1M6DA

Crystal structure of human cathepsin f
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
214
structure length
214
Chain Sequence
b'APPEWDWRSKGAVTKVKDQGMCGSCWAFSVTGNVEGQWFLNQGTLLSLSEQELLDCDKMDKACMGGLPSNAYSAIKNLGGLETEDDYSYQGHMQSCQFSAEKAKVYIQDSVELSQNEQKLAAWLAKRGPISVAINAFGMQFYRHGISRPLRPLCSPWLIDHAVLLVGYGQRSDVPFWAIKNSWGTDWGEKGYYYLHRGSGACGVNTMASSAVVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of human cathepsin F and its implications for the development of novel immunomodulators
pubmed doi rcsb
molecule keywords Cathepsin F
source organism Homo sapiens
molecule tags Hydrolase
total genus 63
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 3.4.22.41: Cathepsin F.
pdb deposition date 2002-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1m6dA00
9PAPA 5F02A 1U9VA 2GFOA 2DCCA 1A6RA 3F5VA 4Q8GA 1Y4HA 2NQIA 3BPFA 2XU1A 3ERVA 4P6GA 1AU4A 5CVMA 3E1ZB 2PNSA 1KHQA 1GLOA 2ARYA 1PPNA 5CHVA 4QRVA 2AUZA 3CBJA 2VHFA 1MHWA 3KKUA 2R9NA 4DMYA 3KW9A 2DC6A 1F2BA 1PPPA 2R9CA 4CDCB 3QSDA 1AU2A 1AYUA 1GECE 3WXEA 1VJVA 2G7YA 3H8CA 1U9XA 3PDFA 3U8EA 1TLOA 2G8EA 2WBFX 3CH3X 1CV8A 2R6NA 5J94A 4Q8HA 4CDDB 4MZOA 3OISA 1Q6KA 2PBHA 3WXFA 1NLJA 4I07A 4BS5A 2YJCA 4KLBA 1CVZA 2E01A 4CDEB 4K7CA 5CVNB 3B79A 1PADA 3ZUAA 4I04A 3IEJA 1EWMA 2O6XA 4FJCA 3MTNA 4ZUXU 1MEGA 4CDFB 3BWKA 1YK7A 4YYRA 2B1MA 3KSEA 1PE6A 5CHTA 4BS6A 3CBKA 3BCNA 4QBBA 1CSBB 1MS6A 1XKGA 2HD5A 2DCBA 4OELA 2AVWA 1YALA 3HHAA 4FIPA 4YYWA 2FQ9A 4YYUA 4I05A 3P5UA 2VHSA 2Y6EA 2DZZA 2H7JA 2R9FA 4RY2A 1KHPA 2YJ2A 1NQCA 1NB5A 1TU6A 3GCBA 1KXRA 2CIOA 1ITOA 3MHSA 3KWBX 3O0UA 3F75A 4YYVA 1Y08A 2R9OA 1QOLA 4PI3A 3K24A 1YVBA 4X6IA 2HH5A 1CTEA 1AU3A 4YV8A 4X6HA 1CB5A 1QDQA 3OVZA 1NL6A 2DCDA 3NHEA 1GMYA 5A24A 1PPOA 3C9EA 2IPPB 2R9MA 3RVVA 1PIPA 4XUIA 1F2CA 2GHUA 1ZIVA 4CZWA 1BGOA 2PREA 1S4VA 4DMXA 2HHNA 3TNXA 3IMAA 1ZCMA 4P6EA 2NQDB 4YYQA 2YJ9A 4WA6A 1IWDA 3KFQA 3LFYA 3H7DA 2Y5BA 2XU4A 2AU1A 1EWLA 1PBHA 2NQAA 2NQGA 2AS8A 2AYNA 4OEMA 1EF7A 2E03A 1SP4B 3M99A 1M6DA 4MSXA 2FYEA 2P86A 3KWZA 3IHPA 3V6CA 3D6SA 1PPDA 3AI8A 1ME4A 3I06A 2AIMA 3CH2X 2XU3A 5EGWA 1F29A 3QJ3A 2PADA 1MEMA 3HHIA 4N8WA 3KX1A 5FPWA 1NB3A 1CPJA 2AUXA 1QXPA 1U9QX 3OF9A 2G6DA 2YJ8A 3K9MA 4PADA 3K8UA 1YK8A 3IUTA 4FK5A 1K3BB 2DC7A 2OP3A 3N3KA 3H89A 2FRQA 1EWOA 1QMYA 4XR7A 3USVA 1ATKA 2DC8A 2FRAA 1U5IA 3P5WA 1STFE 5JA7A 1FH0A 1BY8A 1O0EA 2FT2A 4HWYA 2FTDA 5K16A 2E02A 3O1GA 3PW3A 2DJGB 1THEA 3P5XA 3HWNA 3RVWA 4BQVA 1POPA 2HXZA 1EWPA 1KFUL 1JQPA 2F1GA 2JQGR 3N4CA 1MIRA 3BC3A 3DF0A 3BOWA 2P7UA 1DEUA 1ME3A 2ACTA 1CJLA 1U9WA 2BDLA 1AYVA 2JQFR 2BDZA 3V6EA 8PCHA 1VSNA 2FO5A 4AXMA 1F2AA 2F7DA 4PP2E 2DZYA 4QRGA 2G8JA 1ICFA 3IOQA 1MDWA 2IBIA 4N79A 4QH6A 4YVAA 3IV2A 1X9YA 1BP4A 2ATOA 4PP1A 5CVOB 5EF4A 3S3RA 2OULA 1AECA 1SNKA 1KFXL 1AU0A 2XU5A 2CB5A 5PADA 2E00A 3I3TA 3N3GA 1PXVA 2C0YA 3LXSA 6PADA 2DCAA 7PCKA 1GCBA 4G54A 1HUCB 3HD3A 4MZSA 3QT4A 2DC9A 2YJBA 3MORA 4AXLA 1BQIA 4W5CA 4W5BA 4BSQA 3PBHA 2DJFB 1TL9A 1NPZA 3MHHA 4QRXA 1YT7A 3WXGA 2FUDA 4X6JA 3RVXA 4YYSA 3BPMA 2P0RA 3H8BA 2B1NA 4W4UA 2AYOA 3OF8A 1DF0A 2OZ2A 1AIMA 4N4ZA 3PNRA 1AYWA 1CS8A 3P5VA 4BPVA 5JH3A 3S3QA 1PCIA 3H6SA 1CQDA 3OVXA
chains in the Genus database with same CATH superfamily
9PAPA 5F02A 1U9VA 2Z84A 2GFOA 3W30A 2DCCA 1A6RA 2BU3A 3F5VA 3PHWA 1Y4HA 4Q8GA 2NQIA 3BPFA 2XU1A 3RNVA 3ZNHA 3ERVA 4P6GA 1AU4A 5CVMA 3E1ZB 2PNSA 2JRIA 2UZJA 1KHQA 1GLOA 4A5UA 2ARYA 1PPNA 4M0WA 5CHVA 4GUAA 4QRVA 2AUZA 3CBJA 2VHFA 1MHWA 3KKUA 2R9NA 4DMYA 5KO3A 3KW9A 2DC6A 1F2BA 1PPPA 2R9CA 3OQCA 4CDCB 3QSDA 1AU2A 1AYUA 1GECE 3WXEA 1VJVA 2G7YA 2FE8A 3H8CA 1U9XA 3PDFA 3U8EA 1TLOA 2G8EA 2WBFX 3CH3X 1CV8A 2R6NA 5J94A 3C0RA 4Q8HA 5E6JA 2J7QA 4CDDB 4MZOA 3OISA 1Q6KA 2PBHA 3WXFA 1NLJA 4I07A 4BS5A 2YJCA 4KLBA 1CVZA 2E01A 3BBAA 4CDEB 4K7CA 5CVNB 3B79A 1PADA 3ZUAA 4I04A 3B21A 3IEJA 1EWMA 2O6XA 4FJCA 3MTNA 4ZUXU 4RKXA 1MEGA 3BY4A 4CDFB 3BWKA 4RNAA 1YK7A 2AGAA 4YYRA 2B1MA 3KSEA 1PE6A 5CHTA 4BS6A 3CBKA 4D8IA 3BCNA 4QBBA 1CSBB 1MS6A 1XKGA 2HD5A 2DCBA 3PSEA 4OELA 2AVWA 1YALA 3HHAA 4FIPA 4YYWA 4OVZA 2FQ9A 3TRKA 4YYUA 4I05A 3P5UA 2VHSA 2Y6EA 2DZZA 2H7JA 2R9FA 4RY2A 1KHPA 2YJ2A 1NQCA 1NB5A 1TU6A 3GCBA 1KXRA 2CIOA 1ITOA 3MHSA 3KWBX 3O0UA 3F75A 4YYVA 1Y08A 2R9OA 1QOLA 4PI3A 3K24A 3E9SA 1YVBA 4X6IA 2HH5A 1CTEA 5EZQA 4R3DA 1AU3A 4YV8A 4X6HA 1CB5A 1QDQA 3OVZA 1NL6A 2DCDA 3NHEA 1GMYA 5A24A 4WURA 1PPOA 3C9EA 2IPPB 2R9MA 3RVVA 1PIPA 4XUIA 1F2CA 2GHUA 1ZIVA 4CZWA 1BGOA 2PREA 4BOQA 1S4VA 4REZA 4DMXA 4OVZB 1YZBA 2HHNA 3TNXA 3IMAA 1ZCMA 4P6EA 2NQDB 4YYQA 2YJ9A 4WA6A 1IWDA 3KFQA 3LFYA 3H7DA 2Y5BA 2XU4A 2AU1A 1EWLA 1PBHA 2NQAA 2NQGA 4RF1A 2AS8A 2AYNA 4OEMA 1EF7A 2E03A 1SP4B 3M99A 1M6DA 4MSXA 2FYEA 2P86A 3KWZA 3IHPA 2DOSA 3V6CA 3D6SA 1PPDA 3AI8A 1ME4A 3I06A 2AIMA 3CH2X 2XU3A 5EGWA 1F29A 3QJ3A 2PADA 1MEMA 3HHIA 4N8WA 4BOZA 3KX1A 5FPWA 1NB3A 1CPJA 2AUXA 4D8BA 1QXPA 1U9QX 3OF9A 2G6DA 2YJ8A 3K9MA 4PADA 3K8UA 1YK8A 3IUTA 4FK5A 1K3BB 2DC7A 2OP3A 3N3KA 3H89A 2FRQA 1EWOA 1QMYA 4MM3B 5JZEA 4XR7A 3USVA 1ATKA 2DC8A 2FRAA 1U5IA 3P5WA 1STFE 5JA7A 1FH0A 1BY8A 2HWKA 1O0EA 3PRPA 2FT2A 2BTWA 4HWYA 2FTDA 5K16A 2E02A 3O1GA 3PW3A 2DJGB 1THEA 3P5XA 4XZXA 3BB7A 3HWNA 3RVWA 4BQVA 1POPA 3MP2A 4PT5A 4D8EA 2HXZA 1EWPA 1KFUL 1JQPA 2F1GA 4HXDB 2JQGR 3N4CA 1MIRA 3BC3A 3DF0A 3BOWA 2P7UA 1DEUA 1ME3A 2ACTA 1CJLA 1U9WA 2BDLA 1AYVA 2JQFR 2BDZA 4P16A 3V6EA 8PCHA 1VSNA 2FO5A 4AXMA 1F2AA 2F7DA 4PP2E 2DZYA 4IP3A 4QRGA 2G8JA 1ICFA 3IOQA 2BTWB 1MDWA 2IBIA 2JTCA 4N79A 1UKFA 4QH6A 4YVAA 3IV2A 1X9YA 1BP4A 2ATOA 4PP1A 5CVOB 5EF4A 3S3RA 2OULA 1AECA 1SNKA 1PVJA 1KFXL 1AU0A 2XU5A 3PHUA 2CB5A 3O65A 5PADA 2E00A 4IUMA 3TMPA 3I3TA 3N3GA 1PXVA 2C0YA 4BOSA 3LXSA 2J7QC 4MI7A 6PADA 3MJ5A 2DCAA 7PCKA 1DKIA 1GCBA 1HUCB 3HD3A 4G54A 4BOUA 3MTVA 4MZSA 3QT4A 2DC9A 3PRMA 2YJBA 3MORA 4AXLA 1BQIA 3PT2A 4W5CA 4W5BA 4BSQA 3W31A 3IFUA 3PBHA 5EZSA 2DJFB 1TL9A 1NPZA 3MHHA 3PHXA 4QRXA 4ZTBA 1YT7A 3WXGA 2FUDA 4X6JA 3RVXA 4YYSA 3BPMA 2P0RA 3H8BA 2B1NA 4W4UA 4RF0A 2AYOA 4OW0A 4BOPA 3OF8A 1DF0A 2OZ2A 1AIMA 4N4ZA 3PNRA 1AYWA 1CS8A 3P5VA 4BPVA 5JH3A 3S3QA 1PCIA 3H6SA 1CQDA 3OVXA
chains in the Genus database with same CATH topology
9PAPA 5F02A 1U9VA 2GFOA 2VFCA 2DCCA 1A6RA 3F5VA 4Q8GA 1Y4HA 2NQIA 3BPFA 2XU1A 3ERVA 4P6GA 1AU4A 5CVMA 3E1ZB 2PNSA 1KHQA 1GLOA 2ARYA 1PPNA 5CHVA 4QRVA 2AUZA 3CBJA 2VHFA 1MHWA 3KKUA 2R9NA 4DMYA 3KW9A 2DC6A 1F2BA 1PPPA 2R9CA 4CDCB 3QSDA 1AU2A 1AYUA 1GECE 3WXEA 1VJVA 2G7YA 3H8CA 1U9XA 3PDFA 4B55A 3U8EA 1TLOA 2G8EA 2WBFX 3CH3X 1CV8A 2R6NA 5J94A 4Q8HA 4CDDB 4MZOA 3OISA 1Q6KA 2PBHA 3WXFA 1NLJA 4I07A 4BS5A 2YJCA 4KLBA 1CVZA 2E01A 4CDEB 4K7CA 5CVNB 3B79A 1PADA 3ZUAA 4I04A 3IEJA 1EWMA 2O6XA 4FJCA 3LTWA 3MTNA 4ZUXU 1MEGA 4CDFB 3BWKA 1YK7A 4YYRA 4NV8A 2B1MA 3KSEA 1PE6A 5CHTA 4BS6A 3CBKA 3BCNA 4QBBA 1CSBB 1MS6A 1XKGA 2HD5A 2DCBA 4OELA 2AVWA 4BGFA 1YALA 3HHAA 4FIPA 4YYWA 2FQ9A 4YYUA 4I05A 3P5UA 1E2TA 2VHSA 2Y6EA 2DZZA 2H7JA 2R9FA 4RY2A 1KHPA 2YJ2A 1NQCA 1NB5A 1TU6A 3GCBA 1KXRA 2CIOA 1ITOA 3MHSA 3KWBX 3O0UA 3F75A 4YYVA 1Y08A 2R9OA 1QOLA 4PI3A 3K24A 1YVBA 4X6IA 2HH5A 1CTEA 1AU3A 4YV8A 4X6HA 1CB5A 1QDQA 3OVZA 1NL6A 2DCDA 3NHEA 1GMYA 5A24A 1PPOA 3C9EA 2IPPB 2R9MA 3RVVA 1PIPA 4XUIA 1F2CA 2GHUA 1ZIVA 4CZWA 1BGOA 3D9WA 2PREA 1S4VA 4DMXA 2HHNA 3TNXA 3IMAA 1ZCMA 4P6EA 2NQDB 4YYQA 2YJ9A 4WA6A 1IWDA 3KFQA 1W4TA 3LFYA 3H7DA 2Y5BA 2XU4A 2AU1A 1EWLA 1PBHA 2NQAA 2NQGA 2AS8A 2AYNA 4OEMA 1EF7A 2E03A 1SP4B 3M99A 1M6DA 4MSXA 2FYEA 2P86A 3KWZA 2BSZA 3IHPA 3V6CA 3D6SA 1PPDA 3AI8A 1ME4A 3I06A 2AIMA 3CH2X 2XU3A 5EGWA 1F29A 3QJ3A 2PADA 1MEMA 3HHIA 4N8WA 3KX1A 5FPWA 1NB3A 1CPJA 2AUXA 1GX3A 1QXPA 1U9QX 3OF9A 2G6DA 2YJ8A 3K9MA 4PADA 3K8UA 1YK8A 3IUTA 4FK5A 1K3BB 2DC7A 2OP3A 3N3KA 3H89A 2FRQA 1EWOA 1QMYA 4GUZA 4XR7A 3USVA 1ATKA 2DC8A 2FRAA 1U5IA 3P5WA 1STFE 5JA7A 1FH0A 1BY8A 1O0EA 2FT2A 4HWYA 2FTDA 5K16A 2E02A 3O1GA 3PW3A 2DJGB 1THEA 3P5XA 3HWNA 3RVWA 4BQVA 1POPA 2HXZA 1EWPA 1KFUL 1JQPA 2F1GA 2JQGR 3N4CA 1MIRA 3BC3A 3DF0A 3BOWA 2P7UA 1DEUA 1ME3A 2ACTA 1CJLA 1U9WA 2BDLA 1AYVA 2JQFR 2BDZA 3V6EA 8PCHA 1VSNA 2FO5A 4AXMA 1F2AA 2F7DA 4PP2E 2DZYA 4QRGA 2VFBA 2G8JA 1ICFA 1W5RA 3IOQA 1MDWA 2IBIA 4N79A 4QH6A 4YVAA 3IV2A 1X9YA 1BP4A 2ATOA 4PP1A 5CVOB 5EF4A 3S3RA 2OULA 1AECA 1SNKA 1KFXL 1AU0A 2XU5A 2CB5A 5PADA 2E00A 3I3TA 3N3GA 1PXVA 2C0YA 3LXSA 6PADA 2DCAA 7PCKA 1GCBA 4G54A 1HUCB 3HD3A 4NV7A 4MZSA 3QT4A 2DC9A 2YJBA 3MORA 4AXLA 1BQIA 4W5CA 1W6FA 4W5BA 4BSQA 3PBHA 2DJFB 1TL9A 1NPZA 3MHHA 4QRXA 1YT7A 3WXGA 2FUDA 4X6JA 3RVXA 4YYSA 3BPMA 2P0RA 3H8BA 2B1NA 4W4UA 2AYOA 3OF8A 1DF0A 2OZ2A 1AIMA 4N4ZA 3PNRA 1AYWA 1CS8A 3P5VA 4BPVA 4C5PA 5JH3A 3S3QA 1PCIA 3H6SA 1CQDA 3OVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 9PAP A;  5F02 A;  1U9V A;  2GFO A;  2DCC A;  1A6R A;  3F5V A;  4Q8G A;  1Y4H A;  2NQI A;  3BPF A;  2XU1 A;  3ERV A;  4P6G A;  1AU4 A;  5CVM A;  3E1Z B;  2PNS A;  1KHQ A;  1GLO A;  2ARY A;  1PPN A;  5CHV A;  4QRV A;  2AUZ A;  3CBJ A;  2VHF A;  1MHW A;  3KKU A;  2R9N A;  4DMY A;  3KW9 A;  2DC6 A;  1F2B A;  1PPP A;  2R9C A;  4CDC B;  3QSD A;  1AU2 A;  1AYU A;  1GEC E;  3WXE A;  1VJV A;  2G7Y A;  3H8C A;  1U9X A;  3PDF A;  3U8E A;  1TLO A;  2G8E A;  2WBF X;  3CH3 X;  1CV8 A;  2R6N A;  5J94 A;  4Q8H A;  4CDD B;  4MZO A;  3OIS A;  1Q6K A;  2PBH A;  3WXF A;  1NLJ A;  4I07 A;  4BS5 A;  2YJC A;  4KLB A;  1CVZ A;  2E01 A;  4CDE B;  4K7C A;  5CVN B;  3B79 A;  1PAD A;  3ZUA A;  4I04 A;  3IEJ A;  1EWM A;  2O6X A;  4FJC A;  3MTN A;  4ZUX U;  1MEG A;  4CDF B;  3BWK A;  1YK7 A;  4YYR A;  2B1M A;  3KSE A;  1PE6 A;  5CHT A;  4BS6 A;  3CBK A;  3BCN A;  4QBB A;  1CSB B;  1MS6 A;  1XKG A;  2HD5 A;  2DCB A;  4OEL A;  2AVW A;  1YAL A;  3HHA A;  4FIP A;  4YYW A;  2FQ9 A;  4YYU A;  4I05 A;  3P5U A;  2VHS A;  2Y6E A;  2DZZ A;  2H7J A;  2R9F A;  4RY2 A;  1KHP A;  2YJ2 A;  1NQC A;  1NB5 A;  1TU6 A;  3GCB A;  1KXR A;  2CIO A;  1ITO A;  3MHS A;  3KWB X;  3O0U A;  3F75 A;  4YYV A;  1Y08 A;  2R9O A;  1QOL A;  4PI3 A;  3K24 A;  1YVB A;  4X6I A;  2HH5 A;  1CTE A;  1AU3 A;  4YV8 A;  4X6H A;  1CB5 A;  1QDQ A;  3OVZ A;  1NL6 A;  2DCD A;  3NHE A;  1GMY A;  5A24 A;  1PPO A;  3C9E A;  2IPP B;  2R9M A;  3RVV A;  1PIP A;  4XUI A;  1F2C A;  2GHU A;  1ZIV A;  4CZW A;  1BGO A;  2PRE A;  1S4V A;  4DMX A;  2HHN A;  3TNX A;  3IMA A;  1ZCM A;  4P6E A;  2NQD B;  4YYQ A;  2YJ9 A;  4WA6 A;  1IWD A;  3KFQ A;  3LFY A;  3H7D A;  2Y5B A;  2XU4 A;  2AU1 A;  1EWL A;  1PBH A;  2NQA A;  2NQG A;  2AS8 A;  2AYN A;  4OEM A;  1EF7 A;  2E03 A;  1SP4 B;  3M99 A;  1M6D A;  4MSX A;  2FYE A;  2P86 A;  3KWZ A;  3IHP A;  3V6C A;  3D6S A;  1PPD A;  3AI8 A;  1ME4 A;  3I06 A;  2AIM A;  3CH2 X;  2XU3 A;  5EGW A;  1F29 A;  3QJ3 A;  2PAD A;  1MEM A;  3HHI A;  4N8W A;  3KX1 A;  5FPW A;  1NB3 A;  1CPJ A;  2AUX A;  1QXP A;  1U9Q X;  3OF9 A;  2G6D A;  2YJ8 A;  3K9M A;  4PAD A;  3K8U A;  1YK8 A;  3IUT A;  4FK5 A;  1K3B B;  2DC7 A;  2OP3 A;  3N3K A;  3H89 A;  2FRQ A;  1EWO A;  1QMY A;  4XR7 A;  3USV A;  1ATK A;  2DC8 A;  2FRA A;  1U5I A;  3P5W A;  1STF E;  5JA7 A;  1FH0 A;  1BY8 A;  1O0E A;  2FT2 A;  4HWY A;  2FTD A;  5K16 A;  2E02 A;  3O1G A;  3PW3 A;  2DJG B;  1THE A;  3P5X A;  3HWN A;  3RVW A;  4BQV A;  1POP A;  2HXZ A;  1EWP A;  1KFU L;  1JQP A;  2F1G A;  2JQG R;  3N4C A;  1MIR A;  3BC3 A;  3DF0 A;  3BOW A;  2P7U A;  1DEU A;  1ME3 A;  2ACT A;  1CJL A;  1U9W A;  2BDL A;  1AYV A;  2JQF R;  2BDZ A;  3V6E A;  8PCH A;  1VSN A;  2FO5 A;  4AXM A;  1F2A A;  2F7D A;  4PP2 E;  2DZY A;  4QRG A;  2G8J A;  1ICF A;  3IOQ A;  1MDW A;  2IBI A;  4N79 A;  4QH6 A;  4YVA A;  3IV2 A;  1X9Y A;  1BP4 A;  2ATO A;  4PP1 A;  5CVO B;  5EF4 A;  3S3R A;  2OUL A;  1AEC A;  1SNK A;  1KFX L;  1AU0 A;  2XU5 A;  2CB5 A;  5PAD A;  2E00 A;  3I3T A;  3N3G A;  1PXV A;  2C0Y A;  3LXS A;  6PAD A;  2DCA A;  7PCK A;  1GCB A;  4G54 A;  1HUC B;  3HD3 A;  4MZS A;  3QT4 A;  2DC9 A;  2YJB A;  3MOR A;  4AXL A;  1BQI A;  4W5C A;  4W5B A;  4BSQ A;  3PBH A;  2DJF B;  1TL9 A;  1NPZ A;  3MHH A;  4QRX A;  1YT7 A;  3WXG A;  2FUD A;  4X6J A;  3RVX A;  4YYS A;  3BPM A;  2P0R A;  3H8B A;  2B1N A;  4W4U A;  2AYO A;  3OF8 A;  1DF0 A;  2OZ2 A;  1AIM A;  4N4Z A;  3PNR A;  1AYW A;  1CS8 A;  3P5V A;  4BPV A;  5JH3 A;  3S3Q A;  1PCI A;  3H6S A;  1CQD A;  3OVX A; 
#chains in the Genus database with same CATH topology
 9PAP A;  5F02 A;  1U9V A;  2Z84 A;  2GFO A;  3W30 A;  2DCC A;  1A6R A;  2BU3 A;  3F5V A;  3PHW A;  1Y4H A;  4Q8G A;  2NQI A;  3BPF A;  2XU1 A;  3RNV A;  3ZNH A;  3ERV A;  4P6G A;  1AU4 A;  5CVM A;  3E1Z B;  2PNS A;  2JRI A;  2UZJ A;  1KHQ A;  1GLO A;  4A5U A;  2ARY A;  1PPN A;  4M0W A;  5CHV A;  4GUA A;  4QRV A;  2AUZ A;  3CBJ A;  2VHF A;  1MHW A;  3KKU A;  2R9N A;  4DMY A;  5KO3 A;  3KW9 A;  2DC6 A;  1F2B A;  1PPP A;  2R9C A;  3OQC A;  4CDC B;  3QSD A;  1AU2 A;  1AYU A;  1GEC E;  3WXE A;  1VJV A;  2G7Y A;  2FE8 A;  3H8C A;  1U9X A;  3PDF A;  3U8E A;  1TLO A;  2G8E A;  2WBF X;  3CH3 X;  1CV8 A;  2R6N A;  5J94 A;  3C0R A;  4Q8H A;  5E6J A;  2J7Q A;  4CDD B;  4MZO A;  3OIS A;  1Q6K A;  2PBH A;  3WXF A;  1NLJ A;  4I07 A;  4BS5 A;  2YJC A;  4KLB A;  1CVZ A;  2E01 A;  3BBA A;  4CDE B;  4K7C A;  5CVN B;  3B79 A;  1PAD A;  3ZUA A;  4I04 A;  3B21 A;  3IEJ A;  1EWM A;  2O6X A;  4FJC A;  3MTN A;  4ZUX U;  4RKX A;  1MEG A;  3BY4 A;  4CDF B;  3BWK A;  4RNA A;  1YK7 A;  2AGA A;  4YYR A;  2B1M A;  3KSE A;  1PE6 A;  5CHT A;  4BS6 A;  3CBK A;  4D8I A;  3BCN A;  4QBB A;  1CSB B;  1MS6 A;  1XKG A;  2HD5 A;  2DCB A;  3PSE A;  4OEL A;  2AVW A;  1YAL A;  3HHA A;  4FIP A;  4YYW A;  4OVZ A;  2FQ9 A;  3TRK A;  4YYU A;  4I05 A;  3P5U A;  2VHS A;  2Y6E A;  2DZZ A;  2H7J A;  2R9F A;  4RY2 A;  1KHP A;  2YJ2 A;  1NQC A;  1NB5 A;  1TU6 A;  3GCB A;  1KXR A;  2CIO A;  1ITO A;  3MHS A;  3KWB X;  3O0U A;  3F75 A;  4YYV A;  1Y08 A;  2R9O A;  1QOL A;  4PI3 A;  3K24 A;  3E9S A;  1YVB A;  4X6I A;  2HH5 A;  1CTE A;  5EZQ A;  4R3D A;  1AU3 A;  4YV8 A;  4X6H A;  1CB5 A;  1QDQ A;  3OVZ A;  1NL6 A;  2DCD A;  3NHE A;  1GMY A;  5A24 A;  4WUR A;  1PPO A;  3C9E A;  2IPP B;  2R9M A;  3RVV A;  1PIP A;  4XUI A;  1F2C A;  2GHU A;  1ZIV A;  4CZW A;  1BGO A;  2PRE A;  4BOQ A;  1S4V A;  4REZ A;  4DMX A;  4OVZ B;  1YZB A;  2HHN A;  3TNX A;  3IMA A;  1ZCM A;  4P6E A;  2NQD B;  4YYQ A;  2YJ9 A;  4WA6 A;  1IWD A;  3KFQ A;  3LFY A;  3H7D A;  2Y5B A;  2XU4 A;  2AU1 A;  1EWL A;  1PBH A;  2NQA A;  2NQG A;  4RF1 A;  2AS8 A;  2AYN A;  4OEM A;  1EF7 A;  2E03 A;  1SP4 B;  3M99 A;  1M6D A;  4MSX A;  2FYE A;  2P86 A;  3KWZ A;  3IHP A;  2DOS A;  3V6C A;  3D6S A;  1PPD A;  3AI8 A;  1ME4 A;  3I06 A;  2AIM A;  3CH2 X;  2XU3 A;  5EGW A;  1F29 A;  3QJ3 A;  2PAD A;  1MEM A;  3HHI A;  4N8W A;  4BOZ A;  3KX1 A;  5FPW A;  1NB3 A;  1CPJ A;  2AUX A;  4D8B A;  1QXP A;  1U9Q X;  3OF9 A;  2G6D A;  2YJ8 A;  3K9M A;  4PAD A;  3K8U A;  1YK8 A;  3IUT A;  4FK5 A;  1K3B B;  2DC7 A;  2OP3 A;  3N3K A;  3H89 A;  2FRQ A;  1EWO A;  1QMY A;  4MM3 B;  5JZE A;  4XR7 A;  3USV A;  1ATK A;  2DC8 A;  2FRA A;  1U5I A;  3P5W A;  1STF E;  5JA7 A;  1FH0 A;  1BY8 A;  2HWK A;  1O0E A;  3PRP A;  2FT2 A;  2BTW A;  4HWY A;  2FTD A;  5K16 A;  2E02 A;  3O1G A;  3PW3 A;  2DJG B;  1THE A;  3P5X A;  4XZX A;  3BB7 A;  3HWN A;  3RVW A;  4BQV A;  1POP A;  3MP2 A;  4PT5 A;  4D8E A;  2HXZ A;  1EWP A;  1KFU L;  1JQP A;  2F1G A;  4HXD B;  2JQG R;  3N4C A;  1MIR A;  3BC3 A;  3DF0 A;  3BOW A;  2P7U A;  1DEU A;  1ME3 A;  2ACT A;  1CJL A;  1U9W A;  2BDL A;  1AYV A;  2JQF R;  2BDZ A;  4P16 A;  3V6E A;  8PCH A;  1VSN A;  2FO5 A;  4AXM A;  1F2A A;  2F7D A;  4PP2 E;  2DZY A;  4IP3 A;  4QRG A;  2G8J A;  1ICF A;  3IOQ A;  2BTW B;  1MDW A;  2IBI A;  2JTC A;  4N79 A;  1UKF A;  4QH6 A;  4YVA A;  3IV2 A;  1X9Y A;  1BP4 A;  2ATO A;  4PP1 A;  5CVO B;  5EF4 A;  3S3R A;  2OUL A;  1AEC A;  1SNK A;  1PVJ A;  1KFX L;  1AU0 A;  2XU5 A;  3PHU A;  2CB5 A;  3O65 A;  5PAD A;  2E00 A;  4IUM A;  3TMP A;  3I3T A;  3N3G A;  1PXV A;  2C0Y A;  4BOS A;  3LXS A;  2J7Q C;  4MI7 A;  6PAD A;  3MJ5 A;  2DCA A;  7PCK A;  1DKI A;  1GCB A;  1HUC B;  3HD3 A;  4G54 A;  4BOU A;  3MTV A;  4MZS A;  3QT4 A;  2DC9 A;  3PRM A;  2YJB A;  3MOR A;  4AXL A;  1BQI A;  3PT2 A;  4W5C A;  4W5B A;  4BSQ A;  3W31 A;  3IFU A;  3PBH A;  5EZS A;  2DJF B;  1TL9 A;  1NPZ A;  3MHH A;  3PHX A;  4QRX A;  4ZTB A;  1YT7 A;  3WXG A;  2FUD A;  4X6J A;  3RVX A;  4YYS A;  3BPM A;  2P0R A;  3H8B A;  2B1N A;  4W4U A;  4RF0 A;  2AYO A;  4OW0 A;  4BOP A;  3OF8 A;  1DF0 A;  2OZ2 A;  1AIM A;  4N4Z A;  3PNR A;  1AYW A;  1CS8 A;  3P5V A;  4BPV A;  5JH3 A;  3S3Q A;  1PCI A;  3H6S A;  1CQD A;  3OVX A; 
#chains in the Genus database with same CATH homology
 9PAP A;  5F02 A;  1U9V A;  2GFO A;  2VFC A;  2DCC A;  1A6R A;  3F5V A;  4Q8G A;  1Y4H A;  2NQI A;  3BPF A;  2XU1 A;  3ERV A;  4P6G A;  1AU4 A;  5CVM A;  3E1Z B;  2PNS A;  1KHQ A;  1GLO A;  2ARY A;  1PPN A;  5CHV A;  4QRV A;  2AUZ A;  3CBJ A;  2VHF A;  1MHW A;  3KKU A;  2R9N A;  4DMY A;  3KW9 A;  2DC6 A;  1F2B A;  1PPP A;  2R9C A;  4CDC B;  3QSD A;  1AU2 A;  1AYU A;  1GEC E;  3WXE A;  1VJV A;  2G7Y A;  3H8C A;  1U9X A;  3PDF A;  4B55 A;  3U8E A;  1TLO A;  2G8E A;  2WBF X;  3CH3 X;  1CV8 A;  2R6N A;  5J94 A;  4Q8H A;  4CDD B;  4MZO A;  3OIS A;  1Q6K A;  2PBH A;  3WXF A;  1NLJ A;  4I07 A;  4BS5 A;  2YJC A;  4KLB A;  1CVZ A;  2E01 A;  4CDE B;  4K7C A;  5CVN B;  3B79 A;  1PAD A;  3ZUA A;  4I04 A;  3IEJ A;  1EWM A;  2O6X A;  4FJC A;  3LTW A;  3MTN A;  4ZUX U;  1MEG A;  4CDF B;  3BWK A;  1YK7 A;  4YYR A;  4NV8 A;  2B1M A;  3KSE A;  1PE6 A;  5CHT A;  4BS6 A;  3CBK A;  3BCN A;  4QBB A;  1CSB B;  1MS6 A;  1XKG A;  2HD5 A;  2DCB A;  4OEL A;  2AVW A;  4BGF A;  1YAL A;  3HHA A;  4FIP A;  4YYW A;  2FQ9 A;  4YYU A;  4I05 A;  3P5U A;  1E2T A;  2VHS A;  2Y6E A;  2DZZ A;  2H7J A;  2R9F A;  4RY2 A;  1KHP A;  2YJ2 A;  1NQC A;  1NB5 A;  1TU6 A;  3GCB A;  1KXR A;  2CIO A;  1ITO A;  3MHS A;  3KWB X;  3O0U A;  3F75 A;  4YYV A;  1Y08 A;  2R9O A;  1QOL A;  4PI3 A;  3K24 A;  1YVB A;  4X6I A;  2HH5 A;  1CTE A;  1AU3 A;  4YV8 A;  4X6H A;  1CB5 A;  1QDQ A;  3OVZ A;  1NL6 A;  2DCD A;  3NHE A;  1GMY A;  5A24 A;  1PPO A;  3C9E A;  2IPP B;  2R9M A;  3RVV A;  1PIP A;  4XUI A;  1F2C A;  2GHU A;  1ZIV A;  4CZW A;  1BGO A;  3D9W A;  2PRE A;  1S4V A;  4DMX A;  2HHN A;  3TNX A;  3IMA A;  1ZCM A;  4P6E A;  2NQD B;  4YYQ A;  2YJ9 A;  4WA6 A;  1IWD A;  3KFQ A;  1W4T A;  3LFY A;  3H7D A;  2Y5B A;  2XU4 A;  2AU1 A;  1EWL A;  1PBH A;  2NQA A;  2NQG A;  2AS8 A;  2AYN A;  4OEM A;  1EF7 A;  2E03 A;  1SP4 B;  3M99 A;  1M6D A;  4MSX A;  2FYE A;  2P86 A;  3KWZ A;  2BSZ A;  3IHP A;  3V6C A;  3D6S A;  1PPD A;  3AI8 A;  1ME4 A;  3I06 A;  2AIM A;  3CH2 X;  2XU3 A;  5EGW A;  1F29 A;  3QJ3 A;  2PAD A;  1MEM A;  3HHI A;  4N8W A;  3KX1 A;  5FPW A;  1NB3 A;  1CPJ A;  2AUX A;  1GX3 A;  1QXP A;  1U9Q X;  3OF9 A;  2G6D A;  2YJ8 A;  3K9M A;  4PAD A;  3K8U A;  1YK8 A;  3IUT A;  4FK5 A;  1K3B B;  2DC7 A;  2OP3 A;  3N3K A;  3H89 A;  2FRQ A;  1EWO A;  1QMY A;  4GUZ A;  4XR7 A;  3USV A;  1ATK A;  2DC8 A;  2FRA A;  1U5I A;  3P5W A;  1STF E;  5JA7 A;  1FH0 A;  1BY8 A;  1O0E A;  2FT2 A;  4HWY A;  2FTD A;  5K16 A;  2E02 A;  3O1G A;  3PW3 A;  2DJG B;  1THE A;  3P5X A;  3HWN A;  3RVW A;  4BQV A;  1POP A;  2HXZ A;  1EWP A;  1KFU L;  1JQP A;  2F1G A;  2JQG R;  3N4C A;  1MIR A;  3BC3 A;  3DF0 A;  3BOW A;  2P7U A;  1DEU A;  1ME3 A;  2ACT A;  1CJL A;  1U9W A;  2BDL A;  1AYV A;  2JQF R;  2BDZ A;  3V6E A;  8PCH A;  1VSN A;  2FO5 A;  4AXM A;  1F2A A;  2F7D A;  4PP2 E;  2DZY A;  4QRG A;  2VFB A;  2G8J A;  1ICF A;  1W5R A;  3IOQ A;  1MDW A;  2IBI A;  4N79 A;  4QH6 A;  4YVA A;  3IV2 A;  1X9Y A;  1BP4 A;  2ATO A;  4PP1 A;  5CVO B;  5EF4 A;  3S3R A;  2OUL A;  1AEC A;  1SNK A;  1KFX L;  1AU0 A;  2XU5 A;  2CB5 A;  5PAD A;  2E00 A;  3I3T A;  3N3G A;  1PXV A;  2C0Y A;  3LXS A;  6PAD A;  2DCA A;  7PCK A;  1GCB A;  4G54 A;  1HUC B;  3HD3 A;  4NV7 A;  4MZS A;  3QT4 A;  2DC9 A;  2YJB A;  3MOR A;  4AXL A;  1BQI A;  4W5C A;  1W6F A;  4W5B A;  4BSQ A;  3PBH A;  2DJF B;  1TL9 A;  1NPZ A;  3MHH A;  4QRX A;  1YT7 A;  3WXG A;  2FUD A;  4X6J A;  3RVX A;  4YYS A;  3BPM A;  2P0R A;  3H8B A;  2B1N A;  4W4U A;  2AYO A;  3OF8 A;  1DF0 A;  2OZ2 A;  1AIM A;  4N4Z A;  3PNR A;  1AYW A;  1CS8 A;  3P5V A;  4BPV A;  4C5P A;  5JH3 A;  3S3Q A;  1PCI A;  3H6S A;  1CQD A;  3OVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...