1M6DA

Crystal structure of human cathepsin f
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
214
structure length
214
Chain Sequence
APPEWDWRSKGAVTKVKDQGMCGSCWAFSVTGNVEGQWFLNQGTLLSLSEQELLDCDKMDKACMGGLPSNAYSAIKNLGGLETEDDYSYQGHMQSCQFSAEKAKVYIQDSVELSQNEQKLAAWLAKRGPISVAINAFGMQFYRHGISRPLRPLCSPWLIDHAVLLVGYGQRSDVPFWAIKNSWGTDWGEKGYYYLHRGSGACGVNTMASSAVVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin F
publication title The crystal structure of human cathepsin F and its implications for the development of novel immunomodulators
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 3.4.22.41: Cathepsin F.
pdb deposition date 2002-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1m6dA00
2R9NA 1PPDA 3D6SA 3HHIA 2FRQA 1EWOA 4YVAA 2Y5BA 4OEMA 4CDFB 4Q8GA 3P5WA 1X9YA 2E02A 2OZ2A 4FIPA 1TLOA 4HWYA 1THEA 2E03A 4I04A 1AU0A 2YJ9A 4AXLA 2GHUA 5EF4A 1MEMA 1EWMA 1BQIA 3MHHA 4FK5A 4YYSA 2BDZA 2DC8A 2PNSA 3ERVA 4WA6A 2FO5A 1F2BA 4I07A 2DC7A 4RY2A 1JQPA 5CVNB 4W4UA 1STFE 1DEUA 2B1MA 1DF0A 1CVZA 2Y6EA 2G8JA 3V6CA 3BC3A 3DF0A 2YJBA 3P5UA 2AYOA 1ZCMA 3CH3X 1BP4A 1ICFA 1QMYA 3PNRA 1YVBA 5K16A 5F02A 2YJ2A 2WBFX 1AYWA 3P5XA 3OVZA 1F2AA 4YYVA 1O0EA 3PDFA 2F1GA 4XR7A 4QRVA 4MSXA 1U9XA 3KX1A 2JQFR 2DJFB 3KFQA 3H8BA 1ME4A 4P6GA 3OISA 4CDDB 2ARYA 2DCCA 2G6DA 5A24A 1AU2A 1NB3A 2XU5A 2FUDA 2XU1A 2DC6A 1KHQA 1ZIVA 2FQ9A 3BPFA 2HXZA 1MDWA 3M99A 1NPZA 3HD3A 1Y08A 2H7JA 3OF8A 2NQDB 2AVWA 1ATKA 2CB5A 2P86A 1HUCB 1VSNA 3H8CA 3K8UA 1S4VA 2DCAA 2ACTA 1PADA 1YK8A 3AI8A 3HHAA 4G54A 1M6DA 3WXEA 1U5IA 2NQIA 4CDCB 2R9MA 2HD5A 1QOLA 5EGWA 1QXPA 4PP2E 4X6JA 1SNKA 4MZOA 4K7CA 3LXSA 3NHEA 3N4CA 1Y4HA 1MHWA 1NB5A 2AS8A 1NLJA 2YJCA 1KHPA 4N4ZA 1NQCA 1AU3A 1K3BB 3ZUAA 4YYRA 1KFXL 5JA7A 3PBHA 1NL6A 4YYQA 1F29A 1PBHA 3RVVA 6PADA 4FJCA 5FPWA 3P5VA 4DMXA 2E01A 1GECE 3IOQA 1BGOA 1YALA 2O6XA 3CBKA 3KWZA 2PBHA 2P0RA 2AUZA 3O1GA 2AIMA 5CHVA 1CJLA 2R6NA 3LFYA 1KXRA 4ZUXU 1GMYA 4W5BA 4X6IA 1PCIA 1GCBA 3IV2A 1CPJA 1AIMA 3K24A 4QH6A 3KW9A 3QT4A 1KFUL 3CH2X 3MTNA 3PW3A 2R9FA 3IEJA 5CVOB 1PPNA 4CDEB 1MS6A 5CVMA 5PADA 3WXFA 2DZYA 2C0YA 3C9EA 2YJ8A 4XUIA 3O0UA 4Q8HA 3S3QA 3MORA 2CIOA 1MIRA 2P7UA 3IUTA 1CSBB 2FYEA 1FH0A 4YYUA 1EWLA 3S3RA 2R9OA 2IBIA 1U9QX 4KLBA 1POPA 1U9WA 1TU6A 4P6EA 4W5CA 5J94A 1IWDA 2GFOA 2DJGB 2IPPB 1ME3A 2BDLA 1PIPA 2G8EA 4N79A 2G7YA 1PXVA 3OVXA 4DMYA 1AU4A 3N3KA 2JQGR 1EWPA 3H89A 3IHPA 2B1NA 2AU1A 2NQAA 2AYNA 3KWBX 4I05A 1SP4B 3GCBA 3U8EA 1F2CA 3V6EA 2OP3A 2FT2A 9PAPA 2HHNA 3I3TA 3TNXA 1CTEA 3BPMA 1A6RA 1BY8A 1AECA 3BCNA 3BWKA 2ATOA 4PADA 1PPOA 4QBBA 1PPPA 2E00A 4BPVA 1CS8A 2FRAA 3N3GA 4CZWA 1ITOA 4N8WA 1U9VA 7PCKA 3KSEA 2DCBA 3RVWA 3MHSA 4PI3A 8PCHA 1CB5A 1PE6A 2DZZA 3HWNA 1AYVA 4BQVA 3QSDA 1XKGA 3QJ3A 1YK7A 3IMAA 3BOWA 4BS6A 3USVA 2FTDA 1Q6KA 3K9MA 3B79A 2PREA 3I06A 1EF7A 2NQGA 3CBJA 5CHTA 2XU4A 2OULA 2VHSA 2PADA 1CQDA 4MZSA 2DCDA 4BS5A 4YYWA 3H6SA 4QRGA 3F75A 5JH3A 3F5VA 2XU3A 2HH5A 2VHFA 2F7DA 2R9CA 1CV8A 3OF9A 1GLOA 3RVXA 2DC9A 4YV8A 1TL9A 1AYUA 3E1ZB 4BSQA 4PP1A 4QRXA 3WXGA 1VJVA 4OELA 3KKUA 1MEGA 1YT7A 2AUXA 4AXMA 3H7DA 4X6HA 1QDQA
chains in the Genus database with same CATH superfamily
2R9NA 1PPDA 3D6SA 3HHIA 2FRQA 1EWOA 4YVAA 2Y5BA 3BBAA 3PHXA 3TRKA 4OEMA 4CDFB 4Q8GA 3P5WA 1X9YA 2E02A 2OZ2A 4FIPA 1TLOA 4HWYA 1THEA 2E03A 4I04A 1AU0A 2YJ9A 4AXLA 2GHUA 5EF4A 1MEMA 1DKIA 1EWMA 1BQIA 3MHHA 4FK5A 4YYSA 2BDZA 2DC8A 2PNSA 4IUMA 4MM3B 3IFUA 3ERVA 3PRPA 3PRMA 4WA6A 4OVZB 2FO5A 1F2BA 4I07A 2DC7A 4RY2A 1JQPA 5CVNB 4W4UA 1STFE 1DEUA 4RF1A 2B1MA 1DF0A 1UKFA 3OQCA 1CVZA 4IP3A 2Y6EA 2G8JA 3V6CA 4HXDB 3BC3A 3DF0A 2YJBA 3P5UA 2AYOA 1ZCMA 3CH3X 1BP4A 1ICFA 1QMYA 3PNRA 1YVBA 2DOSA 5K16A 3E9SA 5F02A 2YJ2A 2WBFX 1AYWA 3P5XA 3OVZA 1F2AA 4YYVA 1O0EA 3PDFA 2F1GA 4XR7A 4XZXA 4QRVA 4MSXA 1U9XA 3KX1A 2JQFR 2DJFB 3KFQA 3H8BA 1ME4A 4P6GA 3OISA 4CDDB 2ARYA 2DCCA 4PT5A 2G6DA 2J7QC 5A24A 1AU2A 1NB3A 2XU5A 2FUDA 2XU1A 2DC6A 1KHQA 1ZIVA 2FQ9A 3BPFA 2HXZA 1MDWA 3M99A 1NPZA 3HD3A 1Y08A 2BTWA 2H7JA 3OF8A 2NQDB 2AVWA 1ATKA 2CB5A 4WURA 2P86A 1HUCB 1VSNA 3H8CA 3K8UA 1YZBA 4BOUA 1S4VA 2DCAA 2ACTA 2FE8A 1PADA 1YK8A 3AI8A 3HHAA 4G54A 1M6DA 3WXEA 1U5IA 2NQIA 4CDCB 2R9MA 2HD5A 1QOLA 5EGWA 1QXPA 2Z84A 4PP2E 4X6JA 1SNKA 4MZOA 4K7CA 3LXSA 3NHEA 3N4CA 1Y4HA 1MHWA 4R3DA 1NB5A 2AS8A 1NLJA 2YJCA 1KHPA 4N4ZA 3C0RA 1NQCA 1AU3A 1K3BB 3ZUAA 4BOZA 4YYRA 1KFXL 5JA7A 3PBHA 5EZQA 1NL6A 4YYQA 1F29A 1PBHA 4BOQA 3RVVA 6PADA 3ZNHA 4FJCA 5FPWA 3P5VA 4DMXA 2E01A 1GECE 3IOQA 1BGOA 1YALA 2O6XA 3CBKA 3KWZA 2PBHA 2P0RA 3O65A 2AUZA 3O1GA 2AIMA 2HWKA 5CHVA 2BU3A 1CJLA 2R6NA 3LFYA 1KXRA 4ZUXU 1GMYA 4W5BA 4X6IA 1PCIA 1GCBA 3IV2A 1CPJA 1AIMA 3K24A 4QH6A 5JZEA 3KW9A 3QT4A 1KFUL 3CH2X 3MTNA 3PW3A 2AGAA 2R9FA 3IEJA 5CVOB 1PPNA 4CDEB 1MS6A 3BB7A 4RNAA 5CVMA 5PADA 2BTWB 3WXFA 2DZYA 2C0YA 2JTCA 3C9EA 2YJ8A 4XUIA 3O0UA 4REZA 4Q8HA 4P16A 3S3QA 3MORA 2CIOA 1MIRA 5EZSA 2P7UA 3IUTA 1CSBB 2FYEA 1FH0A 4YYUA 1EWLA 3S3RA 3MJ5A 2R9OA 2IBIA 1U9QX 4KLBA 1POPA 1U9WA 3TMPA 1TU6A 4P6EA 4W5CA 5J94A 1IWDA 2GFOA 2DJGB 2IPPB 1ME3A 3PHUA 3PHWA 2BDLA 1PIPA 2G8EA 4N79A 2G7YA 1PXVA 3OVXA 2JRIA 1PVJA 4DMYA 1AU4A 3N3KA 4RF0A 2JQGR 1EWPA 3H89A 3IHPA 2B1NA 2AU1A 2NQAA 2AYNA 3KWBX 4I05A 1SP4B 3GCBA 3U8EA 1F2CA 3V6EA 2OP3A 2UZJA 4MI7A 2FT2A 9PAPA 2HHNA 3I3TA 3TNXA 1CTEA 3BPMA 1A6RA 3PSEA 3MTVA 4D8EA 4BOPA 1BY8A 1AECA 3BCNA 3BWKA 3RNVA 2ATOA 4PADA 3B21A 1PPOA 4QBBA 1PPPA 2E00A 4BPVA 1CS8A 3MP2A 2FRAA 3N3GA 3W31A 4CZWA 1ITOA 4N8WA 1U9VA 7PCKA 3KSEA 2DCBA 3RVWA 3MHSA 4PI3A 8PCHA 1CB5A 1PE6A 4D8IA 2DZZA 4GUAA 3HWNA 4OW0A 4RKXA 1AYVA 4BQVA 3QSDA 4ZTBA 1XKGA 3QJ3A 1YK7A 3IMAA 3BOWA 4BS6A 3USVA 2FTDA 1Q6KA 3K9MA 3B79A 3PT2A 2PREA 3I06A 1EF7A 3W30A 4OVZA 2NQGA 3CBJA 5CHTA 2XU4A 2OULA 2VHSA 2PADA 1CQDA 4MZSA 2DCDA 4BS5A 4D8BA 4YYWA 5KO3A 3H6SA 4M0WA 2J7QA 4QRGA 3F75A 5JH3A 3F5VA 2XU3A 2HH5A 2VHFA 2F7DA 2R9CA 1CV8A 3OF9A 1GLOA 4BOSA 3RVXA 2DC9A 4YV8A 1TL9A 1AYUA 3BY4A 3E1ZB 4BSQA 4PP1A 4QRXA 3WXGA 1VJVA 4OELA 3KKUA 4A5UA 1MEGA 5E6JA 1YT7A 2AUXA 4AXMA 3H7DA 4X6HA 1QDQA
chains in the Genus database with same CATH topology
2R9NA 1PPDA 3D6SA 3HHIA 2FRQA 1EWOA 4YVAA 2Y5BA 4NV7A 4OEMA 4CDFB 4Q8GA 3P5WA 1X9YA 2E02A 2OZ2A 4FIPA 1TLOA 4HWYA 1THEA 2E03A 4I04A 1AU0A 2YJ9A 4AXLA 2GHUA 5EF4A 1MEMA 1EWMA 1BQIA 3MHHA 4FK5A 4YYSA 2BDZA 2DC8A 2PNSA 3ERVA 4WA6A 2FO5A 1F2BA 4I07A 2DC7A 4RY2A 1JQPA 5CVNB 4W4UA 1STFE 1DEUA 2B1MA 1DF0A 1CVZA 1W5RA 2Y6EA 2G8JA 3V6CA 3BC3A 3DF0A 2YJBA 3P5UA 2AYOA 1ZCMA 3CH3X 1BP4A 1ICFA 1QMYA 3PNRA 1YVBA 5K16A 5F02A 2YJ2A 2WBFX 1AYWA 3P5XA 3OVZA 1F2AA 4YYVA 1O0EA 3PDFA 2F1GA 4XR7A 4QRVA 4MSXA 1U9XA 3KX1A 2JQFR 2DJFB 3KFQA 3H8BA 1ME4A 4P6GA 3OISA 4CDDB 2ARYA 2DCCA 2G6DA 5A24A 1AU2A 1NB3A 2XU5A 2FUDA 2XU1A 2DC6A 1KHQA 1ZIVA 2FQ9A 3BPFA 2HXZA 1MDWA 3M99A 1NPZA 3HD3A 1Y08A 2H7JA 3OF8A 2NQDB 2AVWA 1ATKA 2CB5A 2P86A 1HUCB 1VSNA 3H8CA 3K8UA 1S4VA 2DCAA 2ACTA 1PADA 1YK8A 3AI8A 3HHAA 4G54A 1M6DA 3WXEA 1U5IA 2NQIA 4CDCB 2R9MA 2HD5A 1QOLA 5EGWA 1QXPA 4PP2E 4X6JA 1SNKA 4MZOA 4K7CA 3LXSA 3NHEA 3N4CA 1Y4HA 1MHWA 1NB5A 2AS8A 1NLJA 2YJCA 1KHPA 4N4ZA 1NQCA 1AU3A 1K3BB 3ZUAA 4YYRA 1KFXL 5JA7A 3PBHA 1NL6A 4YYQA 1F29A 1PBHA 3RVVA 6PADA 4FJCA 5FPWA 3P5VA 4DMXA 2E01A 1GECE 1E2TA 3IOQA 1BGOA 1YALA 2O6XA 3CBKA 3KWZA 2PBHA 2P0RA 2AUZA 3O1GA 2AIMA 5CHVA 4B55A 1CJLA 2R6NA 3LFYA 1KXRA 4ZUXU 1GMYA 4W5BA 4X6IA 1PCIA 1GCBA 3IV2A 1CPJA 1AIMA 3K24A 4QH6A 3KW9A 4C5PA 3QT4A 1KFUL 3CH2X 3MTNA 3PW3A 2R9FA 3IEJA 5CVOB 1PPNA 4CDEB 1MS6A 5CVMA 5PADA 3WXFA 2DZYA 2C0YA 3C9EA 2YJ8A 4XUIA 3O0UA 3D9WA 4Q8HA 3S3QA 3MORA 2CIOA 1MIRA 2P7UA 3IUTA 1CSBB 2FYEA 1FH0A 4YYUA 1EWLA 3S3RA 2R9OA 2IBIA 1U9QX 4KLBA 1POPA 1U9WA 1TU6A 4P6EA 4W5CA 5J94A 1IWDA 1GX3A 2GFOA 2DJGB 2IPPB 1ME3A 2BDLA 1PIPA 2G8EA 4N79A 2G7YA 1PXVA 3OVXA 4DMYA 1AU4A 3N3KA 2JQGR 1EWPA 3H89A 3IHPA 2B1NA 2AU1A 2NQAA 2AYNA 3KWBX 4I05A 1SP4B 3GCBA 3U8EA 1F2CA 3V6EA 2OP3A 2FT2A 9PAPA 2HHNA 3I3TA 3TNXA 1CTEA 3BPMA 1A6RA 1BY8A 1AECA 3BCNA 4NV8A 1W6FA 4BGFA 3BWKA 3LTWA 2BSZA 2ATOA 4PADA 1PPOA 4QBBA 1PPPA 2E00A 4BPVA 1CS8A 2FRAA 3N3GA 4CZWA 1ITOA 4N8WA 1U9VA 7PCKA 3KSEA 2DCBA 3RVWA 3MHSA 4PI3A 8PCHA 1CB5A 1PE6A 2DZZA 3HWNA 1W4TA 1AYVA 4BQVA 3QSDA 1XKGA 3QJ3A 1YK7A 3IMAA 3BOWA 4BS6A 3USVA 2FTDA 1Q6KA 3K9MA 3B79A 2PREA 3I06A 1EF7A 2NQGA 3CBJA 5CHTA 2XU4A 2OULA 2VHSA 2PADA 1CQDA 4MZSA 2DCDA 4BS5A 4YYWA 3H6SA 4QRGA 3F75A 5JH3A 3F5VA 2XU3A 2HH5A 2VHFA 2F7DA 2R9CA 1CV8A 3OF9A 1GLOA 3RVXA 2DC9A 4YV8A 1TL9A 1AYUA 2VFCA 3E1ZB 4GUZA 4BSQA 4PP1A 4QRXA 3WXGA 1VJVA 4OELA 3KKUA 1MEGA 2VFBA 1YT7A 2AUXA 4AXMA 3H7DA 4X6HA 1QDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R9N A;  1PPD A;  3D6S A;  3HHI A;  2FRQ A;  1EWO A;  4YVA A;  2Y5B A;  4OEM A;  4CDF B;  4Q8G A;  3P5W A;  1X9Y A;  2E02 A;  2OZ2 A;  4FIP A;  1TLO A;  4HWY A;  1THE A;  2E03 A;  4I04 A;  1AU0 A;  2YJ9 A;  4AXL A;  2GHU A;  5EF4 A;  1MEM A;  1EWM A;  1BQI A;  3MHH A;  4FK5 A;  4YYS A;  2BDZ A;  2DC8 A;  2PNS A;  3ERV A;  4WA6 A;  2FO5 A;  1F2B A;  4I07 A;  2DC7 A;  4RY2 A;  1JQP A;  5CVN B;  4W4U A;  1STF E;  1DEU A;  2B1M A;  1DF0 A;  1CVZ A;  2Y6E A;  2G8J A;  3V6C A;  3BC3 A;  3DF0 A;  2YJB A;  3P5U A;  2AYO A;  1ZCM A;  3CH3 X;  1BP4 A;  1ICF A;  1QMY A;  3PNR A;  1YVB A;  5K16 A;  5F02 A;  2YJ2 A;  2WBF X;  1AYW A;  3P5X A;  3OVZ A;  1F2A A;  4YYV A;  1O0E A;  3PDF A;  2F1G A;  4XR7 A;  4QRV A;  4MSX A;  1U9X A;  3KX1 A;  2JQF R;  2DJF B;  3KFQ A;  3H8B A;  1ME4 A;  4P6G A;  3OIS A;  4CDD B;  2ARY A;  2DCC A;  2G6D A;  5A24 A;  1AU2 A;  1NB3 A;  2XU5 A;  2FUD A;  2XU1 A;  2DC6 A;  1KHQ A;  1ZIV A;  2FQ9 A;  3BPF A;  2HXZ A;  1MDW A;  3M99 A;  1NPZ A;  3HD3 A;  1Y08 A;  2H7J A;  3OF8 A;  2NQD B;  2AVW A;  1ATK A;  2CB5 A;  2P86 A;  1HUC B;  1VSN A;  3H8C A;  3K8U A;  1S4V A;  2DCA A;  2ACT A;  1PAD A;  1YK8 A;  3AI8 A;  3HHA A;  4G54 A;  1M6D A;  3WXE A;  1U5I A;  2NQI A;  4CDC B;  2R9M A;  2HD5 A;  1QOL A;  5EGW A;  1QXP A;  4PP2 E;  4X6J A;  1SNK A;  4MZO A;  4K7C A;  3LXS A;  3NHE A;  3N4C A;  1Y4H A;  1MHW A;  1NB5 A;  2AS8 A;  1NLJ A;  2YJC A;  1KHP A;  4N4Z A;  1NQC A;  1AU3 A;  1K3B B;  3ZUA A;  4YYR A;  1KFX L;  5JA7 A;  3PBH A;  1NL6 A;  4YYQ A;  1F29 A;  1PBH A;  3RVV A;  6PAD A;  4FJC A;  5FPW A;  3P5V A;  4DMX A;  2E01 A;  1GEC E;  3IOQ A;  1BGO A;  1YAL A;  2O6X A;  3CBK A;  3KWZ A;  2PBH A;  2P0R A;  2AUZ A;  3O1G A;  2AIM A;  5CHV A;  1CJL A;  2R6N A;  3LFY A;  1KXR A;  4ZUX U;  1GMY A;  4W5B A;  4X6I A;  1PCI A;  1GCB A;  3IV2 A;  1CPJ A;  1AIM A;  3K24 A;  4QH6 A;  3KW9 A;  3QT4 A;  1KFU L;  3CH2 X;  3MTN A;  3PW3 A;  2R9F A;  3IEJ A;  5CVO B;  1PPN A;  4CDE B;  1MS6 A;  5CVM A;  5PAD A;  3WXF A;  2DZY A;  2C0Y A;  3C9E A;  2YJ8 A;  4XUI A;  3O0U A;  4Q8H A;  3S3Q A;  3MOR A;  2CIO A;  1MIR A;  2P7U A;  3IUT A;  1CSB B;  2FYE A;  1FH0 A;  4YYU A;  1EWL A;  3S3R A;  2R9O A;  2IBI A;  1U9Q X;  4KLB A;  1POP A;  1U9W A;  1TU6 A;  4P6E A;  4W5C A;  5J94 A;  1IWD A;  2GFO A;  2DJG B;  2IPP B;  1ME3 A;  2BDL A;  1PIP A;  2G8E A;  4N79 A;  2G7Y A;  1PXV A;  3OVX A;  4DMY A;  1AU4 A;  3N3K A;  2JQG R;  1EWP A;  3H89 A;  3IHP A;  2B1N A;  2AU1 A;  2NQA A;  2AYN A;  3KWB X;  4I05 A;  1SP4 B;  3GCB A;  3U8E A;  1F2C A;  3V6E A;  2OP3 A;  2FT2 A;  9PAP A;  2HHN A;  3I3T A;  3TNX A;  1CTE A;  3BPM A;  1A6R A;  1BY8 A;  1AEC A;  3BCN A;  3BWK A;  2ATO A;  4PAD A;  1PPO A;  4QBB A;  1PPP A;  2E00 A;  4BPV A;  1CS8 A;  2FRA A;  3N3G A;  4CZW A;  1ITO A;  4N8W A;  1U9V A;  7PCK A;  3KSE A;  2DCB A;  3RVW A;  3MHS A;  4PI3 A;  8PCH A;  1CB5 A;  1PE6 A;  2DZZ A;  3HWN A;  1AYV A;  4BQV A;  3QSD A;  1XKG A;  3QJ3 A;  1YK7 A;  3IMA A;  3BOW A;  4BS6 A;  3USV A;  2FTD A;  1Q6K A;  3K9M A;  3B79 A;  2PRE A;  3I06 A;  1EF7 A;  2NQG A;  3CBJ A;  5CHT A;  2XU4 A;  2OUL A;  2VHS A;  2PAD A;  1CQD A;  4MZS A;  2DCD A;  4BS5 A;  4YYW A;  3H6S A;  4QRG A;  3F75 A;  5JH3 A;  3F5V A;  2XU3 A;  2HH5 A;  2VHF A;  2F7D A;  2R9C A;  1CV8 A;  3OF9 A;  1GLO A;  3RVX A;  2DC9 A;  4YV8 A;  1TL9 A;  1AYU A;  3E1Z B;  4BSQ A;  4PP1 A;  4QRX A;  3WXG A;  1VJV A;  4OEL A;  3KKU A;  1MEG A;  1YT7 A;  2AUX A;  4AXM A;  3H7D A;  4X6H A;  1QDQ A; 
#chains in the Genus database with same CATH topology
 2R9N A;  1PPD A;  3D6S A;  3HHI A;  2FRQ A;  1EWO A;  4YVA A;  2Y5B A;  3BBA A;  3PHX A;  3TRK A;  4OEM A;  4CDF B;  4Q8G A;  3P5W A;  1X9Y A;  2E02 A;  2OZ2 A;  4FIP A;  1TLO A;  4HWY A;  1THE A;  2E03 A;  4I04 A;  1AU0 A;  2YJ9 A;  4AXL A;  2GHU A;  5EF4 A;  1MEM A;  1DKI A;  1EWM A;  1BQI A;  3MHH A;  4FK5 A;  4YYS A;  2BDZ A;  2DC8 A;  2PNS A;  4IUM A;  4MM3 B;  3IFU A;  3ERV A;  3PRP A;  3PRM A;  4WA6 A;  4OVZ B;  2FO5 A;  1F2B A;  4I07 A;  2DC7 A;  4RY2 A;  1JQP A;  5CVN B;  4W4U A;  1STF E;  1DEU A;  4RF1 A;  2B1M A;  1DF0 A;  1UKF A;  3OQC A;  1CVZ A;  4IP3 A;  2Y6E A;  2G8J A;  3V6C A;  4HXD B;  3BC3 A;  3DF0 A;  2YJB A;  3P5U A;  2AYO A;  1ZCM A;  3CH3 X;  1BP4 A;  1ICF A;  1QMY A;  3PNR A;  1YVB A;  2DOS A;  5K16 A;  3E9S A;  5F02 A;  2YJ2 A;  2WBF X;  1AYW A;  3P5X A;  3OVZ A;  1F2A A;  4YYV A;  1O0E A;  3PDF A;  2F1G A;  4XR7 A;  4XZX A;  4QRV A;  4MSX A;  1U9X A;  3KX1 A;  2JQF R;  2DJF B;  3KFQ A;  3H8B A;  1ME4 A;  4P6G A;  3OIS A;  4CDD B;  2ARY A;  2DCC A;  4PT5 A;  2G6D A;  2J7Q C;  5A24 A;  1AU2 A;  1NB3 A;  2XU5 A;  2FUD A;  2XU1 A;  2DC6 A;  1KHQ A;  1ZIV A;  2FQ9 A;  3BPF A;  2HXZ A;  1MDW A;  3M99 A;  1NPZ A;  3HD3 A;  1Y08 A;  2BTW A;  2H7J A;  3OF8 A;  2NQD B;  2AVW A;  1ATK A;  2CB5 A;  4WUR A;  2P86 A;  1HUC B;  1VSN A;  3H8C A;  3K8U A;  1YZB A;  4BOU A;  1S4V A;  2DCA A;  2ACT A;  2FE8 A;  1PAD A;  1YK8 A;  3AI8 A;  3HHA A;  4G54 A;  1M6D A;  3WXE A;  1U5I A;  2NQI A;  4CDC B;  2R9M A;  2HD5 A;  1QOL A;  5EGW A;  1QXP A;  2Z84 A;  4PP2 E;  4X6J A;  1SNK A;  4MZO A;  4K7C A;  3LXS A;  3NHE A;  3N4C A;  1Y4H A;  1MHW A;  4R3D A;  1NB5 A;  2AS8 A;  1NLJ A;  2YJC A;  1KHP A;  4N4Z A;  3C0R A;  1NQC A;  1AU3 A;  1K3B B;  3ZUA A;  4BOZ A;  4YYR A;  1KFX L;  5JA7 A;  3PBH A;  5EZQ A;  1NL6 A;  4YYQ A;  1F29 A;  1PBH A;  4BOQ A;  3RVV A;  6PAD A;  3ZNH A;  4FJC A;  5FPW A;  3P5V A;  4DMX A;  2E01 A;  1GEC E;  3IOQ A;  1BGO A;  1YAL A;  2O6X A;  3CBK A;  3KWZ A;  2PBH A;  2P0R A;  3O65 A;  2AUZ A;  3O1G A;  2AIM A;  2HWK A;  5CHV A;  2BU3 A;  1CJL A;  2R6N A;  3LFY A;  1KXR A;  4ZUX U;  1GMY A;  4W5B A;  4X6I A;  1PCI A;  1GCB A;  3IV2 A;  1CPJ A;  1AIM A;  3K24 A;  4QH6 A;  5JZE A;  3KW9 A;  3QT4 A;  1KFU L;  3CH2 X;  3MTN A;  3PW3 A;  2AGA A;  2R9F A;  3IEJ A;  5CVO B;  1PPN A;  4CDE B;  1MS6 A;  3BB7 A;  4RNA A;  5CVM A;  5PAD A;  2BTW B;  3WXF A;  2DZY A;  2C0Y A;  2JTC A;  3C9E A;  2YJ8 A;  4XUI A;  3O0U A;  4REZ A;  4Q8H A;  4P16 A;  3S3Q A;  3MOR A;  2CIO A;  1MIR A;  5EZS A;  2P7U A;  3IUT A;  1CSB B;  2FYE A;  1FH0 A;  4YYU A;  1EWL A;  3S3R A;  3MJ5 A;  2R9O A;  2IBI A;  1U9Q X;  4KLB A;  1POP A;  1U9W A;  3TMP A;  1TU6 A;  4P6E A;  4W5C A;  5J94 A;  1IWD A;  2GFO A;  2DJG B;  2IPP B;  1ME3 A;  3PHU A;  3PHW A;  2BDL A;  1PIP A;  2G8E A;  4N79 A;  2G7Y A;  1PXV A;  3OVX A;  2JRI A;  1PVJ A;  4DMY A;  1AU4 A;  3N3K A;  4RF0 A;  2JQG R;  1EWP A;  3H89 A;  3IHP A;  2B1N A;  2AU1 A;  2NQA A;  2AYN A;  3KWB X;  4I05 A;  1SP4 B;  3GCB A;  3U8E A;  1F2C A;  3V6E A;  2OP3 A;  2UZJ A;  4MI7 A;  2FT2 A;  9PAP A;  2HHN A;  3I3T A;  3TNX A;  1CTE A;  3BPM A;  1A6R A;  3PSE A;  3MTV A;  4D8E A;  4BOP A;  1BY8 A;  1AEC A;  3BCN A;  3BWK A;  3RNV A;  2ATO A;  4PAD A;  3B21 A;  1PPO A;  4QBB A;  1PPP A;  2E00 A;  4BPV A;  1CS8 A;  3MP2 A;  2FRA A;  3N3G A;  3W31 A;  4CZW A;  1ITO A;  4N8W A;  1U9V A;  7PCK A;  3KSE A;  2DCB A;  3RVW A;  3MHS A;  4PI3 A;  8PCH A;  1CB5 A;  1PE6 A;  4D8I A;  2DZZ A;  4GUA A;  3HWN A;  4OW0 A;  4RKX A;  1AYV A;  4BQV A;  3QSD A;  4ZTB A;  1XKG A;  3QJ3 A;  1YK7 A;  3IMA A;  3BOW A;  4BS6 A;  3USV A;  2FTD A;  1Q6K A;  3K9M A;  3B79 A;  3PT2 A;  2PRE A;  3I06 A;  1EF7 A;  3W30 A;  4OVZ A;  2NQG A;  3CBJ A;  5CHT A;  2XU4 A;  2OUL A;  2VHS A;  2PAD A;  1CQD A;  4MZS A;  2DCD A;  4BS5 A;  4D8B A;  4YYW A;  5KO3 A;  3H6S A;  4M0W A;  2J7Q A;  4QRG A;  3F75 A;  5JH3 A;  3F5V A;  2XU3 A;  2HH5 A;  2VHF A;  2F7D A;  2R9C A;  1CV8 A;  3OF9 A;  1GLO A;  4BOS A;  3RVX A;  2DC9 A;  4YV8 A;  1TL9 A;  1AYU A;  3BY4 A;  3E1Z B;  4BSQ A;  4PP1 A;  4QRX A;  3WXG A;  1VJV A;  4OEL A;  3KKU A;  4A5U A;  1MEG A;  5E6J A;  1YT7 A;  2AUX A;  4AXM A;  3H7D A;  4X6H A;  1QDQ A; 
#chains in the Genus database with same CATH homology
 2R9N A;  1PPD A;  3D6S A;  3HHI A;  2FRQ A;  1EWO A;  4YVA A;  2Y5B A;  4NV7 A;  4OEM A;  4CDF B;  4Q8G A;  3P5W A;  1X9Y A;  2E02 A;  2OZ2 A;  4FIP A;  1TLO A;  4HWY A;  1THE A;  2E03 A;  4I04 A;  1AU0 A;  2YJ9 A;  4AXL A;  2GHU A;  5EF4 A;  1MEM A;  1EWM A;  1BQI A;  3MHH A;  4FK5 A;  4YYS A;  2BDZ A;  2DC8 A;  2PNS A;  3ERV A;  4WA6 A;  2FO5 A;  1F2B A;  4I07 A;  2DC7 A;  4RY2 A;  1JQP A;  5CVN B;  4W4U A;  1STF E;  1DEU A;  2B1M A;  1DF0 A;  1CVZ A;  1W5R A;  2Y6E A;  2G8J A;  3V6C A;  3BC3 A;  3DF0 A;  2YJB A;  3P5U A;  2AYO A;  1ZCM A;  3CH3 X;  1BP4 A;  1ICF A;  1QMY A;  3PNR A;  1YVB A;  5K16 A;  5F02 A;  2YJ2 A;  2WBF X;  1AYW A;  3P5X A;  3OVZ A;  1F2A A;  4YYV A;  1O0E A;  3PDF A;  2F1G A;  4XR7 A;  4QRV A;  4MSX A;  1U9X A;  3KX1 A;  2JQF R;  2DJF B;  3KFQ A;  3H8B A;  1ME4 A;  4P6G A;  3OIS A;  4CDD B;  2ARY A;  2DCC A;  2G6D A;  5A24 A;  1AU2 A;  1NB3 A;  2XU5 A;  2FUD A;  2XU1 A;  2DC6 A;  1KHQ A;  1ZIV A;  2FQ9 A;  3BPF A;  2HXZ A;  1MDW A;  3M99 A;  1NPZ A;  3HD3 A;  1Y08 A;  2H7J A;  3OF8 A;  2NQD B;  2AVW A;  1ATK A;  2CB5 A;  2P86 A;  1HUC B;  1VSN A;  3H8C A;  3K8U A;  1S4V A;  2DCA A;  2ACT A;  1PAD A;  1YK8 A;  3AI8 A;  3HHA A;  4G54 A;  1M6D A;  3WXE A;  1U5I A;  2NQI A;  4CDC B;  2R9M A;  2HD5 A;  1QOL A;  5EGW A;  1QXP A;  4PP2 E;  4X6J A;  1SNK A;  4MZO A;  4K7C A;  3LXS A;  3NHE A;  3N4C A;  1Y4H A;  1MHW A;  1NB5 A;  2AS8 A;  1NLJ A;  2YJC A;  1KHP A;  4N4Z A;  1NQC A;  1AU3 A;  1K3B B;  3ZUA A;  4YYR A;  1KFX L;  5JA7 A;  3PBH A;  1NL6 A;  4YYQ A;  1F29 A;  1PBH A;  3RVV A;  6PAD A;  4FJC A;  5FPW A;  3P5V A;  4DMX A;  2E01 A;  1GEC E;  1E2T A;  3IOQ A;  1BGO A;  1YAL A;  2O6X A;  3CBK A;  3KWZ A;  2PBH A;  2P0R A;  2AUZ A;  3O1G A;  2AIM A;  5CHV A;  4B55 A;  1CJL A;  2R6N A;  3LFY A;  1KXR A;  4ZUX U;  1GMY A;  4W5B A;  4X6I A;  1PCI A;  1GCB A;  3IV2 A;  1CPJ A;  1AIM A;  3K24 A;  4QH6 A;  3KW9 A;  4C5P A;  3QT4 A;  1KFU L;  3CH2 X;  3MTN A;  3PW3 A;  2R9F A;  3IEJ A;  5CVO B;  1PPN A;  4CDE B;  1MS6 A;  5CVM A;  5PAD A;  3WXF A;  2DZY A;  2C0Y A;  3C9E A;  2YJ8 A;  4XUI A;  3O0U A;  3D9W A;  4Q8H A;  3S3Q A;  3MOR A;  2CIO A;  1MIR A;  2P7U A;  3IUT A;  1CSB B;  2FYE A;  1FH0 A;  4YYU A;  1EWL A;  3S3R A;  2R9O A;  2IBI A;  1U9Q X;  4KLB A;  1POP A;  1U9W A;  1TU6 A;  4P6E A;  4W5C A;  5J94 A;  1IWD A;  1GX3 A;  2GFO A;  2DJG B;  2IPP B;  1ME3 A;  2BDL A;  1PIP A;  2G8E A;  4N79 A;  2G7Y A;  1PXV A;  3OVX A;  4DMY A;  1AU4 A;  3N3K A;  2JQG R;  1EWP A;  3H89 A;  3IHP A;  2B1N A;  2AU1 A;  2NQA A;  2AYN A;  3KWB X;  4I05 A;  1SP4 B;  3GCB A;  3U8E A;  1F2C A;  3V6E A;  2OP3 A;  2FT2 A;  9PAP A;  2HHN A;  3I3T A;  3TNX A;  1CTE A;  3BPM A;  1A6R A;  1BY8 A;  1AEC A;  3BCN A;  4NV8 A;  1W6F A;  4BGF A;  3BWK A;  3LTW A;  2BSZ A;  2ATO A;  4PAD A;  1PPO A;  4QBB A;  1PPP A;  2E00 A;  4BPV A;  1CS8 A;  2FRA A;  3N3G A;  4CZW A;  1ITO A;  4N8W A;  1U9V A;  7PCK A;  3KSE A;  2DCB A;  3RVW A;  3MHS A;  4PI3 A;  8PCH A;  1CB5 A;  1PE6 A;  2DZZ A;  3HWN A;  1W4T A;  1AYV A;  4BQV A;  3QSD A;  1XKG A;  3QJ3 A;  1YK7 A;  3IMA A;  3BOW A;  4BS6 A;  3USV A;  2FTD A;  1Q6K A;  3K9M A;  3B79 A;  2PRE A;  3I06 A;  1EF7 A;  2NQG A;  3CBJ A;  5CHT A;  2XU4 A;  2OUL A;  2VHS A;  2PAD A;  1CQD A;  4MZS A;  2DCD A;  4BS5 A;  4YYW A;  3H6S A;  4QRG A;  3F75 A;  5JH3 A;  3F5V A;  2XU3 A;  2HH5 A;  2VHF A;  2F7D A;  2R9C A;  1CV8 A;  3OF9 A;  1GLO A;  3RVX A;  2DC9 A;  4YV8 A;  1TL9 A;  1AYU A;  2VFC A;  3E1Z B;  4GUZ A;  4BSQ A;  4PP1 A;  4QRX A;  3WXG A;  1VJV A;  4OEL A;  3KKU A;  1MEG A;  2VFB A;  1YT7 A;  2AUX A;  4AXM A;  3H7D A;  4X6H A;  1QDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...