1M6DA

Crystal structure of human cathepsin f
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
214
structure length
214
Chain Sequence
b'APPEWDWRSKGAVTKVKDQGMCGSCWAFSVTGNVEGQWFLNQGTLLSLSEQELLDCDKMDKACMGGLPSNAYSAIKNLGGLETEDDYSYQGHMQSCQFSAEKAKVYIQDSVELSQNEQKLAAWLAKRGPISVAINAFGMQFYRHGISRPLRPLCSPWLIDHAVLLVGYGQRSDVPFWAIKNSWGTDWGEKGYYYLHRGSGACGVNTMASSAVVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin F
publication title The crystal structure of human cathepsin F and its implications for the development of novel immunomodulators
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 63
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 3.4.22.41: Cathepsin F.
pdb deposition date 2002-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1m6dA00
3IEJA 7PCKA 2OULA 2AU1A 2FO5A 2DC8A 3CH3X 1GCBA 4W4UA 4X6JA 1MEMA 1ZCMA 3BCNA 3H6SA 1U9VA 1NB3A 3H7DA 5PADA 4YYRA 2CIOA 3H8CA 1VSNA 3WXEA 3PDFA 4YV8A 2AVWA 1GECE 1MEGA 1NPZA 2IBIA 1AU0A 3F5VA 4XR7A 3BWKA 2R6NA 4CDEB 1ME4A 1QMYA 2ATOA 2E02A 4X6HA 1MDWA 4PP1A 4CZWA 1THEA 3I06A 3O1GA 1QDQA 4XUIA 4FJCA 1POPA 1EWOA 1U5IA 3KSEA 1F2CA 3K9MA 2P7UA 1BY8A 2HXZA 2PADA 2AS8A 3QJ3A 2JQGR 1PE6A 1CB5A 1NLJA 2G7YA 2XU5A 3NHEA 1CS8A 1PPPA 3HHAA 1PPOA 1SP4B 3PNRA 2R9NA 3P5VA 2CB5A 5EF4A 2AUZA 2Y5BA 3KKUA 2XU4A 4YYVA 3CH2X 1BGOA 3HWNA 4YYQA 5J94A 2FRQA 3RVVA 4G54A 6PADA 5JH3A 3H89A 2YJ8A 2HH5A 3BOWA 3N3GA 4PP2E 3OF9A 2DCCA 3KW9A 1EWPA 1XKGA 3V6CA 4Q8GA 1CVZA 2BDLA 1TLOA 1Y4HA 3P5WA 2XU3A 3BC3A 1VJVA 1YK8A 1M6DA 1ZIVA 2OZ2A 3DF0A 1AU3A 2B1MA 2P0RA 4I05A 3LXSA 2O6XA 2DC9A 4MZOA 1PPDA 3K8UA 3GCBA 4FIPA 3B79A 2PNSA 2YJBA 3HD3A 4YYWA 2Y6EA 4N79A 1U9XA 4N8WA 3KX1A 3AI8A 4W5BA 3F75A 3O0UA 1QOLA 3ZUAA 3RVWA 2WBFX 1TU6A 2XU1A 5K16A 3KFQA 3MORA 5CVNB 2VHSA 2HD5A 4KLBA 2HHNA 1JQPA 3RVXA 1AYVA 4PI3A 1CSBB 2AYNA 2DCBA 1DEUA 2FQ9A 1KFUL 2DJFB 4N4ZA 3IHPA 4AXLA 2DZZA 2E03A 1KHQA 1IWDA 5CHVA 4DMYA 1CPJA 2FT2A 1NB5A 5FPWA 2F1GA 4K7CA 2NQIA 1O0EA 3C9EA 1CJLA 3IV2A 4BQVA 2PBHA 2YJ9A 3M99A 3H8BA 3I3TA 3QT4A 3E1ZB 1AU2A 3CBKA 1AYUA 2AYOA 4P6EA 3P5UA 1F29A 3IUTA 1F2AA 2AIMA 1TL9A 1X9YA 2NQDB 3S3RA 1AIMA 2GHUA 3MTNA 3TNXA 5CHTA 2GFOA 3P5XA 3USVA 1AU4A 1HUCB 2P86A 1YK7A 4DMXA 4YYUA 1QXPA 5CVMA 4P6GA 2PREA 4MZSA 3ERVA 4WA6A 4Q8HA 3WXGA 4FK5A 1CTEA 1STFE 2DC7A 2FUDA 2YJCA 3IMAA 4BPVA 1ATKA 2BDZA 2R9CA 4BS5A 1EWMA 4QBBA 1AECA 1ITOA 1PXVA 3KWZA 1PIPA 1FH0A 4X6IA 3V6EA 1CV8A 2FRAA 1BP4A 2DCAA 2E01A 1EF7A 2VHFA 2YJ2A 3MHSA 4RY2A 3BPFA 1PADA 1S4VA 2ARYA 3KWBX 1GLOA 4YVAA 4I04A 1U9QX 2H7JA 1ICFA 3K24A 1PCIA 4W5CA 3CBJA 1KHPA 5EGWA 4ZUXU 2NQAA 1KXRA 2FTDA 3HHIA 5F02A 1A6RA 1U9WA 4OEMA 2C0YA 3N3KA 1MS6A 5CVOB 3WXFA 2NQGA 5JA7A 4QRXA 3OVZA 2AUXA 1Q6KA 4CDCB 1CQDA 3IOQA 1F2BA 4I07A 1MHWA 1YT7A 1PBHA 3PW3A 2E00A 2G8EA 3MHHA 2DZYA 3PBHA 9PAPA 2DJGB 4CDFB 2G8JA 8PCHA 4AXMA 4MSXA 5A24A 1BQIA 2R9FA 2F7DA 2G6DA 2JQFR 3QSDA 4CDDB 2R9MA 1NL6A 3S3QA 1KFXL 1K3BB 1PPNA 3OF8A 3OVXA 1MIRA 3OISA 4QRVA 2FYEA 3LFYA 1SNKA 4YYSA 2DCDA 1DF0A 3D6SA 3BPMA 2OP3A 4OELA 4BS6A 1AYWA 1YVBA 4BSQA 3N4CA 1YALA 2R9OA 1NQCA 4QRGA 2IPPB 4HWYA 1ME3A 3U8EA 4QH6A 1Y08A 2B1NA 2DC6A 1GMYA 4PADA 2ACTA 1EWLA
chains in the Genus database with same CATH superfamily
3IEJA 7PCKA 2JTCA 2OULA 2AU1A 2FO5A 2DC8A 3CH3X 1GCBA 4W4UA 4X6JA 1MEMA 1ZCMA 3BCNA 3H6SA 4PT5A 1U9VA 1NB3A 3H7DA 5PADA 4YYRA 2CIOA 3H8CA 4R3DA 1VSNA 3WXEA 3PDFA 4YV8A 2AVWA 1GECE 1MEGA 1NPZA 2IBIA 1AU0A 3F5VA 3TMPA 4XR7A 3BWKA 3PRMA 2R6NA 4CDEB 2DOSA 1ME4A 1QMYA 2ATOA 2E02A 4X6HA 1MDWA 4PP1A 3PRPA 4CZWA 3BBAA 1THEA 3I06A 3B21A 3O1GA 1QDQA 4XUIA 4FJCA 1POPA 1EWOA 1U5IA 3KSEA 1F2CA 4BOPA 3K9MA 2P7UA 3PHWA 3RNVA 1BY8A 2J7QA 4BOUA 4IP3A 2HXZA 2PADA 2AS8A 5EZSA 2BTWB 4BOQA 3QJ3A 2JQGR 4P16A 3ZNHA 1PE6A 1CB5A 1NLJA 2G7YA 2XU5A 3NHEA 1CS8A 3OQCA 1PPPA 3HHAA 4OVZA 1PPOA 1SP4B 3PNRA 2R9NA 3P5VA 2CB5A 5EF4A 2AUZA 2Y5BA 3KKUA 2XU4A 4MI7A 4YYVA 3CH2X 1BGOA 3HWNA 4YYQA 5J94A 2FRQA 3RVVA 3MJ5A 4G54A 6PADA 5JH3A 3H89A 5EZQA 3W31A 2YJ8A 2HH5A 3BOWA 3N3GA 4PP2E 3OF9A 2DCCA 3KW9A 1EWPA 4WURA 1XKGA 3V6CA 4Q8GA 1CVZA 2BDLA 3PHUA 1TLOA 1Y4HA 3P5WA 2XU3A 3BC3A 1VJVA 1UKFA 1YK8A 1M6DA 1ZIVA 2OZ2A 4RKXA 3DF0A 3MP2A 1DKIA 1AU3A 2FE8A 2B1MA 2P0RA 4I05A 3LXSA 3PT2A 2O6XA 2DC9A 3K8UA 1PPDA 4MZOA 3GCBA 4FIPA 3B79A 2PNSA 3BB7A 1PVJA 2YJBA 3HD3A 4YYWA 2Y6EA 4N79A 1U9XA 4N8WA 2UZJA 3KX1A 3AI8A 4W5BA 3F75A 3O0UA 1QOLA 3ZUAA 4XZXA 3RVWA 2WBFX 1TU6A 2XU1A 5K16A 4BOSA 3KFQA 4MM3B 3MORA 5CVNB 2VHSA 2HD5A 4KLBA 2HHNA 1JQPA 3RVXA 1AYVA 4PI3A 1CSBB 2AYNA 2DCBA 1DEUA 2FQ9A 1KFUL 2DJFB 4N4ZA 3IHPA 4AXLA 2DZZA 2E03A 1KHQA 1IWDA 5CHVA 4DMYA 1CPJA 2FT2A 1NB5A 5FPWA 2F1GA 4K7CA 2NQIA 1O0EA 5KO3A 3C9EA 4A5UA 1CJLA 3IV2A 4BQVA 2PBHA 2YJ9A 3M99A 3H8BA 3I3TA 3QT4A 3E1ZB 1AU2A 2BTWA 3CBKA 1AYUA 2AYOA 4P6EA 3BY4A 3P5UA 1F29A 3IUTA 1F2AA 2AIMA 1TL9A 2HWKA 1X9YA 2NQDB 1YZBA 3C0RA 3O65A 3S3RA 3PSEA 1AIMA 2GHUA 3MTNA 3TNXA 3E9SA 4RF1A 5CHTA 5JZEA 2GFOA 4D8EA 3P5XA 3USVA 1AU4A 4OW0A 1HUCB 2P86A 1YK7A 4DMXA 4YYUA 1QXPA 5CVMA 4P6GA 2PREA 4MZSA 4D8IA 3ERVA 4WA6A 4Q8HA 3WXGA 4FK5A 1CTEA 1STFE 2DC7A 2FUDA 2YJCA 3IMAA 4BPVA 1ATKA 2BDZA 2R9CA 4BS5A 1EWMA 4QBBA 1AECA 1ITOA 1PXVA 3KWZA 1PIPA 1FH0A 4X6IA 3V6EA 2JRIA 1CV8A 4IUMA 2FRAA 1BP4A 2DCAA 2E01A 1EF7A 2VHFA 2YJ2A 3MHSA 4RY2A 3BPFA 4RNAA 1PADA 1S4VA 2ARYA 3KWBX 1GLOA 4YVAA 2BU3A 4I04A 1U9QX 2H7JA 1ICFA 3K24A 1PCIA 4W5CA 3CBJA 1KHPA 5EGWA 4ZUXU 2NQAA 1KXRA 2FTDA 3HHIA 5F02A 1A6RA 1U9WA 4OEMA 2C0YA 3N3KA 1MS6A 5CVOB 3WXFA 2NQGA 5JA7A 4QRXA 3OVZA 2AUXA 1Q6KA 4CDCB 1CQDA 3IOQA 1F2BA 4I07A 3MTVA 1MHWA 1YT7A 1PBHA 3PW3A 2E00A 2G8EA 4OVZB 3MHHA 2DZYA 3PBHA 9PAPA 2DJGB 4CDFB 2G8JA 3W30A 8PCHA 2Z84A 4M0WA 4AXMA 4BOZA 4MSXA 5A24A 4RF0A 1BQIA 2R9FA 2F7DA 2AGAA 2G6DA 2JQFR 3QSDA 4CDDB 2R9MA 1NL6A 3PHXA 3S3QA 3TRKA 1KFXL 1K3BB 1PPNA 3OF8A 3OVXA 1MIRA 3OISA 4QRVA 2FYEA 3LFYA 1SNKA 4YYSA 3IFUA 2DCDA 1DF0A 3D6SA 3BPMA 2OP3A 4OELA 4BS6A 1AYWA 1YVBA 4BSQA 2J7QC 3N4CA 1YALA 2R9OA 1NQCA 4QRGA 2IPPB 4HWYA 4HXDB 1ME3A 5E6JA 3U8EA 4REZA 4QH6A 4D8BA 1Y08A 2B1NA 2DC6A 1GMYA 4ZTBA 4PADA 2ACTA 4GUAA 1EWLA
chains in the Genus database with same CATH topology
3IEJA 7PCKA 3LTWA 2OULA 2AU1A 2FO5A 2DC8A 3CH3X 1GCBA 4W4UA 4X6JA 1MEMA 1ZCMA 3BCNA 3H6SA 1U9VA 1NB3A 3H7DA 5PADA 4YYRA 2CIOA 3H8CA 1W5RA 1VSNA 3WXEA 3PDFA 4YV8A 2AVWA 1GECE 1MEGA 1NPZA 2IBIA 1AU0A 3F5VA 4XR7A 3BWKA 2R6NA 4CDEB 1ME4A 1QMYA 2ATOA 3D9WA 2E02A 4X6HA 1MDWA 4PP1A 4CZWA 1THEA 3I06A 3O1GA 1QDQA 4XUIA 4FJCA 1POPA 1EWOA 1U5IA 3KSEA 1F2CA 3K9MA 2P7UA 1BY8A 2HXZA 2PADA 2AS8A 3QJ3A 2JQGR 1PE6A 1CB5A 1NLJA 1W4TA 2G7YA 2XU5A 3NHEA 1CS8A 2VFBA 1PPPA 3HHAA 1PPOA 1SP4B 3PNRA 2R9NA 3P5VA 2CB5A 5EF4A 2AUZA 2Y5BA 3KKUA 2XU4A 4YYVA 3CH2X 1BGOA 3HWNA 4YYQA 5J94A 2FRQA 3RVVA 4G54A 6PADA 5JH3A 3H89A 4GUZA 2YJ8A 2HH5A 3BOWA 3N3GA 4PP2E 1GX3A 3OF9A 2DCCA 3KW9A 4BGFA 1EWPA 1XKGA 3V6CA 4Q8GA 1CVZA 2BDLA 1TLOA 1Y4HA 3P5WA 2XU3A 3BC3A 1VJVA 1YK8A 1M6DA 1ZIVA 2OZ2A 3DF0A 1AU3A 2B1MA 2P0RA 4I05A 3LXSA 2O6XA 2DC9A 4MZOA 1PPDA 3K8UA 3GCBA 4FIPA 3B79A 2PNSA 2YJBA 3HD3A 4YYWA 2Y6EA 4N79A 1U9XA 4N8WA 3KX1A 3AI8A 4W5BA 3F75A 3O0UA 1QOLA 3ZUAA 3RVWA 2WBFX 1TU6A 2XU1A 5K16A 3KFQA 3MORA 5CVNB 2VHSA 2HD5A 4KLBA 2HHNA 1JQPA 3RVXA 1AYVA 4PI3A 1CSBB 2AYNA 2DCBA 1DEUA 2FQ9A 1KFUL 2DJFB 4N4ZA 3IHPA 4AXLA 2DZZA 2E03A 1W6FA 1KHQA 1IWDA 5CHVA 4DMYA 1CPJA 2FT2A 1NB5A 5FPWA 2F1GA 4K7CA 2NQIA 1O0EA 3C9EA 1CJLA 3IV2A 4BQVA 2PBHA 2YJ9A 3M99A 3H8BA 3I3TA 3QT4A 3E1ZB 1AU2A 3CBKA 1AYUA 2AYOA 4P6EA 3P5UA 1F29A 3IUTA 1F2AA 2AIMA 1TL9A 4NV8A 1X9YA 2NQDB 3S3RA 1AIMA 2GHUA 3MTNA 3TNXA 5CHTA 2GFOA 3P5XA 3USVA 1AU4A 1HUCB 2VFCA 2P86A 1YK7A 4DMXA 4YYUA 1QXPA 5CVMA 4P6GA 2PREA 4MZSA 3ERVA 4WA6A 4Q8HA 3WXGA 4FK5A 1CTEA 1STFE 2DC7A 2FUDA 2YJCA 3IMAA 4BPVA 1ATKA 2BDZA 2R9CA 4BS5A 1EWMA 4QBBA 1AECA 1ITOA 1PXVA 3KWZA 2BSZA 1PIPA 1FH0A 4X6IA 3V6EA 1CV8A 2FRAA 1BP4A 2DCAA 2E01A 1EF7A 2VHFA 2YJ2A 3MHSA 4RY2A 3BPFA 1PADA 1S4VA 2ARYA 3KWBX 1GLOA 4YVAA 4I04A 1U9QX 2H7JA 1ICFA 3K24A 4NV7A 1PCIA 4W5CA 3CBJA 1KHPA 5EGWA 4ZUXU 2NQAA 1KXRA 2FTDA 3HHIA 5F02A 1A6RA 1U9WA 4OEMA 2C0YA 3N3KA 1MS6A 5CVOB 3WXFA 2NQGA 5JA7A 4QRXA 3OVZA 2AUXA 1Q6KA 4CDCB 1CQDA 3IOQA 1F2BA 4C5PA 4I07A 1MHWA 1YT7A 1PBHA 3PW3A 2E00A 2G8EA 3MHHA 2DZYA 3PBHA 9PAPA 2DJGB 4CDFB 2G8JA 8PCHA 4AXMA 4MSXA 5A24A 1BQIA 2R9FA 2F7DA 2G6DA 4B55A 2JQFR 3QSDA 4CDDB 2R9MA 1NL6A 3S3QA 1KFXL 1K3BB 1PPNA 3OF8A 3OVXA 1MIRA 3OISA 4QRVA 2FYEA 3LFYA 1SNKA 4YYSA 2DCDA 1DF0A 3D6SA 3BPMA 2OP3A 4OELA 4BS6A 1AYWA 1YVBA 4BSQA 3N4CA 1YALA 2R9OA 1NQCA 1E2TA 4QRGA 2IPPB 4HWYA 1ME3A 3U8EA 4QH6A 1Y08A 2B1NA 2DC6A 1GMYA 4PADA 2ACTA 1EWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IEJ A;  7PCK A;  2OUL A;  2AU1 A;  2FO5 A;  2DC8 A;  3CH3 X;  1GCB A;  4W4U A;  4X6J A;  1MEM A;  1ZCM A;  3BCN A;  3H6S A;  1U9V A;  1NB3 A;  3H7D A;  5PAD A;  4YYR A;  2CIO A;  3H8C A;  1VSN A;  3WXE A;  3PDF A;  4YV8 A;  2AVW A;  1GEC E;  1MEG A;  1NPZ A;  2IBI A;  1AU0 A;  3F5V A;  4XR7 A;  3BWK A;  2R6N A;  4CDE B;  1ME4 A;  1QMY A;  2ATO A;  2E02 A;  4X6H A;  1MDW A;  4PP1 A;  4CZW A;  1THE A;  3I06 A;  3O1G A;  1QDQ A;  4XUI A;  4FJC A;  1POP A;  1EWO A;  1U5I A;  3KSE A;  1F2C A;  3K9M A;  2P7U A;  1BY8 A;  2HXZ A;  2PAD A;  2AS8 A;  3QJ3 A;  2JQG R;  1PE6 A;  1CB5 A;  1NLJ A;  2G7Y A;  2XU5 A;  3NHE A;  1CS8 A;  1PPP A;  3HHA A;  1PPO A;  1SP4 B;  3PNR A;  2R9N A;  3P5V A;  2CB5 A;  5EF4 A;  2AUZ A;  2Y5B A;  3KKU A;  2XU4 A;  4YYV A;  3CH2 X;  1BGO A;  3HWN A;  4YYQ A;  5J94 A;  2FRQ A;  3RVV A;  4G54 A;  6PAD A;  5JH3 A;  3H89 A;  2YJ8 A;  2HH5 A;  3BOW A;  3N3G A;  4PP2 E;  3OF9 A;  2DCC A;  3KW9 A;  1EWP A;  1XKG A;  3V6C A;  4Q8G A;  1CVZ A;  2BDL A;  1TLO A;  1Y4H A;  3P5W A;  2XU3 A;  3BC3 A;  1VJV A;  1YK8 A;  1M6D A;  1ZIV A;  2OZ2 A;  3DF0 A;  1AU3 A;  2B1M A;  2P0R A;  4I05 A;  3LXS A;  2O6X A;  2DC9 A;  4MZO A;  1PPD A;  3K8U A;  3GCB A;  4FIP A;  3B79 A;  2PNS A;  2YJB A;  3HD3 A;  4YYW A;  2Y6E A;  4N79 A;  1U9X A;  4N8W A;  3KX1 A;  3AI8 A;  4W5B A;  3F75 A;  3O0U A;  1QOL A;  3ZUA A;  3RVW A;  2WBF X;  1TU6 A;  2XU1 A;  5K16 A;  3KFQ A;  3MOR A;  5CVN B;  2VHS A;  2HD5 A;  4KLB A;  2HHN A;  1JQP A;  3RVX A;  1AYV A;  4PI3 A;  1CSB B;  2AYN A;  2DCB A;  1DEU A;  2FQ9 A;  1KFU L;  2DJF B;  4N4Z A;  3IHP A;  4AXL A;  2DZZ A;  2E03 A;  1KHQ A;  1IWD A;  5CHV A;  4DMY A;  1CPJ A;  2FT2 A;  1NB5 A;  5FPW A;  2F1G A;  4K7C A;  2NQI A;  1O0E A;  3C9E A;  1CJL A;  3IV2 A;  4BQV A;  2PBH A;  2YJ9 A;  3M99 A;  3H8B A;  3I3T A;  3QT4 A;  3E1Z B;  1AU2 A;  3CBK A;  1AYU A;  2AYO A;  4P6E A;  3P5U A;  1F29 A;  3IUT A;  1F2A A;  2AIM A;  1TL9 A;  1X9Y A;  2NQD B;  3S3R A;  1AIM A;  2GHU A;  3MTN A;  3TNX A;  5CHT A;  2GFO A;  3P5X A;  3USV A;  1AU4 A;  1HUC B;  2P86 A;  1YK7 A;  4DMX A;  4YYU A;  1QXP A;  5CVM A;  4P6G A;  2PRE A;  4MZS A;  3ERV A;  4WA6 A;  4Q8H A;  3WXG A;  4FK5 A;  1CTE A;  1STF E;  2DC7 A;  2FUD A;  2YJC A;  3IMA A;  4BPV A;  1ATK A;  2BDZ A;  2R9C A;  4BS5 A;  1EWM A;  4QBB A;  1AEC A;  1ITO A;  1PXV A;  3KWZ A;  1PIP A;  1FH0 A;  4X6I A;  3V6E A;  1CV8 A;  2FRA A;  1BP4 A;  2DCA A;  2E01 A;  1EF7 A;  2VHF A;  2YJ2 A;  3MHS A;  4RY2 A;  3BPF A;  1PAD A;  1S4V A;  2ARY A;  3KWB X;  1GLO A;  4YVA A;  4I04 A;  1U9Q X;  2H7J A;  1ICF A;  3K24 A;  1PCI A;  4W5C A;  3CBJ A;  1KHP A;  5EGW A;  4ZUX U;  2NQA A;  1KXR A;  2FTD A;  3HHI A;  5F02 A;  1A6R A;  1U9W A;  4OEM A;  2C0Y A;  3N3K A;  1MS6 A;  5CVO B;  3WXF A;  2NQG A;  5JA7 A;  4QRX A;  3OVZ A;  2AUX A;  1Q6K A;  4CDC B;  1CQD A;  3IOQ A;  1F2B A;  4I07 A;  1MHW A;  1YT7 A;  1PBH A;  3PW3 A;  2E00 A;  2G8E A;  3MHH A;  2DZY A;  3PBH A;  9PAP A;  2DJG B;  4CDF B;  2G8J A;  8PCH A;  4AXM A;  4MSX A;  5A24 A;  1BQI A;  2R9F A;  2F7D A;  2G6D A;  2JQF R;  3QSD A;  4CDD B;  2R9M A;  1NL6 A;  3S3Q A;  1KFX L;  1K3B B;  1PPN A;  3OF8 A;  3OVX A;  1MIR A;  3OIS A;  4QRV A;  2FYE A;  3LFY A;  1SNK A;  4YYS A;  2DCD A;  1DF0 A;  3D6S A;  3BPM A;  2OP3 A;  4OEL A;  4BS6 A;  1AYW A;  1YVB A;  4BSQ A;  3N4C A;  1YAL A;  2R9O A;  1NQC A;  4QRG A;  2IPP B;  4HWY A;  1ME3 A;  3U8E A;  4QH6 A;  1Y08 A;  2B1N A;  2DC6 A;  1GMY A;  4PAD A;  2ACT A;  1EWL A; 
#chains in the Genus database with same CATH topology
 3IEJ A;  7PCK A;  2JTC A;  2OUL A;  2AU1 A;  2FO5 A;  2DC8 A;  3CH3 X;  1GCB A;  4W4U A;  4X6J A;  1MEM A;  1ZCM A;  3BCN A;  3H6S A;  4PT5 A;  1U9V A;  1NB3 A;  3H7D A;  5PAD A;  4YYR A;  2CIO A;  3H8C A;  4R3D A;  1VSN A;  3WXE A;  3PDF A;  4YV8 A;  2AVW A;  1GEC E;  1MEG A;  1NPZ A;  2IBI A;  1AU0 A;  3F5V A;  3TMP A;  4XR7 A;  3BWK A;  3PRM A;  2R6N A;  4CDE B;  2DOS A;  1ME4 A;  1QMY A;  2ATO A;  2E02 A;  4X6H A;  1MDW A;  4PP1 A;  3PRP A;  4CZW A;  3BBA A;  1THE A;  3I06 A;  3B21 A;  3O1G A;  1QDQ A;  4XUI A;  4FJC A;  1POP A;  1EWO A;  1U5I A;  3KSE A;  1F2C A;  4BOP A;  3K9M A;  2P7U A;  3PHW A;  3RNV A;  1BY8 A;  2J7Q A;  4BOU A;  4IP3 A;  2HXZ A;  2PAD A;  2AS8 A;  5EZS A;  2BTW B;  4BOQ A;  3QJ3 A;  2JQG R;  4P16 A;  3ZNH A;  1PE6 A;  1CB5 A;  1NLJ A;  2G7Y A;  2XU5 A;  3NHE A;  1CS8 A;  3OQC A;  1PPP A;  3HHA A;  4OVZ A;  1PPO A;  1SP4 B;  3PNR A;  2R9N A;  3P5V A;  2CB5 A;  5EF4 A;  2AUZ A;  2Y5B A;  3KKU A;  2XU4 A;  4MI7 A;  4YYV A;  3CH2 X;  1BGO A;  3HWN A;  4YYQ A;  5J94 A;  2FRQ A;  3RVV A;  3MJ5 A;  4G54 A;  6PAD A;  5JH3 A;  3H89 A;  5EZQ A;  3W31 A;  2YJ8 A;  2HH5 A;  3BOW A;  3N3G A;  4PP2 E;  3OF9 A;  2DCC A;  3KW9 A;  1EWP A;  4WUR A;  1XKG A;  3V6C A;  4Q8G A;  1CVZ A;  2BDL A;  3PHU A;  1TLO A;  1Y4H A;  3P5W A;  2XU3 A;  3BC3 A;  1VJV A;  1UKF A;  1YK8 A;  1M6D A;  1ZIV A;  2OZ2 A;  4RKX A;  3DF0 A;  3MP2 A;  1DKI A;  1AU3 A;  2FE8 A;  2B1M A;  2P0R A;  4I05 A;  3LXS A;  3PT2 A;  2O6X A;  2DC9 A;  3K8U A;  1PPD A;  4MZO A;  3GCB A;  4FIP A;  3B79 A;  2PNS A;  3BB7 A;  1PVJ A;  2YJB A;  3HD3 A;  4YYW A;  2Y6E A;  4N79 A;  1U9X A;  4N8W A;  2UZJ A;  3KX1 A;  3AI8 A;  4W5B A;  3F75 A;  3O0U A;  1QOL A;  3ZUA A;  4XZX A;  3RVW A;  2WBF X;  1TU6 A;  2XU1 A;  5K16 A;  4BOS A;  3KFQ A;  4MM3 B;  3MOR A;  5CVN B;  2VHS A;  2HD5 A;  4KLB A;  2HHN A;  1JQP A;  3RVX A;  1AYV A;  4PI3 A;  1CSB B;  2AYN A;  2DCB A;  1DEU A;  2FQ9 A;  1KFU L;  2DJF B;  4N4Z A;  3IHP A;  4AXL A;  2DZZ A;  2E03 A;  1KHQ A;  1IWD A;  5CHV A;  4DMY A;  1CPJ A;  2FT2 A;  1NB5 A;  5FPW A;  2F1G A;  4K7C A;  2NQI A;  1O0E A;  5KO3 A;  3C9E A;  4A5U A;  1CJL A;  3IV2 A;  4BQV A;  2PBH A;  2YJ9 A;  3M99 A;  3H8B A;  3I3T A;  3QT4 A;  3E1Z B;  1AU2 A;  2BTW A;  3CBK A;  1AYU A;  2AYO A;  4P6E A;  3BY4 A;  3P5U A;  1F29 A;  3IUT A;  1F2A A;  2AIM A;  1TL9 A;  2HWK A;  1X9Y A;  2NQD B;  1YZB A;  3C0R A;  3O65 A;  3S3R A;  3PSE A;  1AIM A;  2GHU A;  3MTN A;  3TNX A;  3E9S A;  4RF1 A;  5CHT A;  5JZE A;  2GFO A;  4D8E A;  3P5X A;  3USV A;  1AU4 A;  4OW0 A;  1HUC B;  2P86 A;  1YK7 A;  4DMX A;  4YYU A;  1QXP A;  5CVM A;  4P6G A;  2PRE A;  4MZS A;  4D8I A;  3ERV A;  4WA6 A;  4Q8H A;  3WXG A;  4FK5 A;  1CTE A;  1STF E;  2DC7 A;  2FUD A;  2YJC A;  3IMA A;  4BPV A;  1ATK A;  2BDZ A;  2R9C A;  4BS5 A;  1EWM A;  4QBB A;  1AEC A;  1ITO A;  1PXV A;  3KWZ A;  1PIP A;  1FH0 A;  4X6I A;  3V6E A;  2JRI A;  1CV8 A;  4IUM A;  2FRA A;  1BP4 A;  2DCA A;  2E01 A;  1EF7 A;  2VHF A;  2YJ2 A;  3MHS A;  4RY2 A;  3BPF A;  4RNA A;  1PAD A;  1S4V A;  2ARY A;  3KWB X;  1GLO A;  4YVA A;  2BU3 A;  4I04 A;  1U9Q X;  2H7J A;  1ICF A;  3K24 A;  1PCI A;  4W5C A;  3CBJ A;  1KHP A;  5EGW A;  4ZUX U;  2NQA A;  1KXR A;  2FTD A;  3HHI A;  5F02 A;  1A6R A;  1U9W A;  4OEM A;  2C0Y A;  3N3K A;  1MS6 A;  5CVO B;  3WXF A;  2NQG A;  5JA7 A;  4QRX A;  3OVZ A;  2AUX A;  1Q6K A;  4CDC B;  1CQD A;  3IOQ A;  1F2B A;  4I07 A;  3MTV A;  1MHW A;  1YT7 A;  1PBH A;  3PW3 A;  2E00 A;  2G8E A;  4OVZ B;  3MHH A;  2DZY A;  3PBH A;  9PAP A;  2DJG B;  4CDF B;  2G8J A;  3W30 A;  8PCH A;  2Z84 A;  4M0W A;  4AXM A;  4BOZ A;  4MSX A;  5A24 A;  4RF0 A;  1BQI A;  2R9F A;  2F7D A;  2AGA A;  2G6D A;  2JQF R;  3QSD A;  4CDD B;  2R9M A;  1NL6 A;  3PHX A;  3S3Q A;  3TRK A;  1KFX L;  1K3B B;  1PPN A;  3OF8 A;  3OVX A;  1MIR A;  3OIS A;  4QRV A;  2FYE A;  3LFY A;  1SNK A;  4YYS A;  3IFU A;  2DCD A;  1DF0 A;  3D6S A;  3BPM A;  2OP3 A;  4OEL A;  4BS6 A;  1AYW A;  1YVB A;  4BSQ A;  2J7Q C;  3N4C A;  1YAL A;  2R9O A;  1NQC A;  4QRG A;  2IPP B;  4HWY A;  4HXD B;  1ME3 A;  5E6J A;  3U8E A;  4REZ A;  4QH6 A;  4D8B A;  1Y08 A;  2B1N A;  2DC6 A;  1GMY A;  4ZTB A;  4PAD A;  2ACT A;  4GUA A;  1EWL A; 
#chains in the Genus database with same CATH homology
 3IEJ A;  7PCK A;  3LTW A;  2OUL A;  2AU1 A;  2FO5 A;  2DC8 A;  3CH3 X;  1GCB A;  4W4U A;  4X6J A;  1MEM A;  1ZCM A;  3BCN A;  3H6S A;  1U9V A;  1NB3 A;  3H7D A;  5PAD A;  4YYR A;  2CIO A;  3H8C A;  1W5R A;  1VSN A;  3WXE A;  3PDF A;  4YV8 A;  2AVW A;  1GEC E;  1MEG A;  1NPZ A;  2IBI A;  1AU0 A;  3F5V A;  4XR7 A;  3BWK A;  2R6N A;  4CDE B;  1ME4 A;  1QMY A;  2ATO A;  3D9W A;  2E02 A;  4X6H A;  1MDW A;  4PP1 A;  4CZW A;  1THE A;  3I06 A;  3O1G A;  1QDQ A;  4XUI A;  4FJC A;  1POP A;  1EWO A;  1U5I A;  3KSE A;  1F2C A;  3K9M A;  2P7U A;  1BY8 A;  2HXZ A;  2PAD A;  2AS8 A;  3QJ3 A;  2JQG R;  1PE6 A;  1CB5 A;  1NLJ A;  1W4T A;  2G7Y A;  2XU5 A;  3NHE A;  1CS8 A;  2VFB A;  1PPP A;  3HHA A;  1PPO A;  1SP4 B;  3PNR A;  2R9N A;  3P5V A;  2CB5 A;  5EF4 A;  2AUZ A;  2Y5B A;  3KKU A;  2XU4 A;  4YYV A;  3CH2 X;  1BGO A;  3HWN A;  4YYQ A;  5J94 A;  2FRQ A;  3RVV A;  4G54 A;  6PAD A;  5JH3 A;  3H89 A;  4GUZ A;  2YJ8 A;  2HH5 A;  3BOW A;  3N3G A;  4PP2 E;  1GX3 A;  3OF9 A;  2DCC A;  3KW9 A;  4BGF A;  1EWP A;  1XKG A;  3V6C A;  4Q8G A;  1CVZ A;  2BDL A;  1TLO A;  1Y4H A;  3P5W A;  2XU3 A;  3BC3 A;  1VJV A;  1YK8 A;  1M6D A;  1ZIV A;  2OZ2 A;  3DF0 A;  1AU3 A;  2B1M A;  2P0R A;  4I05 A;  3LXS A;  2O6X A;  2DC9 A;  4MZO A;  1PPD A;  3K8U A;  3GCB A;  4FIP A;  3B79 A;  2PNS A;  2YJB A;  3HD3 A;  4YYW A;  2Y6E A;  4N79 A;  1U9X A;  4N8W A;  3KX1 A;  3AI8 A;  4W5B A;  3F75 A;  3O0U A;  1QOL A;  3ZUA A;  3RVW A;  2WBF X;  1TU6 A;  2XU1 A;  5K16 A;  3KFQ A;  3MOR A;  5CVN B;  2VHS A;  2HD5 A;  4KLB A;  2HHN A;  1JQP A;  3RVX A;  1AYV A;  4PI3 A;  1CSB B;  2AYN A;  2DCB A;  1DEU A;  2FQ9 A;  1KFU L;  2DJF B;  4N4Z A;  3IHP A;  4AXL A;  2DZZ A;  2E03 A;  1W6F A;  1KHQ A;  1IWD A;  5CHV A;  4DMY A;  1CPJ A;  2FT2 A;  1NB5 A;  5FPW A;  2F1G A;  4K7C A;  2NQI A;  1O0E A;  3C9E A;  1CJL A;  3IV2 A;  4BQV A;  2PBH A;  2YJ9 A;  3M99 A;  3H8B A;  3I3T A;  3QT4 A;  3E1Z B;  1AU2 A;  3CBK A;  1AYU A;  2AYO A;  4P6E A;  3P5U A;  1F29 A;  3IUT A;  1F2A A;  2AIM A;  1TL9 A;  4NV8 A;  1X9Y A;  2NQD B;  3S3R A;  1AIM A;  2GHU A;  3MTN A;  3TNX A;  5CHT A;  2GFO A;  3P5X A;  3USV A;  1AU4 A;  1HUC B;  2VFC A;  2P86 A;  1YK7 A;  4DMX A;  4YYU A;  1QXP A;  5CVM A;  4P6G A;  2PRE A;  4MZS A;  3ERV A;  4WA6 A;  4Q8H A;  3WXG A;  4FK5 A;  1CTE A;  1STF E;  2DC7 A;  2FUD A;  2YJC A;  3IMA A;  4BPV A;  1ATK A;  2BDZ A;  2R9C A;  4BS5 A;  1EWM A;  4QBB A;  1AEC A;  1ITO A;  1PXV A;  3KWZ A;  2BSZ A;  1PIP A;  1FH0 A;  4X6I A;  3V6E A;  1CV8 A;  2FRA A;  1BP4 A;  2DCA A;  2E01 A;  1EF7 A;  2VHF A;  2YJ2 A;  3MHS A;  4RY2 A;  3BPF A;  1PAD A;  1S4V A;  2ARY A;  3KWB X;  1GLO A;  4YVA A;  4I04 A;  1U9Q X;  2H7J A;  1ICF A;  3K24 A;  4NV7 A;  1PCI A;  4W5C A;  3CBJ A;  1KHP A;  5EGW A;  4ZUX U;  2NQA A;  1KXR A;  2FTD A;  3HHI A;  5F02 A;  1A6R A;  1U9W A;  4OEM A;  2C0Y A;  3N3K A;  1MS6 A;  5CVO B;  3WXF A;  2NQG A;  5JA7 A;  4QRX A;  3OVZ A;  2AUX A;  1Q6K A;  4CDC B;  1CQD A;  3IOQ A;  1F2B A;  4C5P A;  4I07 A;  1MHW A;  1YT7 A;  1PBH A;  3PW3 A;  2E00 A;  2G8E A;  3MHH A;  2DZY A;  3PBH A;  9PAP A;  2DJG B;  4CDF B;  2G8J A;  8PCH A;  4AXM A;  4MSX A;  5A24 A;  1BQI A;  2R9F A;  2F7D A;  2G6D A;  4B55 A;  2JQF R;  3QSD A;  4CDD B;  2R9M A;  1NL6 A;  3S3Q A;  1KFX L;  1K3B B;  1PPN A;  3OF8 A;  3OVX A;  1MIR A;  3OIS A;  4QRV A;  2FYE A;  3LFY A;  1SNK A;  4YYS A;  2DCD A;  1DF0 A;  3D6S A;  3BPM A;  2OP3 A;  4OEL A;  4BS6 A;  1AYW A;  1YVB A;  4BSQ A;  3N4C A;  1YAL A;  2R9O A;  1NQC A;  1E2T A;  4QRG A;  2IPP B;  4HWY A;  1ME3 A;  3U8E A;  4QH6 A;  1Y08 A;  2B1N A;  2DC6 A;  1GMY A;  4PAD A;  2ACT A;  1EWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...