1M6DA

Crystal structure of human cathepsin f
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
214
structure length
214
Chain Sequence
APPEWDWRSKGAVTKVKDQGMCGSCWAFSVTGNVEGQWFLNQGTLLSLSEQELLDCDKMDKACMGGLPSNAYSAIKNLGGLETEDDYSYQGHMQSCQFSAEKAKVYIQDSVELSQNEQKLAAWLAKRGPISVAINAFGMQFYRHGISRPLRPLCSPWLIDHAVLLVGYGQRSDVPFWAIKNSWGTDWGEKGYYYLHRGSGACGVNTMASSAVVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of human cathepsin F and its implications for the development of novel immunomodulators
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin F
total genus 63
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 3.4.22.41: Cathepsin F.
pdb deposition date 2002-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1m6dA00
4QRVA 1BP4A 2Y6EA 3ZUAA 5PADA 1PPOA 1NB3A 1EWLA 4CDFB 4DMXA 3N3GA 3N4CA 3D6SA 1F29A 4KLBA 4YYQA 2AS8A 1NQCA 1PPDA 1ICFA 3H8CA 2F7DA 2XU4A 2NQIA 3H8BA 1PPNA 3IOQA 3OVXA 1SP4B 3WXEA 3OISA 2YJBA 2E02A 4I05A 1CTEA 2PNSA 1U9VA 2DC8A 1PXVA 1BGOA 3HD3A 1AIMA 1DEUA 2PREA 2FUDA 2B1NA 2P0RA 3S3QA 4N79A 4OEMA 1CPJA 3DF0A 2CIOA 1ZIVA 1YT7A 1X9YA 2YJ9A 4X6HA 2IBIA 1AECA 1U9WA 2VHFA 1KHPA 1PADA 5F02A 2OP3A 3P5WA 3KX1A 2FT2A 1YALA 3BC3A 2DJGB 3H7DA 2G7YA 4BS6A 1CS8A 2DZZA 1GLOA 2DZYA 3K9MA 9PAPA 5CVMA 3WXGA 1Q6KA 1MEMA 3IEJA 1MEGA 3HHAA 3MHHA 2AUXA 3C9EA 3USVA 4XR7A 2H7JA 1QMYA 2E01A 2YJ2A 1QDQA 2ARYA 2JQFR 1GCBA 3AI8A 3I3TA 3F75A 5JH3A 1AU0A 1F2AA 1TU6A 4Q8GA 5A24A 3CBKA 2E03A 1Y08A 3BPMA 4X6IA 2DC7A 4CDDB 1CJLA 4BS5A 4XUIA 1AU3A 2DC6A 3WXFA 3HWNA 3H89A 3KFQA 4AXLA 1ME3A 1A6RA 2NQAA 5K16A 3LFYA 4YYUA 2B1MA 1AYVA 3QSDA 4PADA 1U9XA 5JA7A 1PIPA 2DCAA 3N3KA 3P5UA 4FJCA 1KFUL 1CB5A 1TL9A 2P86A 1AYUA 4RY2A 2ACTA 3NHEA 3MHSA 1VJVA 1SNKA 3PNRA 1YVBA 3RVWA 1MDWA 2NQDB 3PDFA 3M99A 3CBJA 4FIPA 3S3RA 4YV8A 1EWMA 1CSBB 4QH6A 2OULA 1ATKA 4CZWA 4QBBA 2HH5A 7PCKA 3TNXA 4BSQA 1KXRA 4MSXA 2C0YA 3OF9A 2DC9A 2NQGA 4MZOA 2R9NA 1FH0A 4W5CA 4AXMA 3KKUA 3P5XA 3V6EA 2JQGR 2DCCA 2ATOA 4G54A 1IWDA 2AUZA 2R9OA 3H6SA 1NB5A 2VHSA 2DCDA 4PP1A 3BPFA 1F2CA 3IUTA 3KWZA 4BQVA 1Y4HA 3OF8A 3CH2X 1JQPA 2AIMA 4X6JA 4DMYA 1GMYA 3BCNA 2FRAA 1EWOA 3KW9A 2Y5BA 3RVVA 2O6XA 4YYSA 4YYVA 1CQDA 1EF7A 4MZSA 1CV8A 1U5IA 2R9MA 1BQIA 3KWBX 5CVNB 3BOWA 2G8JA 4W5BA 2G6DA 5J94A 3PBHA 1STFE 4YVAA 2FYEA 2AVWA 3MTNA 1BY8A 4I04A 1AU4A 2FRQA 2GHUA 1MS6A 3PW3A 3MORA 1F2BA 2OZ2A 4P6GA 4YYWA 2HD5A 3IMAA 5CHVA 4BPVA 1QXPA 5CVOB 2GFOA 3U8EA 3OVZA 4PP2E 2F1GA 2BDZA 3IV2A 1ME4A 2P7UA 5FPWA 3E1ZB 2XU5A 3F5VA 3HHIA 8PCHA 3K8UA 4WA6A 1MHWA 3RVXA 1ITOA 1POPA 3QT4A 1PPPA 5CHTA 2WBFX 1PBHA 1NLJA 2XU1A 3K24A 5EGWA 3O0UA 3I06A 4YYRA 5EF4A 3B79A 2E00A 2HHNA 1KFXL 2AU1A 1PE6A 2PBHA 2HXZA 1XKGA 2FTDA 2IPPB 2XU3A 2YJ8A 4CDEB 6PADA 3O1GA 1NL6A 1O0EA 4W4UA 1NPZA 4Q8HA 1YK7A 2R6NA 1AU2A 1K3BB 1KHQA 1PCIA 1YK8A 3KSEA 2PADA 2FQ9A 4QRXA 4FK5A 2R9FA 3BWKA 1CVZA 1S4VA 3LXSA 1GECE 2AYOA 2YJCA 4OELA 4I07A 3ERVA 2DJFB 4K7CA 3CH3X 1TLOA 2FO5A 4QRGA 4ZUXU 2AYNA 4HWYA 1DF0A 3GCBA 2CB5A 3P5VA 1ZCMA 1M6DA 2BDLA 1MIRA 4CDCB 1VSNA 3QJ3A 4PI3A 2G8EA 3IHPA 1EWPA 2DCBA 1AYWA 1THEA 4P6EA 1QOLA 3V6CA 1U9QX 4N8WA 2R9CA 4N4ZA 1HUCB
chains in the Genus database with same CATH superfamily
4QRVA 1BP4A 2Y6EA 3ZUAA 5PADA 1PPOA 1NB3A 1EWLA 5EZQA 4CDFB 4DMXA 5KO3A 3IFUA 3N3GA 4WURA 3N4CA 3C0RA 3D6SA 1F29A 4KLBA 4YYQA 5E6JA 2AS8A 1NQCA 1PPDA 1ICFA 3H8CA 2F7DA 2XU4A 2NQIA 3H8BA 1PPNA 3IOQA 3OVXA 1SP4B 3WXEA 3OISA 2YJBA 2E02A 4I05A 1CTEA 2PNSA 1U9VA 2DC8A 1PXVA 1BGOA 3HD3A 1AIMA 1DEUA 2PREA 2FUDA 2B1NA 3E9SA 2P0RA 3MJ5A 3S3QA 4N79A 4OEMA 4R3DA 1CPJA 4GUAA 4RF0A 3DF0A 3PHWA 2CIOA 1ZIVA 1YT7A 1X9YA 2YJ9A 4X6HA 2IBIA 2BTWB 1AECA 1U9WA 2VHFA 1KHPA 1PADA 5F02A 2OP3A 3P5WA 3KX1A 2FT2A 1YALA 3BC3A 2DJGB 3H7DA 2G7YA 4BS6A 1CS8A 2DZZA 1GLOA 2DZYA 3K9MA 9PAPA 5CVMA 3WXGA 1Q6KA 4BOPA 1MEMA 3IEJA 4P16A 1MEGA 3HHAA 3MHHA 2AUXA 5JZEA 3C9EA 3USVA 4XR7A 2H7JA 4XZXA 1QMYA 2E01A 2DOSA 2YJ2A 3MTVA 1QDQA 2ARYA 2J7QC 2JQFR 1GCBA 3AI8A 3I3TA 3F75A 5JH3A 1AU0A 1F2AA 1TU6A 4Q8GA 5A24A 3CBKA 2E03A 1Y08A 3MP2A 3BPMA 3PRMA 4X6IA 2DC7A 4CDDB 1CJLA 4BS5A 4XUIA 1AU3A 2DC6A 3WXFA 2BTWA 3HWNA 3BY4A 3H89A 3KFQA 4AXLA 1ME3A 1A6RA 5EZSA 2NQAA 1YZBA 5K16A 3LFYA 4YYUA 2B1MA 2HWKA 1AYVA 3QSDA 3BB7A 4PADA 1U9XA 5JA7A 3TRKA 1PIPA 2DCAA 3N3KA 3P5UA 4FJCA 1KFUL 1CB5A 1TL9A 2P86A 1AYUA 4RY2A 2ACTA 3NHEA 4D8BA 3MHSA 1VJVA 1SNKA 3PNRA 1YVBA 3RVWA 1MDWA 2NQDB 3PDFA 3M99A 4BOQA 3CBJA 4FIPA 3S3RA 4YV8A 1EWMA 1CSBB 4D8EA 4QH6A 2JRIA 2OULA 1ATKA 4CZWA 4QBBA 3BBAA 2HH5A 7PCKA 3TNXA 4BOUA 4BSQA 1KXRA 4MSXA 2C0YA 3OF9A 4OVZB 2DC9A 2NQGA 4MZOA 2R9NA 1FH0A 4W5CA 4AXMA 3KKUA 3P5XA 3V6EA 2JQGR 2DCCA 2ATOA 4G54A 2FE8A 1IWDA 2AUZA 2R9OA 3H6SA 1NB5A 2VHSA 3PHXA 2DCDA 4PP1A 3BPFA 1F2CA 3IUTA 3KWZA 4BQVA 1Y4HA 3OF8A 3CH2X 1JQPA 2AIMA 4ZTBA 4X6JA 4BOZA 4DMYA 1GMYA 3BCNA 2FRAA 1EWOA 3KW9A 4OW0A 2Y5BA 3OQCA 3TMPA 3RVVA 2O6XA 4YYSA 4YYVA 1CQDA 3B21A 1EF7A 4MZSA 1CV8A 1U5IA 2R9MA 1BQIA 3KWBX 5CVNB 3BOWA 2G8JA 4W5BA 2G6DA 3PHUA 4PT5A 5J94A 4REZA 3PT2A 3PBHA 1STFE 4YVAA 2FYEA 2AVWA 3MTNA 1BY8A 4I04A 1AU4A 2FRQA 2GHUA 1MS6A 3PW3A 4BOSA 3MORA 1F2BA 2OZ2A 4P6GA 4YYWA 2HD5A 3W31A 3IMAA 5CHVA 4BPVA 1QXPA 5CVOB 2GFOA 3U8EA 3OVZA 4PP2E 2F1GA 4MM3B 2BDZA 3IV2A 1ME4A 2P7UA 4IP3A 5FPWA 3PRPA 3E1ZB 2XU5A 4MI7A 3F5VA 3HHIA 8PCHA 3K8UA 1MHWA 4WA6A 3RVXA 1ITOA 3O65A 2JTCA 1POPA 3QT4A 4HXDB 1PPPA 2AGAA 5CHTA 2WBFX 1PBHA 1NLJA 2XU1A 3K24A 5EGWA 3O0UA 4OVZA 3I06A 4YYRA 4RNAA 5EF4A 4RKXA 3B79A 1PVJA 2E00A 2HHNA 1KFXL 2AU1A 1PE6A 2PBHA 2HXZA 1XKGA 2FTDA 2IPPB 2XU3A 2YJ8A 4CDEB 6PADA 3O1GA 1NL6A 4M0WA 1O0EA 4W4UA 1NPZA 4Q8HA 1YK7A 2R6NA 1AU2A 1K3BB 1KHQA 2Z84A 1PCIA 1YK8A 3KSEA 4D8IA 2UZJA 2PADA 2FQ9A 4QRXA 4FK5A 2R9FA 3BWKA 1CVZA 1S4VA 3RNVA 3LXSA 1GECE 3PSEA 2AYOA 2YJCA 4OELA 4I07A 3ERVA 2DJFB 3W30A 4K7CA 3CH3X 1TLOA 2FO5A 4QRGA 4ZUXU 1DKIA 2AYNA 4HWYA 1DF0A 3GCBA 2CB5A 3P5VA 1ZCMA 1M6DA 2BDLA 2BU3A 1UKFA 4RF1A 3ZNHA 1MIRA 2J7QA 4CDCB 1VSNA 3QJ3A 4IUMA 4PI3A 2G8EA 3IHPA 1EWPA 2DCBA 1AYWA 1THEA 4P6EA 1QOLA 4A5UA 3V6CA 1U9QX 4N8WA 2R9CA 4N4ZA 1HUCB
chains in the Genus database with same CATH topology
4QRVA 1BP4A 2Y6EA 3ZUAA 5PADA 1PPOA 1NB3A 1W5RA 1EWLA 4CDFB 4DMXA 3N3GA 3N4CA 3D6SA 1F29A 4KLBA 4YYQA 2AS8A 1NQCA 1PPDA 1ICFA 3H8CA 2F7DA 2XU4A 2NQIA 3H8BA 1PPNA 3IOQA 3OVXA 1SP4B 3WXEA 3OISA 2YJBA 2E02A 4I05A 1CTEA 2PNSA 1U9VA 2DC8A 1PXVA 1BGOA 3HD3A 1AIMA 1DEUA 2PREA 2FUDA 2B1NA 2P0RA 3S3QA 4N79A 4OEMA 1CPJA 3DF0A 2CIOA 1ZIVA 1YT7A 1X9YA 2YJ9A 4X6HA 2IBIA 1AECA 1U9WA 2VHFA 1KHPA 1PADA 2VFCA 5F02A 2OP3A 3P5WA 3KX1A 2FT2A 1YALA 3BC3A 2DJGB 3H7DA 2G7YA 4BS6A 1CS8A 2DZZA 1GLOA 2DZYA 3K9MA 9PAPA 5CVMA 3WXGA 1Q6KA 1MEMA 3IEJA 1MEGA 3HHAA 3MHHA 2AUXA 3C9EA 3USVA 4XR7A 2H7JA 1QMYA 2E01A 2YJ2A 1QDQA 2ARYA 1W4TA 2JQFR 1GCBA 3AI8A 3I3TA 3F75A 5JH3A 1AU0A 1F2AA 1TU6A 4Q8GA 5A24A 3CBKA 2E03A 1Y08A 3BPMA 4X6IA 2DC7A 4CDDB 1CJLA 4BS5A 4XUIA 1AU3A 2DC6A 3WXFA 3HWNA 3H89A 3KFQA 4AXLA 1ME3A 1E2TA 1A6RA 2NQAA 1W6FA 5K16A 3LFYA 4YYUA 2B1MA 1AYVA 3QSDA 4PADA 1U9XA 5JA7A 1PIPA 2DCAA 3N3KA 4NV7A 3P5UA 4FJCA 1KFUL 1CB5A 1TL9A 2P86A 1AYUA 4RY2A 2ACTA 3NHEA 3MHSA 1VJVA 1SNKA 3PNRA 1YVBA 3RVWA 1MDWA 2NQDB 2BSZA 3PDFA 3M99A 3CBJA 4FIPA 3S3RA 4YV8A 1EWMA 1CSBB 4QH6A 2OULA 1ATKA 4CZWA 4QBBA 2HH5A 7PCKA 3TNXA 4BSQA 1KXRA 4MSXA 2C0YA 3OF9A 2DC9A 2NQGA 4MZOA 2R9NA 1FH0A 4W5CA 4AXMA 3LTWA 3KKUA 3P5XA 3V6EA 2JQGR 2DCCA 2ATOA 4G54A 1IWDA 2AUZA 2R9OA 3H6SA 1NB5A 2VHSA 2DCDA 4PP1A 3BPFA 1F2CA 3IUTA 3KWZA 4BQVA 1Y4HA 3OF8A 3CH2X 1JQPA 2AIMA 4X6JA 4DMYA 1GMYA 4NV8A 3BCNA 2FRAA 1EWOA 3KW9A 2Y5BA 3RVVA 4BGFA 2O6XA 4YYSA 4YYVA 1CQDA 1EF7A 4MZSA 1CV8A 1U5IA 2R9MA 1BQIA 3KWBX 5CVNB 3BOWA 2G8JA 4W5BA 2G6DA 5J94A 3PBHA 1STFE 4YVAA 2FYEA 2AVWA 3MTNA 1BY8A 4I04A 1AU4A 2FRQA 2GHUA 1MS6A 3PW3A 3MORA 1F2BA 4GUZA 2OZ2A 4P6GA 4YYWA 2HD5A 3IMAA 5CHVA 4BPVA 1QXPA 5CVOB 2GFOA 3U8EA 3OVZA 4PP2E 2F1GA 2BDZA 3IV2A 1ME4A 2P7UA 5FPWA 3E1ZB 4C5PA 2XU5A 4B55A 3F5VA 3HHIA 8PCHA 3K8UA 4WA6A 1MHWA 3RVXA 1ITOA 1POPA 3QT4A 1PPPA 5CHTA 2WBFX 1PBHA 1NLJA 2XU1A 3K24A 5EGWA 3O0UA 3I06A 4YYRA 5EF4A 3B79A 2E00A 2HHNA 1KFXL 2AU1A 1PE6A 2PBHA 2HXZA 1XKGA 2FTDA 2IPPB 2XU3A 2YJ8A 4CDEB 6PADA 3O1GA 1NL6A 1O0EA 4W4UA 1NPZA 4Q8HA 1YK7A 2R6NA 1AU2A 1K3BB 1KHQA 1PCIA 1YK8A 3KSEA 2PADA 2FQ9A 4QRXA 4FK5A 2R9FA 3BWKA 1CVZA 1S4VA 3LXSA 1GECE 2AYOA 2YJCA 4OELA 4I07A 3ERVA 2DJFB 4K7CA 3CH3X 1TLOA 2FO5A 4QRGA 4ZUXU 3D9WA 2AYNA 2VFBA 4HWYA 1GX3A 1DF0A 3GCBA 2CB5A 3P5VA 1ZCMA 1M6DA 2BDLA 1MIRA 4CDCB 1VSNA 3QJ3A 4PI3A 2G8EA 3IHPA 1EWPA 2DCBA 1AYWA 1THEA 4P6EA 1QOLA 3V6CA 1U9QX 4N8WA 2R9CA 4N4ZA 1HUCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QRV A;  1BP4 A;  2Y6E A;  3ZUA A;  5PAD A;  1PPO A;  1NB3 A;  1EWL A;  4CDF B;  4DMX A;  3N3G A;  3N4C A;  3D6S A;  1F29 A;  4KLB A;  4YYQ A;  2AS8 A;  1NQC A;  1PPD A;  1ICF A;  3H8C A;  2F7D A;  2XU4 A;  2NQI A;  3H8B A;  1PPN A;  3IOQ A;  3OVX A;  1SP4 B;  3WXE A;  3OIS A;  2YJB A;  2E02 A;  4I05 A;  1CTE A;  2PNS A;  1U9V A;  2DC8 A;  1PXV A;  1BGO A;  3HD3 A;  1AIM A;  1DEU A;  2PRE A;  2FUD A;  2B1N A;  2P0R A;  3S3Q A;  4N79 A;  4OEM A;  1CPJ A;  3DF0 A;  2CIO A;  1ZIV A;  1YT7 A;  1X9Y A;  2YJ9 A;  4X6H A;  2IBI A;  1AEC A;  1U9W A;  2VHF A;  1KHP A;  1PAD A;  5F02 A;  2OP3 A;  3P5W A;  3KX1 A;  2FT2 A;  1YAL A;  3BC3 A;  2DJG B;  3H7D A;  2G7Y A;  4BS6 A;  1CS8 A;  2DZZ A;  1GLO A;  2DZY A;  3K9M A;  9PAP A;  5CVM A;  3WXG A;  1Q6K A;  1MEM A;  3IEJ A;  1MEG A;  3HHA A;  3MHH A;  2AUX A;  3C9E A;  3USV A;  4XR7 A;  2H7J A;  1QMY A;  2E01 A;  2YJ2 A;  1QDQ A;  2ARY A;  2JQF R;  1GCB A;  3AI8 A;  3I3T A;  3F75 A;  5JH3 A;  1AU0 A;  1F2A A;  1TU6 A;  4Q8G A;  5A24 A;  3CBK A;  2E03 A;  1Y08 A;  3BPM A;  4X6I A;  2DC7 A;  4CDD B;  1CJL A;  4BS5 A;  4XUI A;  1AU3 A;  2DC6 A;  3WXF A;  3HWN A;  3H89 A;  3KFQ A;  4AXL A;  1ME3 A;  1A6R A;  2NQA A;  5K16 A;  3LFY A;  4YYU A;  2B1M A;  1AYV A;  3QSD A;  4PAD A;  1U9X A;  5JA7 A;  1PIP A;  2DCA A;  3N3K A;  3P5U A;  4FJC A;  1KFU L;  1CB5 A;  1TL9 A;  2P86 A;  1AYU A;  4RY2 A;  2ACT A;  3NHE A;  3MHS A;  1VJV A;  1SNK A;  3PNR A;  1YVB A;  3RVW A;  1MDW A;  2NQD B;  3PDF A;  3M99 A;  3CBJ A;  4FIP A;  3S3R A;  4YV8 A;  1EWM A;  1CSB B;  4QH6 A;  2OUL A;  1ATK A;  4CZW A;  4QBB A;  2HH5 A;  7PCK A;  3TNX A;  4BSQ A;  1KXR A;  4MSX A;  2C0Y A;  3OF9 A;  2DC9 A;  2NQG A;  4MZO A;  2R9N A;  1FH0 A;  4W5C A;  4AXM A;  3KKU A;  3P5X A;  3V6E A;  2JQG R;  2DCC A;  2ATO A;  4G54 A;  1IWD A;  2AUZ A;  2R9O A;  3H6S A;  1NB5 A;  2VHS A;  2DCD A;  4PP1 A;  3BPF A;  1F2C A;  3IUT A;  3KWZ A;  4BQV A;  1Y4H A;  3OF8 A;  3CH2 X;  1JQP A;  2AIM A;  4X6J A;  4DMY A;  1GMY A;  3BCN A;  2FRA A;  1EWO A;  3KW9 A;  2Y5B A;  3RVV A;  2O6X A;  4YYS A;  4YYV A;  1CQD A;  1EF7 A;  4MZS A;  1CV8 A;  1U5I A;  2R9M A;  1BQI A;  3KWB X;  5CVN B;  3BOW A;  2G8J A;  4W5B A;  2G6D A;  5J94 A;  3PBH A;  1STF E;  4YVA A;  2FYE A;  2AVW A;  3MTN A;  1BY8 A;  4I04 A;  1AU4 A;  2FRQ A;  2GHU A;  1MS6 A;  3PW3 A;  3MOR A;  1F2B A;  2OZ2 A;  4P6G A;  4YYW A;  2HD5 A;  3IMA A;  5CHV A;  4BPV A;  1QXP A;  5CVO B;  2GFO A;  3U8E A;  3OVZ A;  4PP2 E;  2F1G A;  2BDZ A;  3IV2 A;  1ME4 A;  2P7U A;  5FPW A;  3E1Z B;  2XU5 A;  3F5V A;  3HHI A;  8PCH A;  3K8U A;  4WA6 A;  1MHW A;  3RVX A;  1ITO A;  1POP A;  3QT4 A;  1PPP A;  5CHT A;  2WBF X;  1PBH A;  1NLJ A;  2XU1 A;  3K24 A;  5EGW A;  3O0U A;  3I06 A;  4YYR A;  5EF4 A;  3B79 A;  2E00 A;  2HHN A;  1KFX L;  2AU1 A;  1PE6 A;  2PBH A;  2HXZ A;  1XKG A;  2FTD A;  2IPP B;  2XU3 A;  2YJ8 A;  4CDE B;  6PAD A;  3O1G A;  1NL6 A;  1O0E A;  4W4U A;  1NPZ A;  4Q8H A;  1YK7 A;  2R6N A;  1AU2 A;  1K3B B;  1KHQ A;  1PCI A;  1YK8 A;  3KSE A;  2PAD A;  2FQ9 A;  4QRX A;  4FK5 A;  2R9F A;  3BWK A;  1CVZ A;  1S4V A;  3LXS A;  1GEC E;  2AYO A;  2YJC A;  4OEL A;  4I07 A;  3ERV A;  2DJF B;  4K7C A;  3CH3 X;  1TLO A;  2FO5 A;  4QRG A;  4ZUX U;  2AYN A;  4HWY A;  1DF0 A;  3GCB A;  2CB5 A;  3P5V A;  1ZCM A;  1M6D A;  2BDL A;  1MIR A;  4CDC B;  1VSN A;  3QJ3 A;  4PI3 A;  2G8E A;  3IHP A;  1EWP A;  2DCB A;  1AYW A;  1THE A;  4P6E A;  1QOL A;  3V6C A;  1U9Q X;  4N8W A;  2R9C A;  4N4Z A;  1HUC B; 
#chains in the Genus database with same CATH topology
 4QRV A;  1BP4 A;  2Y6E A;  3ZUA A;  5PAD A;  1PPO A;  1NB3 A;  1EWL A;  5EZQ A;  4CDF B;  4DMX A;  5KO3 A;  3IFU A;  3N3G A;  4WUR A;  3N4C A;  3C0R A;  3D6S A;  1F29 A;  4KLB A;  4YYQ A;  5E6J A;  2AS8 A;  1NQC A;  1PPD A;  1ICF A;  3H8C A;  2F7D A;  2XU4 A;  2NQI A;  3H8B A;  1PPN A;  3IOQ A;  3OVX A;  1SP4 B;  3WXE A;  3OIS A;  2YJB A;  2E02 A;  4I05 A;  1CTE A;  2PNS A;  1U9V A;  2DC8 A;  1PXV A;  1BGO A;  3HD3 A;  1AIM A;  1DEU A;  2PRE A;  2FUD A;  2B1N A;  3E9S A;  2P0R A;  3MJ5 A;  3S3Q A;  4N79 A;  4OEM A;  4R3D A;  1CPJ A;  4GUA A;  4RF0 A;  3DF0 A;  3PHW A;  2CIO A;  1ZIV A;  1YT7 A;  1X9Y A;  2YJ9 A;  4X6H A;  2IBI A;  2BTW B;  1AEC A;  1U9W A;  2VHF A;  1KHP A;  1PAD A;  5F02 A;  2OP3 A;  3P5W A;  3KX1 A;  2FT2 A;  1YAL A;  3BC3 A;  2DJG B;  3H7D A;  2G7Y A;  4BS6 A;  1CS8 A;  2DZZ A;  1GLO A;  2DZY A;  3K9M A;  9PAP A;  5CVM A;  3WXG A;  1Q6K A;  4BOP A;  1MEM A;  3IEJ A;  4P16 A;  1MEG A;  3HHA A;  3MHH A;  2AUX A;  5JZE A;  3C9E A;  3USV A;  4XR7 A;  2H7J A;  4XZX A;  1QMY A;  2E01 A;  2DOS A;  2YJ2 A;  3MTV A;  1QDQ A;  2ARY A;  2J7Q C;  2JQF R;  1GCB A;  3AI8 A;  3I3T A;  3F75 A;  5JH3 A;  1AU0 A;  1F2A A;  1TU6 A;  4Q8G A;  5A24 A;  3CBK A;  2E03 A;  1Y08 A;  3MP2 A;  3BPM A;  3PRM A;  4X6I A;  2DC7 A;  4CDD B;  1CJL A;  4BS5 A;  4XUI A;  1AU3 A;  2DC6 A;  3WXF A;  2BTW A;  3HWN A;  3BY4 A;  3H89 A;  3KFQ A;  4AXL A;  1ME3 A;  1A6R A;  5EZS A;  2NQA A;  1YZB A;  5K16 A;  3LFY A;  4YYU A;  2B1M A;  2HWK A;  1AYV A;  3QSD A;  3BB7 A;  4PAD A;  1U9X A;  5JA7 A;  3TRK A;  1PIP A;  2DCA A;  3N3K A;  3P5U A;  4FJC A;  1KFU L;  1CB5 A;  1TL9 A;  2P86 A;  1AYU A;  4RY2 A;  2ACT A;  3NHE A;  4D8B A;  3MHS A;  1VJV A;  1SNK A;  3PNR A;  1YVB A;  3RVW A;  1MDW A;  2NQD B;  3PDF A;  3M99 A;  4BOQ A;  3CBJ A;  4FIP A;  3S3R A;  4YV8 A;  1EWM A;  1CSB B;  4D8E A;  4QH6 A;  2JRI A;  2OUL A;  1ATK A;  4CZW A;  4QBB A;  3BBA A;  2HH5 A;  7PCK A;  3TNX A;  4BOU A;  4BSQ A;  1KXR A;  4MSX A;  2C0Y A;  3OF9 A;  4OVZ B;  2DC9 A;  2NQG A;  4MZO A;  2R9N A;  1FH0 A;  4W5C A;  4AXM A;  3KKU A;  3P5X A;  3V6E A;  2JQG R;  2DCC A;  2ATO A;  4G54 A;  2FE8 A;  1IWD A;  2AUZ A;  2R9O A;  3H6S A;  1NB5 A;  2VHS A;  3PHX A;  2DCD A;  4PP1 A;  3BPF A;  1F2C A;  3IUT A;  3KWZ A;  4BQV A;  1Y4H A;  3OF8 A;  3CH2 X;  1JQP A;  2AIM A;  4ZTB A;  4X6J A;  4BOZ A;  4DMY A;  1GMY A;  3BCN A;  2FRA A;  1EWO A;  3KW9 A;  4OW0 A;  2Y5B A;  3OQC A;  3TMP A;  3RVV A;  2O6X A;  4YYS A;  4YYV A;  1CQD A;  3B21 A;  1EF7 A;  4MZS A;  1CV8 A;  1U5I A;  2R9M A;  1BQI A;  3KWB X;  5CVN B;  3BOW A;  2G8J A;  4W5B A;  2G6D A;  3PHU A;  4PT5 A;  5J94 A;  4REZ A;  3PT2 A;  3PBH A;  1STF E;  4YVA A;  2FYE A;  2AVW A;  3MTN A;  1BY8 A;  4I04 A;  1AU4 A;  2FRQ A;  2GHU A;  1MS6 A;  3PW3 A;  4BOS A;  3MOR A;  1F2B A;  2OZ2 A;  4P6G A;  4YYW A;  2HD5 A;  3W31 A;  3IMA A;  5CHV A;  4BPV A;  1QXP A;  5CVO B;  2GFO A;  3U8E A;  3OVZ A;  4PP2 E;  2F1G A;  4MM3 B;  2BDZ A;  3IV2 A;  1ME4 A;  2P7U A;  4IP3 A;  5FPW A;  3PRP A;  3E1Z B;  2XU5 A;  4MI7 A;  3F5V A;  3HHI A;  8PCH A;  3K8U A;  1MHW A;  4WA6 A;  3RVX A;  1ITO A;  3O65 A;  2JTC A;  1POP A;  3QT4 A;  4HXD B;  1PPP A;  2AGA A;  5CHT A;  2WBF X;  1PBH A;  1NLJ A;  2XU1 A;  3K24 A;  5EGW A;  3O0U A;  4OVZ A;  3I06 A;  4YYR A;  4RNA A;  5EF4 A;  4RKX A;  3B79 A;  1PVJ A;  2E00 A;  2HHN A;  1KFX L;  2AU1 A;  1PE6 A;  2PBH A;  2HXZ A;  1XKG A;  2FTD A;  2IPP B;  2XU3 A;  2YJ8 A;  4CDE B;  6PAD A;  3O1G A;  1NL6 A;  4M0W A;  1O0E A;  4W4U A;  1NPZ A;  4Q8H A;  1YK7 A;  2R6N A;  1AU2 A;  1K3B B;  1KHQ A;  2Z84 A;  1PCI A;  1YK8 A;  3KSE A;  4D8I A;  2UZJ A;  2PAD A;  2FQ9 A;  4QRX A;  4FK5 A;  2R9F A;  3BWK A;  1CVZ A;  1S4V A;  3RNV A;  3LXS A;  1GEC E;  3PSE A;  2AYO A;  2YJC A;  4OEL A;  4I07 A;  3ERV A;  2DJF B;  3W30 A;  4K7C A;  3CH3 X;  1TLO A;  2FO5 A;  4QRG A;  4ZUX U;  1DKI A;  2AYN A;  4HWY A;  1DF0 A;  3GCB A;  2CB5 A;  3P5V A;  1ZCM A;  1M6D A;  2BDL A;  2BU3 A;  1UKF A;  4RF1 A;  3ZNH A;  1MIR A;  2J7Q A;  4CDC B;  1VSN A;  3QJ3 A;  4IUM A;  4PI3 A;  2G8E A;  3IHP A;  1EWP A;  2DCB A;  1AYW A;  1THE A;  4P6E A;  1QOL A;  4A5U A;  3V6C A;  1U9Q X;  4N8W A;  2R9C A;  4N4Z A;  1HUC B; 
#chains in the Genus database with same CATH homology
 4QRV A;  1BP4 A;  2Y6E A;  3ZUA A;  5PAD A;  1PPO A;  1NB3 A;  1W5R A;  1EWL A;  4CDF B;  4DMX A;  3N3G A;  3N4C A;  3D6S A;  1F29 A;  4KLB A;  4YYQ A;  2AS8 A;  1NQC A;  1PPD A;  1ICF A;  3H8C A;  2F7D A;  2XU4 A;  2NQI A;  3H8B A;  1PPN A;  3IOQ A;  3OVX A;  1SP4 B;  3WXE A;  3OIS A;  2YJB A;  2E02 A;  4I05 A;  1CTE A;  2PNS A;  1U9V A;  2DC8 A;  1PXV A;  1BGO A;  3HD3 A;  1AIM A;  1DEU A;  2PRE A;  2FUD A;  2B1N A;  2P0R A;  3S3Q A;  4N79 A;  4OEM A;  1CPJ A;  3DF0 A;  2CIO A;  1ZIV A;  1YT7 A;  1X9Y A;  2YJ9 A;  4X6H A;  2IBI A;  1AEC A;  1U9W A;  2VHF A;  1KHP A;  1PAD A;  2VFC A;  5F02 A;  2OP3 A;  3P5W A;  3KX1 A;  2FT2 A;  1YAL A;  3BC3 A;  2DJG B;  3H7D A;  2G7Y A;  4BS6 A;  1CS8 A;  2DZZ A;  1GLO A;  2DZY A;  3K9M A;  9PAP A;  5CVM A;  3WXG A;  1Q6K A;  1MEM A;  3IEJ A;  1MEG A;  3HHA A;  3MHH A;  2AUX A;  3C9E A;  3USV A;  4XR7 A;  2H7J A;  1QMY A;  2E01 A;  2YJ2 A;  1QDQ A;  2ARY A;  1W4T A;  2JQF R;  1GCB A;  3AI8 A;  3I3T A;  3F75 A;  5JH3 A;  1AU0 A;  1F2A A;  1TU6 A;  4Q8G A;  5A24 A;  3CBK A;  2E03 A;  1Y08 A;  3BPM A;  4X6I A;  2DC7 A;  4CDD B;  1CJL A;  4BS5 A;  4XUI A;  1AU3 A;  2DC6 A;  3WXF A;  3HWN A;  3H89 A;  3KFQ A;  4AXL A;  1ME3 A;  1E2T A;  1A6R A;  2NQA A;  1W6F A;  5K16 A;  3LFY A;  4YYU A;  2B1M A;  1AYV A;  3QSD A;  4PAD A;  1U9X A;  5JA7 A;  1PIP A;  2DCA A;  3N3K A;  4NV7 A;  3P5U A;  4FJC A;  1KFU L;  1CB5 A;  1TL9 A;  2P86 A;  1AYU A;  4RY2 A;  2ACT A;  3NHE A;  3MHS A;  1VJV A;  1SNK A;  3PNR A;  1YVB A;  3RVW A;  1MDW A;  2NQD B;  2BSZ A;  3PDF A;  3M99 A;  3CBJ A;  4FIP A;  3S3R A;  4YV8 A;  1EWM A;  1CSB B;  4QH6 A;  2OUL A;  1ATK A;  4CZW A;  4QBB A;  2HH5 A;  7PCK A;  3TNX A;  4BSQ A;  1KXR A;  4MSX A;  2C0Y A;  3OF9 A;  2DC9 A;  2NQG A;  4MZO A;  2R9N A;  1FH0 A;  4W5C A;  4AXM A;  3LTW A;  3KKU A;  3P5X A;  3V6E A;  2JQG R;  2DCC A;  2ATO A;  4G54 A;  1IWD A;  2AUZ A;  2R9O A;  3H6S A;  1NB5 A;  2VHS A;  2DCD A;  4PP1 A;  3BPF A;  1F2C A;  3IUT A;  3KWZ A;  4BQV A;  1Y4H A;  3OF8 A;  3CH2 X;  1JQP A;  2AIM A;  4X6J A;  4DMY A;  1GMY A;  4NV8 A;  3BCN A;  2FRA A;  1EWO A;  3KW9 A;  2Y5B A;  3RVV A;  4BGF A;  2O6X A;  4YYS A;  4YYV A;  1CQD A;  1EF7 A;  4MZS A;  1CV8 A;  1U5I A;  2R9M A;  1BQI A;  3KWB X;  5CVN B;  3BOW A;  2G8J A;  4W5B A;  2G6D A;  5J94 A;  3PBH A;  1STF E;  4YVA A;  2FYE A;  2AVW A;  3MTN A;  1BY8 A;  4I04 A;  1AU4 A;  2FRQ A;  2GHU A;  1MS6 A;  3PW3 A;  3MOR A;  1F2B A;  4GUZ A;  2OZ2 A;  4P6G A;  4YYW A;  2HD5 A;  3IMA A;  5CHV A;  4BPV A;  1QXP A;  5CVO B;  2GFO A;  3U8E A;  3OVZ A;  4PP2 E;  2F1G A;  2BDZ A;  3IV2 A;  1ME4 A;  2P7U A;  5FPW A;  3E1Z B;  4C5P A;  2XU5 A;  4B55 A;  3F5V A;  3HHI A;  8PCH A;  3K8U A;  4WA6 A;  1MHW A;  3RVX A;  1ITO A;  1POP A;  3QT4 A;  1PPP A;  5CHT A;  2WBF X;  1PBH A;  1NLJ A;  2XU1 A;  3K24 A;  5EGW A;  3O0U A;  3I06 A;  4YYR A;  5EF4 A;  3B79 A;  2E00 A;  2HHN A;  1KFX L;  2AU1 A;  1PE6 A;  2PBH A;  2HXZ A;  1XKG A;  2FTD A;  2IPP B;  2XU3 A;  2YJ8 A;  4CDE B;  6PAD A;  3O1G A;  1NL6 A;  1O0E A;  4W4U A;  1NPZ A;  4Q8H A;  1YK7 A;  2R6N A;  1AU2 A;  1K3B B;  1KHQ A;  1PCI A;  1YK8 A;  3KSE A;  2PAD A;  2FQ9 A;  4QRX A;  4FK5 A;  2R9F A;  3BWK A;  1CVZ A;  1S4V A;  3LXS A;  1GEC E;  2AYO A;  2YJC A;  4OEL A;  4I07 A;  3ERV A;  2DJF B;  4K7C A;  3CH3 X;  1TLO A;  2FO5 A;  4QRG A;  4ZUX U;  3D9W A;  2AYN A;  2VFB A;  4HWY A;  1GX3 A;  1DF0 A;  3GCB A;  2CB5 A;  3P5V A;  1ZCM A;  1M6D A;  2BDL A;  1MIR A;  4CDC B;  1VSN A;  3QJ3 A;  4PI3 A;  2G8E A;  3IHP A;  1EWP A;  2DCB A;  1AYW A;  1THE A;  4P6E A;  1QOL A;  3V6C A;  1U9Q X;  4N8W A;  2R9C A;  4N4Z A;  1HUC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...