4UA 1PPDA 2YJ2A 4QRVA 3BC3A 3KWBX 3O1GA 3IEJA 3P5UA 4MSXA 3QSDA 2DC8A 2DCDA 3O0UA 4CZWA 2R9NA 2B1MA 3DF0A 4YYWA 2AYOA 1DF0A 2HHNA 2AYNA 1EWPA 3F5VA 2NQIA 3KFQA 1YT7A 2JQGR 3H6SA 1M6DA 2O6XA 2PADA 4P6GA 1CSBB 4BSQA 5K16A 1XKGA 4PI3A 1MIRA 4X6HA 2YJ8A 1AYWA 1TLOA 2AUXA 2FRAA 4XUIA 2NQDB 1NPZA 3TNXA 2R9CA 1X9YA 4BPVA 1AU3A 1AYVA 4CDCB 3RVXA 2ATOA 1HUCB 1NL6A 1Y4HA 2E02A 4PADA 1YK8A 3OF9A 4CDDB 4YYVA 1CVZA 1U5IA 1MEGA 3OVXA 9PAPA 4N4ZA 3HHIA 1ME4A 3IHPA 1AYUA 1TU6A 4QH6A 3PNRA 2FQ9A 1MDWA 4P6EA 3P5WA 2VHFA 4W5CA 2GFOA 3RVWA 2OULA 1PPOA 1YVBA 4DMYA 2HXZA 2OZ2A 2FYEA 3N3GA 1SP4B 3I06A 1IWDA 1CS8A 2GHUA 4AXLA 4HWYA 2AUZA 3GCBA 1PPPA 3BCNA 5FPWA 3KKUA 2IBIA 4K7CA 4Q8GA 3NHEA 1SNKA 1NB3A 2E00A 3N3KA 1F2AA 5PADA 3M99A 3I3TA 4G54A 1F2CA 2NQGA 4PP1A 1ATKA 1Q6KA 2FTDA 2DC7A 1O0EA 1STFE 4X6JA 2R9MA 3BWKA 1QMYA 3P5VA 2DJFB 5CHVA 3QJ3A 3LXSA 1NQCA 4I05A 3HD3A 3CBKA 2VHSA 1AIMA 1ZCMA 1QXPA 3CH3X 5A24A 2HH5A 2XU3A 2NQAA 1CTEA 1BY8A 3KX1A 1F29A 3BOWA 3S3QA 4MZSA 2E01A 3OF8A 1BP4A 1YK7A 3MTNA 3D6SA 4I04A 2H7JA 2YJBA 3F75A 2DC6A 4FK5A 5CVNB 1EWOA 1CPJA 2F1GA 2G6DA 4X6IA 4YYUA 2XU4A 4BQVA 2OP3A 2R9FA 1KFXL 4YVAA 4WA6A 2JQFR 3KSEA 2B1NA 5F02A 2HD5A 3V6EA 2XU1A 2XU5A 3HWNA 1PE6A 4OEMA 2G8EA 2FUDA 5JH3A 1U9QX 1PXVA 1KHPA 1GMYA 3BPMA 1FH0A 2YJCA 2AVWA 5J94A 2WBFX 2ACTA 2DJGB 1CJLA 1AECA 1F2BA 1GLOA 2E03A 8PCHA 1QDQA 3H8BA 4AXMA 3OISA 1CB5A 1GCBA 3ERVA 2G7YA 1BQIA 3AI8A 1PCIA 3PW3A 1PADA 3MHSA 4FJCA 2DZZA 1JQPA 3IUTA 1THEA 1PIPA 5CVMA 1U9VA 1POPA 1AU0A 3U8EA 1EWMA 4I07A 3P5XA 3H89A 5JA7A 1YALA 3WXFA 2Y6EA 3LFYA 1U9WA 3KWZA 3K24A 4CDFB 4YYSA 1TL9A 1VJVA 1GECE 2P0RA 4QRGA 2DC9A 3K8UA 3H8CA 2DZYA 3ZUAA 1VSNA 2P86A 2IPPB 3B79A 1ICFA 1MHWA 1A6RA 3BPFA 4PP2E 4YYQA 3IOQA 4CDEB 1ZIVA 4N8WA 1PBHA 1PPNA 3K9MA 3USVA 2DCAA 4MZOA 3KW9A 2Y5BA 3E1ZB 5EGWA 3S3RA 2DCCA 3V6CA 3H7DA 2F7DA 4RY2A
chains in the Genus database with same CATH superfamily
2AU1A 3BY4A 1Y08A 3QT4A 3RVVA 3PDFA 4BOUA 2R6NA 1MS6A 2CB5A 1NLJA 4N79A 3HHAA 1AU2A 3N4CA 1KHQA 2DCBA 2J7QA 4YV8A 2FE8A 2CIOA 1NB5A 1DEUA 4W5BA 1CV8A 1QOLA 2YJ9A 1K3BB 3IMAA 3PHUA 4HXDB 4OVZB 5CVOB 7PCKA 4KLBA 4BS6A 3MORA 2AS8A 1YZBA 2P7UA 4Q8HA 2ARYA 4A5UA 3MHHA 4DMXA 6PADA 2C0YA 3W30A 3OVZA 3TMPA 1ME3A 3PSEA 4BS5A 4FIPA 2BDLA 2PNSA 1EWLA 1KFUL 2PBHA 1CQDA 3IV2A 2J7QC 3CH2X 2G8JA 3E9SA 1MEMA 1S4VA 5EF4A 1ITOA 1EF7A 4D8EA 3CBJA 4QBBA 2BTWA 4OELA 2FO5A 2PREA 1BGOA 2FRQA 4RKXA 2R9OA 1AU4A 3C9EA 4XR7A 1UKFA 3PBHA 4ZUXU 5CHTA 3RNVA 3OQCA 2FT2A 3WXEA 4QRXA 1KXRA 3C0RA 4YYRA 2BDZA 3WXGA 1U9XA 2AIMA 4W4UA 1PPDA 2YJ2A 4QRVA 3BC3A 3KWBX 4MI7A 3O1GA 3IEJA 3P5UA 5KO3A 4MSXA 3QSDA 2DC8A 2DCDA 3O0UA 4CZWA 2R9NA 2B1MA 3DF0A 4YYWA 2AYOA 1DF0A 2HHNA 3IFUA 2AYNA 1EWPA 3F5VA 2NQIA 3KFQA 1YT7A 2JQGR 4BOZA 3H6SA 1M6DA 2O6XA 2PADA 4P6GA 2DOSA 1CSBB 4BSQA 5K16A 1XKGA 4PI3A 4BOSA 1MIRA 4X6HA 2YJ8A 1AYWA 1TLOA 2AUXA 2FRAA 4XUIA 2NQDB 1NPZA 3TNXA 2R9CA 1X9YA 4BPVA 1AU3A 1AYVA 4CDCB 3RVXA 3MTVA 2ATOA 1HUCB 1NL6A 1Y4HA 2E02A 2Z84A 4PADA 1YK8A 3OF9A 4CDDB 4YYVA 3BBAA 1CVZA 1U5IA 1MEGA 3OVXA 9PAPA 4N4ZA 3PHXA 1DKIA 2HWKA 3MJ5A 3HHIA 1ME4A 3IHPA 1AYUA 1TU6A 4QH6A 3PNRA 2FQ9A 1MDWA 4P6EA 3P5WA 2VHFA 4W5CA 2GFOA 3RVWA 3B21A 2OULA 1PPOA 1YVBA 4DMYA 2HXZA 2OZ2A 2FYEA 3N3GA 1SP4B 3I06A 1IWDA 1CS8A 2GHUA 3PRMA 4RNAA 4AXLA 4HWYA 4OW0A 2AUZA 3GCBA 4ZTBA 1PVJA 1PPPA 3BCNA 5FPWA 3KKUA 3ZNHA 2IBIA 4K7CA 4Q8GA 3NHEA 1SNKA 2UZJA 2JTCA 1NB3A 2E00A 3N3KA 1F2AA 4PT5A 5PADA 3M99A 3PRPA 3I3TA 4G54A 4BOPA 1F2CA 2NQGA 4WURA 4PP1A 1ATKA 1Q6KA 2FTDA 2DC7A 1O0EA 1STFE 4X6JA 3PT2A 2R9MA 3BWKA 1QMYA 3P5VA 2DJFB 5CHVA 3QJ3A 3LXSA 2AGAA 2BTWB 1NQCA 4I05A 3HD3A 3CBKA 2VHSA 1AIMA 1ZCMA 1QXPA 3CH3X 5A24A 2HH5A 2XU3A 2NQAA 1CTEA 1BY8A 3KX1A 1F29A 3BOWA 3S3QA 3O65A 4MZSA 2E01A 3OF8A 4D8IA 1BP4A 4IUMA 4BOQA 1YK7A 3MTNA 2JRIA 3D6SA 4I04A 2H7JA 2YJBA 3F75A 2DC6A 4FK5A 5CVNB 1EWOA 3BB7A 1CPJA 2F1GA 2G6DA 4X6IA 5EZQA 4YYUA 4OVZA 2XU4A 5EZSA 4IP3A 4BQVA 2OP3A 2R9FA 4RF0A 1KFXL 4YVAA 4WA6A 2JQFR 3KSEA 2B1NA 3PHWA 5F02A 5E6JA 2HD5A 3V6EA 2XU1A 2XU5A 3HWNA 1PE6A 4OEMA 3TRKA 2G8EA 2FUDA 5JH3A 1U9QX 1PXVA 1KHPA 1GMYA 3BPMA 4MM3B 1FH0A 2YJCA 2AVWA 5J94A 2WBFX 2ACTA 2DJGB 1CJLA 1AECA 1F2BA 1GLOA 2E03A 8PCHA 1QDQA 3H8BA 4AXMA 3OISA 1CB5A 1GCBA 4R3DA 3ERVA 4P16A 2G7YA 1BQIA 3AI8A 1PCIA 3PW3A 1PADA 3MHSA 4FJCA 2DZZA 1JQPA 3IUTA 1THEA 1PIPA 5CVMA 1U9VA 1POPA 1AU0A 3U8EA 1EWMA 4I07A 4REZA 3MP2A 3P5XA 3W31A 3H89A 5JA7A 4GUAA 1YALA 3WXFA 2Y6EA 3LFYA 1U9WA 3KWZA 4M0WA 3K24A 4CDFB 4YYSA 1TL9A 1VJVA 1GECE 2BU3A 2P0RA 4QRGA 2DC9A 3K8UA 3H8CA 2DZYA 3ZUAA 5JZEA 1VSNA 2P86A 2IPPB 3B79A 1ICFA 1MHWA 1A6RA 3BPFA 4PP2E 4YYQA 3IOQA 4XZXA 4CDEB 1ZIVA 4N8WA 1PBHA 1PPNA 3K9MA 3USVA 2DCAA 4MZOA 3KW9A 2Y5BA 3E1ZB 5EGWA 3S3RA 2DCCA 3V6CA 3H7DA 2F7DA 4RY2A 4RF1A 4D8BA
chains in the Genus database with same CATH topology
2AU1A 1Y08A 3QT4A 3RVVA 3PDFA 2R6NA 1MS6A 3D9WA 2CB5A 1NLJA 4N79A 3HHAA 1AU2A 3N4CA 1KHQA 2DCBA 4YV8A 2CIOA 1NB5A 1DEUA 4W5BA 1CV8A 1QOLA 2YJ9A 1K3BB 3IMAA 5CVOB 7PCKA 4KLBA 4BS6A 3MORA 2AS8A 2P7UA 4Q8HA 2ARYA 3MHHA 4DMXA 6PADA 2C0YA 3OVZA 1ME3A 4BS5A 4FIPA 2BDLA 2PNSA 1EWLA 1KFUL 2PBHA 1CQDA 3IV2A 3CH2X 2G8JA 1MEMA 1S4VA 5EF4A 1ITOA 1EF7A 3CBJA 4QBBA 4OELA 2FO5A 2PREA 1BGOA 2FRQA 2R9OA 1AU4A 3C9EA 4XR7A 3PBHA 4ZUXU 5CHTA 4B55A 2FT2A 3WXEA 4QRXA 1KXRA 4YYRA 2BDZA 3WXGA 1U9XA 2AIMA 4W4UA 1PPDA 2YJ2A 4QRVA 3BC3A 3KWBX 3O1GA 3IEJA 3P5UA 4MSXA 3QSDA 2DC8A 2DCDA 3O0UA 4CZWA 2R9NA 2B1MA 3DF0A 4YYWA 2AYOA 1DF0A 2HHNA 2AYNA 1EWPA 3F5VA 2NQIA 3KFQA 1YT7A 2JQGR 3H6SA 1M6DA 2O6XA 4NV7A 2PADA 4P6GA 2BSZA 1CSBB 4BSQA 5K16A 1XKGA 4PI3A 1MIRA 4X6HA 2YJ8A 1AYWA 1TLOA 2AUXA 2FRAA 4XUIA 2NQDB 1NPZA 3TNXA 2R9CA 1X9YA 4BPVA 1AU3A 1AYVA 4CDCB 3RVXA 2VFBA 1W5RA 2ATOA 1HUCB 1NL6A 1Y4HA 2E02A 4PADA 1YK8A 3OF9A 4CDDB 2VFCA 4YYVA 1CVZA 1U5IA 1MEGA 3OVXA 9PAPA 4N4ZA 3HHIA 1ME4A 3IHPA 1AYUA 1TU6A 4QH6A 3PNRA 2FQ9A 1MDWA 4P6EA 3P5WA 2VHFA 4W5CA 1E2TA 2GFOA 3RVWA 2OULA 1PPOA 1YVBA 4DMYA 2HXZA 2OZ2A 2FYEA 3N3GA 1SP4B 3I06A 1IWDA 1CS8A 2GHUA 4AXLA 4HWYA 2AUZA 3GCBA 1PPPA 3BCNA 5FPWA 3KKUA 2IBIA 4K7CA 4Q8GA 3NHEA 1SNKA 1NB3A 2E00A 3N3KA 1F2AA 5PADA 3M99A 3I3TA 4G54A 1F2CA 2NQGA 4PP1A 1ATKA 1Q6KA 2FTDA 2DC7A 1O0EA 1STFE 4X6JA 2R9MA 3BWKA 1QMYA 3P5VA 1W4TA 2DJFB 5CHVA 3QJ3A 3LXSA 1NQCA 4I05A 3HD3A 3CBKA 2VHSA 1AIMA 1ZCMA 1QXPA 3CH3X 5A24A 2HH5A 2XU3A 2NQAA 1CTEA 1BY8A 3KX1A 1F29A 3BOWA 3S3QA 4MZSA 2E01A 3OF8A 1BP4A 1YK7A 3MTNA 3D6SA 4I04A 2H7JA 2YJBA 3F75A 2DC6A 4FK5A 5CVNB 1EWOA 1CPJA 2F1GA 2G6DA 4X6IA 4YYUA 2XU4A 4BQVA 2OP3A 2R9FA 1KFXL 4YVAA 4WA6A 2JQFR 3KSEA 2B1NA 5F02A 2HD5A 1GX3A 3V6EA 2XU1A 2XU5A 4BGFA 3HWNA 1PE6A 4OEMA 2G8EA 2FUDA 5JH3A 1U9QX 1PXVA 1KHPA 1GMYA 3BPMA 4C5PA 1FH0A 2YJCA 2AVWA 5J94A 2WBFX 2ACTA 2DJGB 1CJLA 1AECA 1F2BA 1GLOA 2E03A 8PCHA 1QDQA 3H8BA 4AXMA 3OISA 1CB5A 1GCBA 3ERVA 3LTWA 2G7YA 1BQIA 3AI8A 1PCIA 3PW3A 1PADA 3MHSA 4FJCA 2DZZA 1JQPA 3IUTA 1THEA 1PIPA 5CVMA 1U9VA 1POPA 1AU0A 3U8EA 1EWMA 4I07A 3P5XA 3H89A 5JA7A 1YALA 1W6FA 3WXFA 2Y6EA 3LFYA 1U9WA 3KWZA 3K24A 4CDFB 4YYSA 1TL9A 1VJVA 1GECE 2P0RA 4QRGA 2DC9A 3K8UA 3H8CA 2DZYA 3ZUAA 1VSNA 4NV8A 2P86A 2IPPB 3B79A 1ICFA 1MHWA 1A6RA 3BPFA 4PP2E 4YYQA 3IOQA 4CDEB 1ZIVA 4N8WA 1PBHA 1PPNA 3K9MA 4GUZA 3USVA 2DCAA 4MZOA 3KW9A 2Y5BA 3E1ZB 5EGWA 3S3RA 2DCCA 3V6CA 3H7DA 2F7DA 4RY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AU1 A;  1Y08 A;  3QT4 A;  3RVV A;  3PDF A;  2R6N A;  1MS6 A;  2CB5 A;  1NLJ A;  4N79 A;  3HHA A;  1AU2 A;  3N4C A;  1KHQ A;  2DCB A;  4YV8 A;  2CIO A;  1NB5 A;  1DEU A;  4W5B A;  1CV8 A;  1QOL A;  2YJ9 A;  1K3B B;  3IMA A;  5CVO B;  7PCK A;  4KLB A;  4BS6 A;  3MOR A;  2AS8 A;  2P7U A;  4Q8H A;  2ARY A;  3MHH A;  4DMX A;  6PAD A;  2C0Y A;  3OVZ A;  1ME3 A;  4BS5 A;  4FIP A;  2BDL A;  2PNS A;  1EWL A;  1KFU L;  2PBH A;  1CQD A;  3IV2 A;  3CH2 X;  2G8J A;  1MEM A;  1S4V A;  5EF4 A;  1ITO A;  1EF7 A;  3CBJ A;  4QBB A;  4OEL A;  2FO5 A;  2PRE A;  1BGO A;  2FRQ A;  2R9O A;  1AU4 A;  3C9E A;  4XR7 A;  3PBH A;  4ZUX U;  5CHT A;  2FT2 A;  3WXE A;  4QRX A;  1KXR A;  4YYR A;  2BDZ A;  3WXG A;  1U9X A;  2AIM A;  4W4U A;  1PPD A;  2YJ2 A;  4QRV A;  3BC3 A;  3KWB X;  3O1G A;  3IEJ A;  3P5U A;  4MSX A;  3QSD A;  2DC8 A;  2DCD A;  3O0U A;  4CZW A;  2R9N A;  2B1M A;  3DF0 A;  4YYW A;  2AYO A;  1DF0 A;  2HHN A;  2AYN A;  1EWP A;  3F5V A;  2NQI A;  3KFQ A;  1YT7 A;  2JQG R;  3H6S A;  1M6D A;  2O6X A;  2PAD A;  4P6G A;  1CSB B;  4BSQ A;  5K16 A;  1XKG A;  4PI3 A;  1MIR A;  4X6H A;  2YJ8 A;  1AYW A;  1TLO A;  2AUX A;  2FRA A;  4XUI A;  2NQD B;  1NPZ A;  3TNX A;  2R9C A;  1X9Y A;  4BPV A;  1AU3 A;  1AYV A;  4CDC B;  3RVX A;  2ATO A;  1HUC B;  1NL6 A;  1Y4H A;  2E02 A;  4PAD A;  1YK8 A;  3OF9 A;  4CDD B;  4YYV A;  1CVZ A;  1U5I A;  1MEG A;  3OVX A;  9PAP A;  4N4Z A;  3HHI A;  1ME4 A;  3IHP A;  1AYU A;  1TU6 A;  4QH6 A;  3PNR A;  2FQ9 A;  1MDW A;  4P6E A;  3P5W A;  2VHF A;  4W5C A;  2GFO A;  3RVW A;  2OUL A;  1PPO A;  1YVB A;  4DMY A;  2HXZ A;  2OZ2 A;  2FYE A;  3N3G A;  1SP4 B;  3I06 A;  1IWD A;  1CS8 A;  2GHU A;  4AXL A;  4HWY A;  2AUZ A;  3GCB A;  1PPP A;  3BCN A;  5FPW A;  3KKU A;  2IBI A;  4K7C A;  4Q8G A;  3NHE A;  1SNK A;  1NB3 A;  2E00 A;  3N3K A;  1F2A A;  5PAD A;  3M99 A;  3I3T A;  4G54 A;  1F2C A;  2NQG A;  4PP1 A;  1ATK A;  1Q6K A;  2FTD A;  2DC7 A;  1O0E A;  1STF E;  4X6J A;  2R9M A;  3BWK A;  1QMY A;  3P5V A;  2DJF B;  5CHV A;  3QJ3 A;  3LXS A;  1NQC A;  4I05 A;  3HD3 A;  3CBK A;  2VHS A;  1AIM A;  1ZCM A;  1QXP A;  3CH3 X;  5A24 A;  2HH5 A;  2XU3 A;  2NQA A;  1CTE A;  1BY8 A;  3KX1 A;  1F29 A;  3BOW A;  3S3Q A;  4MZS A;  2E01 A;  3OF8 A;  1BP4 A;  1YK7 A;  3MTN A;  3D6S A;  4I04 A;  2H7J A;  2YJB A;  3F75 A;  2DC6 A;  4FK5 A;  5CVN B;  1EWO A;  1CPJ A;  2F1G A;  2G6D A;  4X6I A;  4YYU A;  2XU4 A;  4BQV A;  2OP3 A;  2R9F A;  1KFX L;  4YVA A;  4WA6 A;  2JQF R;  3KSE A;  2B1N A;  5F02 A;  2HD5 A;  3V6E A;  2XU1 A;  2XU5 A;  3HWN A;  1PE6 A;  4OEM A;  2G8E A;  2FUD A;  5JH3 A;  1U9Q X;  1PXV A;  1KHP A;  1GMY A;  3BPM A;  1FH0 A;  2YJC A;  2AVW A;  5J94 A;  2WBF X;  2ACT A;  2DJG B;  1CJL A;  1AEC A;  1F2B A;  1GLO A;  2E03 A;  8PCH A;  1QDQ A;  3H8B A;  4AXM A;  3OIS A;  1CB5 A;  1GCB A;  3ERV A;  2G7Y A;  1BQI A;  3AI8 A;  1PCI A;  3PW3 A;  1PAD A;  3MHS A;  4FJC A;  2DZZ A;  1JQP A;  3IUT A;  1THE A;  1PIP A;  5CVM A;  1U9V A;  1POP A;  1AU0 A;  3U8E A;  1EWM A;  4I07 A;  3P5X A;  3H89 A;  5JA7 A;  1YAL A;  3WXF A;  2Y6E A;  3LFY A;  1U9W A;  3KWZ A;  3K24 A;  4CDF B;  4YYS A;  1TL9 A;  1VJV A;  1GEC E;  2P0R A;  4QRG A;  2DC9 A;  3K8U A;  3H8C A;  2DZY A;  3ZUA A;  1VSN A;  2P86 A;  2IPP B;  3B79 A;  1ICF A;  1MHW A;  1A6R A;  3BPF A;  4PP2 E;  4YYQ A;  3IOQ A;  4CDE B;  1ZIV A;  4N8W A;  1PBH A;  1PPN A;  3K9M A;  3USV A;  2DCA A;  4MZO A;  3KW9 A;  2Y5B A;  3E1Z B;  5EGW A;  3S3R A;  2DCC A;  3V6C A;  3H7D A;  2F7D A;  4RY2 A; 
#chains in the Genus database with same CATH topology
 2AU1 A;  3BY4 A;  1Y08 A;  3QT4 A;  3RVV A;  3PDF A;  4BOU A;  2R6N A;  1MS6 A;  2CB5 A;  1NLJ A;  4N79 A;  3HHA A;  1AU2 A;  3N4C A;  1KHQ A;  2DCB A;  2J7Q A;  4YV8 A;  2FE8 A;  2CIO A;  1NB5 A;  1DEU A;  4W5B A;  1CV8 A;  1QOL A;  2YJ9 A;  1K3B B;  3IMA A;  3PHU A;  4HXD B;  4OVZ B;  5CVO B;  7PCK A;  4KLB A;  4BS6 A;  3MOR A;  2AS8 A;  1YZB A;  2P7U A;  4Q8H A;  2ARY A;  4A5U A;  3MHH A;  4DMX A;  6PAD A;  2C0Y A;  3W30 A;  3OVZ A;  3TMP A;  1ME3 A;  3PSE A;  4BS5 A;  4FIP A;  2BDL A;  2PNS A;  1EWL A;  1KFU L;  2PBH A;  1CQD A;  3IV2 A;  2J7Q C;  3CH2 X;  2G8J A;  3E9S A;  1MEM A;  1S4V A;  5EF4 A;  1ITO A;  1EF7 A;  4D8E A;  3CBJ A;  4QBB A;  2BTW A;  4OEL A;  2FO5 A;  2PRE A;  1BGO A;  2FRQ A;  4RKX A;  2R9O A;  1AU4 A;  3C9E A;  4XR7 A;  1UKF A;  3PBH A;  4ZUX U;  5CHT A;  3RNV A;  3OQC A;  2FT2 A;  3WXE A;  4QRX A;  1KXR A;  3C0R A;  4YYR A;  2BDZ A;  3WXG A;  1U9X A;  2AIM A;  4W4U A;  1PPD A;  2YJ2 A;  4QRV A;  3BC3 A;  3KWB X;  4MI7 A;  3O1G A;  3IEJ A;  3P5U A;  5KO3 A;  4MSX A;  3QSD A;  2DC8 A;  2DCD A;  3O0U A;  4CZW A;  2R9N A;  2B1M A;  3DF0 A;  4YYW A;  2AYO A;  1DF0 A;  2HHN A;  3IFU A;  2AYN A;  1EWP A;  3F5V A;  2NQI A;  3KFQ A;  1YT7 A;  2JQG R;  4BOZ A;  3H6S A;  1M6D A;  2O6X A;  2PAD A;  4P6G A;  2DOS A;  1CSB B;  4BSQ A;  5K16 A;  1XKG A;  4PI3 A;  4BOS A;  1MIR A;  4X6H A;  2YJ8 A;  1AYW A;  1TLO A;  2AUX A;  2FRA A;  4XUI A;  2NQD B;  1NPZ A;  3TNX A;  2R9C A;  1X9Y A;  4BPV A;  1AU3 A;  1AYV A;  4CDC B;  3RVX A;  3MTV A;  2ATO A;  1HUC B;  1NL6 A;  1Y4H A;  2E02 A;  2Z84 A;  4PAD A;  1YK8 A;  3OF9 A;  4CDD B;  4YYV A;  3BBA A;  1CVZ A;  1U5I A;  1MEG A;  3OVX A;  9PAP A;  4N4Z A;  3PHX A;  1DKI A;  2HWK A;  3MJ5 A;  3HHI A;  1ME4 A;  3IHP A;  1AYU A;  1TU6 A;  4QH6 A;  3PNR A;  2FQ9 A;  1MDW A;  4P6E A;  3P5W A;  2VHF A;  4W5C A;  2GFO A;  3RVW A;  3B21 A;  2OUL A;  1PPO A;  1YVB A;  4DMY A;  2HXZ A;  2OZ2 A;  2FYE A;  3N3G A;  1SP4 B;  3I06 A;  1IWD A;  1CS8 A;  2GHU A;  3PRM A;  4RNA A;  4AXL A;  4HWY A;  4OW0 A;  2AUZ A;  3GCB A;  4ZTB A;  1PVJ A;  1PPP A;  3BCN A;  5FPW A;  3KKU A;  3ZNH A;  2IBI A;  4K7C A;  4Q8G A;  3NHE A;  1SNK A;  2UZJ A;  2JTC A;  1NB3 A;  2E00 A;  3N3K A;  1F2A A;  4PT5 A;  5PAD A;  3M99 A;  3PRP A;  3I3T A;  4G54 A;  4BOP A;  1F2C A;  2NQG A;  4WUR A;  4PP1 A;  1ATK A;  1Q6K A;  2FTD A;  2DC7 A;  1O0E A;  1STF E;  4X6J A;  3PT2 A;  2R9M A;  3BWK A;  1QMY A;  3P5V A;  2DJF B;  5CHV A;  3QJ3 A;  3LXS A;  2AGA A;  2BTW B;  1NQC A;  4I05 A;  3HD3 A;  3CBK A;  2VHS A;  1AIM A;  1ZCM A;  1QXP A;  3CH3 X;  5A24 A;  2HH5 A;  2XU3 A;  2NQA A;  1CTE A;  1BY8 A;  3KX1 A;  1F29 A;  3BOW A;  3S3Q A;  3O65 A;  4MZS A;  2E01 A;  3OF8 A;  4D8I A;  1BP4 A;  4IUM A;  4BOQ A;  1YK7 A;  3MTN A;  2JRI A;  3D6S A;  4I04 A;  2H7J A;  2YJB A;  3F75 A;  2DC6 A;  4FK5 A;  5CVN B;  1EWO A;  3BB7 A;  1CPJ A;  2F1G A;  2G6D A;  4X6I A;  5EZQ A;  4YYU A;  4OVZ A;  2XU4 A;  5EZS A;  4IP3 A;  4BQV A;  2OP3 A;  2R9F A;  4RF0 A;  1KFX L;  4YVA A;  4WA6 A;  2JQF R;  3KSE A;  2B1N A;  3PHW A;  5F02 A;  5E6J A;  2HD5 A;  3V6E A;  2XU1 A;  2XU5 A;  3HWN A;  1PE6 A;  4OEM A;  3TRK A;  2G8E A;  2FUD A;  5JH3 A;  1U9Q X;  1PXV A;  1KHP A;  1GMY A;  3BPM A;  4MM3 B;  1FH0 A;  2YJC A;  2AVW A;  5J94 A;  2WBF X;  2ACT A;  2DJG B;  1CJL A;  1AEC A;  1F2B A;  1GLO A;  2E03 A;  8PCH A;  1QDQ A;  3H8B A;  4AXM A;  3OIS A;  1CB5 A;  1GCB A;  4R3D A;  3ERV A;  4P16 A;  2G7Y A;  1BQI A;  3AI8 A;  1PCI A;  3PW3 A;  1PAD A;  3MHS A;  4FJC A;  2DZZ A;  1JQP A;  3IUT A;  1THE A;  1PIP A;  5CVM A;  1U9V A;  1POP A;  1AU0 A;  3U8E A;  1EWM A;  4I07 A;  4REZ A;  3MP2 A;  3P5X A;  3W31 A;  3H89 A;  5JA7 A;  4GUA A;  1YAL A;  3WXF A;  2Y6E A;  3LFY A;  1U9W A;  3KWZ A;  4M0W A;  3K24 A;  4CDF B;  4YYS A;  1TL9 A;  1VJV A;  1GEC E;  2BU3 A;  2P0R A;  4QRG A;  2DC9 A;  3K8U A;  3H8C A;  2DZY A;  3ZUA A;  5JZE A;  1VSN A;  2P86 A;  2IPP B;  3B79 A;  1ICF A;  1MHW A;  1A6R A;  3BPF A;  4PP2 E;  4YYQ A;  3IOQ A;  4XZX A;  4CDE B;  1ZIV A;  4N8W A;  1PBH A;  1PPN A;  3K9M A;  3USV A;  2DCA A;  4MZO A;  3KW9 A;  2Y5B A;  3E1Z B;  5EGW A;  3S3R A;  2DCC A;  3V6C A;  3H7D A;  2F7D A;  4RY2 A;  4RF1 A;  4D8B A; 
#chains in the Genus database with same CATH homology
 2AU1 A;  1Y08 A;  3QT4 A;  3RVV A;  3PDF A;  2R6N A;  1MS6 A;  3D9W A;  2CB5 A;  1NLJ A;  4N79 A;  3HHA A;  1AU2 A;  3N4C A;  1KHQ A;  2DCB A;  4YV8 A;  2CIO A;  1NB5 A;  1DEU A;  4W5B A;  1CV8 A;  1QOL A;  2YJ9 A;  1K3B B;  3IMA A;  5CVO B;  7PCK A;  4KLB A;  4BS6 A;  3MOR A;  2AS8 A;  2P7U A;  4Q8H A;  2ARY A;  3MHH A;  4DMX A;  6PAD A;  2C0Y A;  3OVZ A;  1ME3 A;  4BS5 A;  4FIP A;  2BDL A;  2PNS A;  1EWL A;  1KFU L;  2PBH A;  1CQD A;  3IV2 A;  3CH2 X;  2G8J A;  1MEM A;  1S4V A;  5EF4 A;  1ITO A;  1EF7 A;  3CBJ A;  4QBB A;  4OEL A;  2FO5 A;  2PRE A;  1BGO A;  2FRQ A;  2R9O A;  1AU4 A;  3C9E A;  4XR7 A;  3PBH A;  4ZUX U;  5CHT A;  4B55 A;  2FT2 A;  3WXE A;  4QRX A;  1KXR A;  4YYR A;  2BDZ A;  3WXG A;  1U9X A;  2AIM A;  4W4U A;  1PPD A;  2YJ2 A;  4QRV A;  3BC3 A;  3KWB X;  3O1G A;  3IEJ A;  3P5U A;  4MSX A;  3QSD A;  2DC8 A;  2DCD A;  3O0U A;  4CZW A;  2R9N A;  2B1M A;  3DF0 A;  4YYW A;  2AYO A;  1DF0 A;  2HHN A;  2AYN A;  1EWP A;  3F5V A;  2NQI A;  3KFQ A;  1YT7 A;  2JQG R;  3H6S A;  1M6D A;  2O6X A;  4NV7 A;  2PAD A;  4P6G A;  2BSZ A;  1CSB B;  4BSQ A;  5K16 A;  1XKG A;  4PI3 A;  1MIR A;  4X6H A;  2YJ8 A;  1AYW A;  1TLO A;  2AUX A;  2FRA A;  4XUI A;  2NQD B;  1NPZ A;  3TNX A;  2R9C A;  1X9Y A;  4BPV A;  1AU3 A;  1AYV A;  4CDC B;  3RVX A;  2VFB A;  1W5R A;  2ATO A;  1HUC B;  1NL6 A;  1Y4H A;  2E02 A;  4PAD A;  1YK8 A;  3OF9 A;  4CDD B;  2VFC A;  4YYV A;  1CVZ A;  1U5I A;  1MEG A;  3OVX A;  9PAP A;  4N4Z A;  3HHI A;  1ME4 A;  3IHP A;  1AYU A;  1TU6 A;  4QH6 A;  3PNR A;  2FQ9 A;  1MDW A;  4P6E A;  3P5W A;  2VHF A;  4W5C A;  1E2T A;  2GFO A;  3RVW A;  2OUL A;  1PPO A;  1YVB A;  4DMY A;  2HXZ A;  2OZ2 A;  2FYE A;  3N3G A;  1SP4 B;  3I06 A;  1IWD A;  1CS8 A;  2GHU A;  4AXL A;  4HWY A;  2AUZ A;  3GCB A;  1PPP A;  3BCN A;  5FPW A;  3KKU A;  2IBI A;  4K7C A;  4Q8G A;  3NHE A;  1SNK A;  1NB3 A;  2E00 A;  3N3K A;  1F2A A;  5PAD A;  3M99 A;  3I3T A;  4G54 A;  1F2C A;  2NQG A;  4PP1 A;  1ATK A;  1Q6K A;  2FTD A;  2DC7 A;  1O0E A;  1STF E;  4X6J A;  2R9M A;  3BWK A;  1QMY A;  3P5V A;  1W4T A;  2DJF B;  5CHV A;  3QJ3 A;  3LXS A;  1NQC A;  4I05 A;  3HD3 A;  3CBK A;  2VHS A;  1AIM A;  1ZCM A;  1QXP A;  3CH3 X;  5A24 A;  2HH5 A;  2XU3 A;  2NQA A;  1CTE A;  1BY8 A;  3KX1 A;  1F29 A;  3BOW A;  3S3Q A;  4MZS A;  2E01 A;  3OF8 A;  1BP4 A;  1YK7 A;  3MTN A;  3D6S A;  4I04 A;  2H7J A;  2YJB A;  3F75 A;  2DC6 A;  4FK5 A;  5CVN B;  1EWO A;  1CPJ A;  2F1G A;  2G6D A;  4X6I A;  4YYU A;  2XU4 A;  4BQV A;  2OP3 A;  2R9F A;  1KFX L;  4YVA A;  4WA6 A;  2JQF R;  3KSE A;  2B1N A;  5F02 A;  2HD5 A;  1GX3 A;  3V6E A;  2XU1 A;  2XU5 A;  4BGF A;  3HWN A;  1PE6 A;  4OEM A;  2G8E A;  2FUD A;  5JH3 A;  1U9Q X;  1PXV A;  1KHP A;  1GMY A;  3BPM A;  4C5P A;  1FH0 A;  2YJC A;  2AVW A;  5J94 A;  2WBF X;  2ACT A;  2DJG B;  1CJL A;  1AEC A;  1F2B A;  1GLO A;  2E03 A;  8PCH A;  1QDQ A;  3H8B A;  4AXM A;  3OIS A;  1CB5 A;  1GCB A;  3ERV A;  3LTW A;  2G7Y A;  1BQI A;  3AI8 A;  1PCI A;  3PW3 A;  1PAD A;  3MHS A;  4FJC A;  2DZZ A;  1JQP A;  3IUT A;  1THE A;  1PIP A;  5CVM A;  1U9V A;  1POP A;  1AU0 A;  3U8E A;  1EWM A;  4I07 A;  3P5X A;  3H89 A;  5JA7 A;  1YAL A;  1W6F A;  3WXF A;  2Y6E A;  3LFY A;  1U9W A;  3KWZ A;  3K24 A;  4CDF B;  4YYS A;  1TL9 A;  1VJV A;  1GEC E;  2P0R A;  4QRG A;  2DC9 A;  3K8U A;  3H8C A;  2DZY A;  3ZUA A;  1VSN A;  4NV8 A;  2P86 A;  2IPP B;  3B79 A;  1ICF A;  1MHW A;  1A6R A;  3BPF A;  4PP2 E;  4YYQ A;  3IOQ A;  4CDE B;  1ZIV A;  4N8W A;  1PBH A;  1PPN A;  3K9M A;  4GUZ A;  3USV A;  2DCA A;  4MZO A;  3KW9 A;  2Y5B A;  3E1Z B;  5EGW A;  3S3R A;  2DCC A;  3V6C A;  3H7D A;  2F7D A;  4RY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...