1QOLA

Structure of the fmdv leader protease
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
173
structure length
166
Chain Sequence
MELTLYNGEKKTFYSRPNNHDNAWLNAILQLFRYVEEPFFDWVYSSPENLTLEAIKQLEDLTGLELHEGGPPALVIWNIKHLLHTGIGTASRPSEVCVVDGTDMCLADFHAGIFLKGQEHAVFACVTSNGWYAIDDEDFYPWTPDPSDVLVFVPYDQKAKVQRKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Foot-and-Mouth Disease Virus Leader Protease: A Papain-Like Fold Adapted for Self-Processing and Eif4G Recognition.
pubmed doi rcsb
source organism Foot-and-mouth disease virus
molecule tags Hydrolase
molecule keywords PROTEASE (NONSTRUCTURAL PROTEIN P20A)
total genus 38
structure length 166
sequence length 173
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1qolA00
2DCAA 1NB5A 1KHPA 2PBHA 4BS5A 4CDEB 1CS8A 2XU3A 2G8JA 1THEA 2AYOA 3RVWA 2OZ2A 1NB3A 3S3QA 4X6JA 3MTNA 1ITOA 1CTEA 2AVWA 2PADA 2AUZA 3OVZA 3ZUAA 3D6SA 3KX1A 2DCDA 1AU4A 4QRVA 1U5IA 1F2CA 4N8WA 1GLOA 3H89A 3V6EA 4MZOA 2R9CA 1TU6A 1TLOA 2FO5A 2XU1A 2XU4A 3S3RA 4BSQA 3O1GA 4KLBA 3KKUA 1YK8A 5JH3A 2Y6EA 2DJFB 2NQAA 1QXPA 2CIOA 7PCKA 4YYWA 3I3TA 3KWZA 5JA7A 2AYNA 3P5VA 4I05A 1KHQA 1MDWA 1AU3A 1M6DA 2IBIA 3MORA 1VSNA 3K8UA 1VJVA 1HUCB 2AU1A 1AIMA 2R9NA 1AYUA 2P86A 3H8BA 4HWYA 1EWLA 5CVOB 3P5XA 4YYRA 5F02A 4CDDB 1BY8A 3OF9A 3H7DA 1SP4B 3MHSA 1GMYA 1KXRA 3KWBX 1MEMA 4P6EA 2G8EA 1S4VA 1U9VA 3CBJA 2F7DA 4PP1A 2B1MA 1CPJA 2YJ8A 3IOQA 2AUXA 4YYQA 1Y08A 2BDLA 1IWDA 1ICFA 3HWNA 2FRQA 1PADA 1KFUL 3QSDA 1AYWA 4QBBA 3N3KA 9PAPA 2NQGA 3KW9A 1QMYA 2YJBA 2R9OA 3IV2A 1CJLA 1PPDA 3K9MA 4CDCB 2HH5A 4CZWA 3ERVA 2G7YA 3O0UA 4AXMA 3F5VA 2WBFX 3BPFA 1PPNA 3KFQA 4YV8A 3IHPA 1ZCMA 3H8CA 1DEUA 3QJ3A 1EWMA 5K16A 3PW3A 2Y5BA 1X9YA 3GCBA 1YALA 4QRXA 3HHAA 4YYSA 3DF0A 1CQDA 1K3BB 1STFE 2AIMA 4BQVA 4W5BA 2ATOA 4FK5A 5CVNB 4YYUA 3LFYA 3WXGA 8PCHA 4YYVA 3QT4A 3USVA 2B1NA 2PREA 3AI8A 4G54A 3C9EA 1DF0A 2DC9A 1QOLA 3LXSA 1CB5A 1BQIA 4BS6A 2R9FA 2NQIA 1U9XA 3BOWA 3BC3A 1YK7A 3PBHA 1NQCA 1ZIVA 1U9QX 2ACTA 4I07A 2FTDA 3OISA 4Q8GA 2ARYA 1QDQA 4DMYA 1CSBB 1O0EA 4FJCA 1ME4A 2OULA 2XU5A 1MHWA 2DJGB 1JQPA 5EF4A 1MIRA 1KFXL 4Q8HA 1ME3A 3N4CA 1YVBA 3BCNA 5FPWA 1F2AA 2JQFR 3IEJA 2O6XA 1EWOA 2VHSA 4RY2A 3HHIA 4OEMA 1AU0A 1BP4A 1AU2A 1PBHA 1FH0A 3BWKA 3I06A 2OP3A 4PADA 3RVXA 1F2BA 2HD5A 1PXVA 1BGOA 3NHEA 3PNRA 3RVVA 2FQ9A 4CDFB 3IUTA 4WA6A 2R9MA 2P0RA 4PI3A 2DC7A 1Q6KA 2C0YA 2DCCA 2FYEA 4X6HA 2JQGR 5PADA 3CBKA 5EGWA 4N79A 3P5WA 1Y4HA 1SNKA 2HXZA 2HHNA 2E01A 3PDFA 3WXFA 2P7UA 2NQDB 2E03A 3CH3X 6PADA 3WXEA 3KSEA 4FIPA 5CVMA 3F75A 3U8EA 1PIPA 3V6CA 3N3GA 3OF8A 2FRAA 4BPVA 1ATKA 4XR7A 5CHTA 2GFOA 4MZSA 3P5UA 1A6RA 2YJ9A 2YJCA 4DMXA 4K7CA 2FT2A 2DZYA 3TNXA 2FUDA 3M99A 3OVXA 1MS6A 2CB5A 4XUIA 5CHVA 1EF7A 4AXLA 3BPMA 4QRGA 1CV8A 2R6NA 2IPPB 1NLJA 1GCBA 3MHHA 4ZUXU 2G6DA 3CH2X 1CVZA 1AYVA 3B79A 1EWPA 4W5CA 2DZZA 1NPZA 4N4ZA 1NL6A 3H6SA 5A24A 2E00A 4OELA 4YVAA 2YJ2A 1PPPA 3HD3A 1TL9A 4W4UA 4P6GA 1PE6A 2AS8A 1PPOA 1GECE 1U9WA 3E1ZB 1POPA 4QH6A 1F29A 4MSXA 1XKGA 2F1GA 2E02A 1AECA 2GHUA 4I04A 2DC8A 2DCBA 2PNSA 2H7JA 1MEGA 2VHFA 5J94A 2BDZA 3K24A 3IMAA 2DC6A 4PP2E 4X6IA 1YT7A 1PCIA
chains in the Genus database with same CATH superfamily
2DCAA 1NB5A 1KHPA 2PBHA 4OVZB 4BS5A 4CDEB 1CS8A 1DKIA 2XU3A 1UKFA 2G8JA 1THEA 2AYOA 3RVWA 2OZ2A 4XZXA 1NB3A 3S3QA 4X6JA 3MTNA 1ITOA 1CTEA 3MJ5A 2AVWA 2PADA 2AUZA 1PVJA 3OVZA 3ZUAA 4ZTBA 3D6SA 2AGAA 3KX1A 2DCDA 1AU4A 4QRVA 4IUMA 1U5IA 2BU3A 1F2CA 4N8WA 4OW0A 1GLOA 3H89A 3V6EA 4BOPA 3RNVA 4MZOA 2R9CA 1TU6A 1TLOA 4WURA 4A5UA 4R3DA 2FO5A 2XU1A 2XU4A 3S3RA 4BSQA 2DOSA 3O1GA 4KLBA 3KKUA 3PSEA 1YK8A 3O65A 5JH3A 2Y6EA 3E9SA 2DJFB 2NQAA 3PT2A 1QXPA 2CIOA 3ZNHA 7PCKA 4M0WA 4YYWA 3I3TA 3TMPA 4GUAA 3KWZA 5JA7A 2AYNA 3P5VA 4I05A 1KHQA 1MDWA 1AU3A 1M6DA 5E6JA 2IBIA 3PHXA 3MORA 1VSNA 3K8UA 1VJVA 1HUCB 2AU1A 4BOQA 4RKXA 1AIMA 2R9NA 1AYUA 2P86A 3H8BA 4HWYA 1EWLA 5CVOB 4RF0A 1YZBA 3P5XA 4YYRA 5F02A 4CDDB 1BY8A 3OF9A 3H7DA 1SP4B 3MHSA 1GMYA 1KXRA 3BBAA 3KWBX 1MEMA 5JZEA 4P6EA 2G8EA 1S4VA 1U9VA 3CBJA 2F7DA 4HXDB 4PP1A 2B1MA 1CPJA 2YJ8A 3IOQA 2AUXA 4YYQA 1Y08A 2BDLA 3W31A 2J7QC 1IWDA 2HWKA 1ICFA 3HWNA 2FRQA 1PADA 1KFUL 3QSDA 1AYWA 2Z84A 4QBBA 3N3KA 9PAPA 3OQCA 2NQGA 3KW9A 4D8BA 1QMYA 2YJBA 3TRKA 2R9OA 3IV2A 1CJLA 1PPDA 3K9MA 4CDCB 2HH5A 4CZWA 3ERVA 2G7YA 3O0UA 4AXMA 3F5VA 2WBFX 4P16A 3BPFA 1PPNA 3KFQA 4YV8A 3IHPA 3PHUA 1ZCMA 3C0RA 3H8CA 1DEUA 3QJ3A 4BOZA 5KO3A 3BB7A 1EWMA 5K16A 3PW3A 2Y5BA 1X9YA 3GCBA 1YALA 4QRXA 3HHAA 4YYSA 2UZJA 3DF0A 1CQDA 1K3BB 1STFE 2AIMA 4BQVA 4W5BA 2ATOA 4FK5A 5CVNB 4YYUA 3LFYA 3WXGA 8PCHA 4YYVA 3QT4A 3AI8A 2B1NA 2PREA 3USVA 4G54A 3C9EA 1DF0A 2DC9A 4D8EA 1QOLA 2JTCA 3LXSA 1CB5A 1BQIA 4BS6A 2R9FA 2NQIA 1U9XA 3BOWA 3BC3A 1YK7A 3PBHA 1NQCA 1ZIVA 1U9QX 2ACTA 4I07A 5EZSA 2FTDA 4RNAA 3OISA 4Q8GA 2ARYA 1QDQA 4DMYA 1CSBB 1O0EA 4FJCA 1ME4A 2BTWA 2OULA 3PRMA 2XU5A 1MHWA 2DJGB 1JQPA 5EF4A 1MIRA 1KFXL 4Q8HA 1ME3A 3N4CA 1YVBA 3BCNA 5FPWA 1F2AA 2JQFR 3IEJA 2O6XA 1EWOA 2VHSA 4RY2A 3HHIA 4OEMA 1AU0A 2J7QA 1BP4A 1AU2A 1PBHA 1FH0A 3BWKA 3I06A 2OP3A 4PADA 3RVXA 1F2BA 2HD5A 1PXVA 1BGOA 3PRPA 3NHEA 3PNRA 3RVVA 4BOSA 2FQ9A 4OVZA 4CDFB 3IUTA 2JRIA 4WA6A 2R9MA 2P0RA 4PI3A 2DC7A 1Q6KA 4IP3A 2C0YA 2DCCA 3BY4A 2FYEA 4X6HA 2JQGR 5PADA 3CBKA 5EGWA 4N79A 3P5WA 3W30A 1Y4HA 1SNKA 2HXZA 2HHNA 2FE8A 5EZQA 2E01A 3PDFA 3WXFA 2P7UA 2NQDB 2E03A 3CH3X 6PADA 3IFUA 3WXEA 3KSEA 4FIPA 5CVMA 3F75A 3U8EA 1PIPA 3V6CA 3N3GA 3OF8A 2FRAA 4BPVA 1ATKA 4XR7A 5CHTA 2GFOA 4MZSA 3P5UA 1A6RA 2YJ9A 2YJCA 4DMXA 4K7CA 3MTVA 2FT2A 2DZYA 3TNXA 3MP2A 2FUDA 3M99A 3OVXA 1MS6A 2CB5A 4XUIA 5CHVA 3B21A 1EF7A 4AXLA 3BPMA 4QRGA 1CV8A 2R6NA 2IPPB 1NLJA 1GCBA 3MHHA 4ZUXU 2G6DA 3CH2X 1CVZA 2BTWB 1AYVA 3B79A 4PT5A 1EWPA 4W5CA 2DZZA 1NPZA 4N4ZA 1NL6A 4D8IA 3H6SA 5A24A 2E00A 4OELA 4YVAA 2YJ2A 1PPPA 3HD3A 1TL9A 4W4UA 4P6GA 1PE6A 2AS8A 1PPOA 1GECE 1U9WA 3E1ZB 1POPA 3PHWA 4QH6A 1F29A 4MM3B 4MSXA 1XKGA 2F1GA 4RF1A 2E02A 1AECA 2GHUA 4I04A 2DC8A 2DCBA 2PNSA 2H7JA 1MEGA 2VHFA 4MI7A 5J94A 2BDZA 3K24A 4REZA 3IMAA 2DC6A 4PP2E 4X6IA 4BOUA 1YT7A 1PCIA
chains in the Genus database with same CATH topology
2DCAA 1NB5A 1KHPA 2PBHA 4BS5A 4CDEB 1CS8A 2XU3A 2G8JA 1THEA 2AYOA 3RVWA 2OZ2A 1NB3A 3S3QA 4X6JA 3MTNA 1ITOA 1CTEA 2AVWA 2PADA 2AUZA 3OVZA 3LTWA 3ZUAA 3D6SA 3KX1A 2DCDA 1AU4A 4QRVA 1U5IA 1F2CA 4N8WA 1GLOA 3H89A 3V6EA 1W5RA 4MZOA 2R9CA 1TU6A 1TLOA 2FO5A 2XU1A 2XU4A 3S3RA 4BSQA 3O1GA 4KLBA 3KKUA 2VFBA 1YK8A 5JH3A 2Y6EA 2DJFB 2NQAA 1QXPA 2CIOA 7PCKA 4YYWA 3I3TA 3KWZA 5JA7A 2AYNA 3P5VA 4I05A 1KHQA 1MDWA 1AU3A 1M6DA 2IBIA 1E2TA 3MORA 1VSNA 3K8UA 1VJVA 1W4TA 1HUCB 2AU1A 1AIMA 2R9NA 1AYUA 2P86A 3H8BA 4HWYA 1EWLA 5CVOB 3P5XA 4YYRA 5F02A 4CDDB 1BY8A 1GX3A 3OF9A 3H7DA 1SP4B 3MHSA 1GMYA 1KXRA 3KWBX 1MEMA 4P6EA 2G8EA 1S4VA 1U9VA 3CBJA 2F7DA 4PP1A 2B1MA 1CPJA 2YJ8A 3IOQA 2AUXA 4YYQA 1Y08A 2BDLA 1IWDA 1ICFA 3HWNA 2FRQA 1PADA 1KFUL 3QSDA 1AYWA 4QBBA 3N3KA 9PAPA 2NQGA 3KW9A 1QMYA 2YJBA 2R9OA 3IV2A 1CJLA 1PPDA 3K9MA 4CDCB 2HH5A 4CZWA 3ERVA 2G7YA 3O0UA 4AXMA 3F5VA 2WBFX 3BPFA 1PPNA 3KFQA 4YV8A 3IHPA 1ZCMA 3H8CA 1DEUA 3QJ3A 1EWMA 2VFCA 5K16A 3PW3A 2Y5BA 1X9YA 3GCBA 1YALA 4QRXA 3HHAA 4YYSA 3DF0A 1CQDA 1K3BB 4NV7A 1STFE 2AIMA 4BQVA 4W5BA 2ATOA 4FK5A 5CVNB 4YYUA 3LFYA 3WXGA 8PCHA 4YYVA 3QT4A 3AI8A 2B1NA 2PREA 3USVA 4G54A 3C9EA 1DF0A 2DC9A 1QOLA 3LXSA 1CB5A 1BQIA 4BS6A 2R9FA 2NQIA 1U9XA 3BOWA 3BC3A 1YK7A 3PBHA 1NQCA 1ZIVA 1U9QX 2ACTA 4I07A 2FTDA 2BSZA 3OISA 4Q8GA 2ARYA 1QDQA 4DMYA 1CSBB 1O0EA 4FJCA 1ME4A 2OULA 2XU5A 1MHWA 2DJGB 1JQPA 5EF4A 1MIRA 1KFXL 4Q8HA 1ME3A 3N4CA 1YVBA 3BCNA 5FPWA 1F2AA 4B55A 2JQFR 3IEJA 2O6XA 1EWOA 2VHSA 4RY2A 3HHIA 4OEMA 1AU0A 1BP4A 1AU2A 1PBHA 1FH0A 3BWKA 3I06A 2OP3A 4PADA 3RVXA 1F2BA 2HD5A 1PXVA 1BGOA 3NHEA 3PNRA 3RVVA 2FQ9A 1W6FA 4CDFB 3IUTA 4WA6A 2R9MA 2P0RA 4PI3A 2DC7A 1Q6KA 2C0YA 2DCCA 2FYEA 4X6HA 2JQGR 5PADA 3CBKA 5EGWA 4BGFA 4N79A 3P5WA 1Y4HA 1SNKA 2HXZA 2HHNA 2E01A 3D9WA 4NV8A 3PDFA 3WXFA 2P7UA 2NQDB 2E03A 3CH3X 6PADA 3WXEA 3KSEA 4FIPA 5CVMA 3F75A 3U8EA 1PIPA 3V6CA 3N3GA 3OF8A 2FRAA 4BPVA 1ATKA 4XR7A 5CHTA 2GFOA 4MZSA 3P5UA 1A6RA 2YJ9A 2YJCA 4DMXA 4K7CA 2FT2A 2DZYA 3TNXA 2FUDA 3M99A 3OVXA 1MS6A 2CB5A 4XUIA 5CHVA 1EF7A 4AXLA 3BPMA 4QRGA 1CV8A 2R6NA 2IPPB 1NLJA 1GCBA 3MHHA 4C5PA 4ZUXU 2G6DA 3CH2X 1CVZA 1AYVA 3B79A 1EWPA 4W5CA 2DZZA 4GUZA 1NPZA 4N4ZA 1NL6A 3H6SA 5A24A 2E00A 4OELA 4YVAA 2YJ2A 1PPPA 3HD3A 1TL9A 4W4UA 4P6GA 1PE6A 2AS8A 1PPOA 1GECE 1U9WA 3E1ZB 1POPA 4QH6A 1F29A 4MSXA 1XKGA 2F1GA 2E02A 1AECA 2GHUA 4I04A 2DC8A 2DCBA 2PNSA 2H7JA 1MEGA 2VHFA 5J94A 2BDZA 3K24A 3IMAA 2DC6A 4PP2E 4X6IA 1YT7A 1PCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DCA A;  1NB5 A;  1KHP A;  2PBH A;  4BS5 A;  4CDE B;  1CS8 A;  2XU3 A;  2G8J A;  1THE A;  2AYO A;  3RVW A;  2OZ2 A;  1NB3 A;  3S3Q A;  4X6J A;  3MTN A;  1ITO A;  1CTE A;  2AVW A;  2PAD A;  2AUZ A;  3OVZ A;  3ZUA A;  3D6S A;  3KX1 A;  2DCD A;  1AU4 A;  4QRV A;  1U5I A;  1F2C A;  4N8W A;  1GLO A;  3H89 A;  3V6E A;  4MZO A;  2R9C A;  1TU6 A;  1TLO A;  2FO5 A;  2XU1 A;  2XU4 A;  3S3R A;  4BSQ A;  3O1G A;  4KLB A;  3KKU A;  1YK8 A;  5JH3 A;  2Y6E A;  2DJF B;  2NQA A;  1QXP A;  2CIO A;  7PCK A;  4YYW A;  3I3T A;  3KWZ A;  5JA7 A;  2AYN A;  3P5V A;  4I05 A;  1KHQ A;  1MDW A;  1AU3 A;  1M6D A;  2IBI A;  3MOR A;  1VSN A;  3K8U A;  1VJV A;  1HUC B;  2AU1 A;  1AIM A;  2R9N A;  1AYU A;  2P86 A;  3H8B A;  4HWY A;  1EWL A;  5CVO B;  3P5X A;  4YYR A;  5F02 A;  4CDD B;  1BY8 A;  3OF9 A;  3H7D A;  1SP4 B;  3MHS A;  1GMY A;  1KXR A;  3KWB X;  1MEM A;  4P6E A;  2G8E A;  1S4V A;  1U9V A;  3CBJ A;  2F7D A;  4PP1 A;  2B1M A;  1CPJ A;  2YJ8 A;  3IOQ A;  2AUX A;  4YYQ A;  1Y08 A;  2BDL A;  1IWD A;  1ICF A;  3HWN A;  2FRQ A;  1PAD A;  1KFU L;  3QSD A;  1AYW A;  4QBB A;  3N3K A;  9PAP A;  2NQG A;  3KW9 A;  1QMY A;  2YJB A;  2R9O A;  3IV2 A;  1CJL A;  1PPD A;  3K9M A;  4CDC B;  2HH5 A;  4CZW A;  3ERV A;  2G7Y A;  3O0U A;  4AXM A;  3F5V A;  2WBF X;  3BPF A;  1PPN A;  3KFQ A;  4YV8 A;  3IHP A;  1ZCM A;  3H8C A;  1DEU A;  3QJ3 A;  1EWM A;  5K16 A;  3PW3 A;  2Y5B A;  1X9Y A;  3GCB A;  1YAL A;  4QRX A;  3HHA A;  4YYS A;  3DF0 A;  1CQD A;  1K3B B;  1STF E;  2AIM A;  4BQV A;  4W5B A;  2ATO A;  4FK5 A;  5CVN B;  4YYU A;  3LFY A;  3WXG A;  8PCH A;  4YYV A;  3QT4 A;  3USV A;  2B1N A;  2PRE A;  3AI8 A;  4G54 A;  3C9E A;  1DF0 A;  2DC9 A;  1QOL A;  3LXS A;  1CB5 A;  1BQI A;  4BS6 A;  2R9F A;  2NQI A;  1U9X A;  3BOW A;  3BC3 A;  1YK7 A;  3PBH A;  1NQC A;  1ZIV A;  1U9Q X;  2ACT A;  4I07 A;  2FTD A;  3OIS A;  4Q8G A;  2ARY A;  1QDQ A;  4DMY A;  1CSB B;  1O0E A;  4FJC A;  1ME4 A;  2OUL A;  2XU5 A;  1MHW A;  2DJG B;  1JQP A;  5EF4 A;  1MIR A;  1KFX L;  4Q8H A;  1ME3 A;  3N4C A;  1YVB A;  3BCN A;  5FPW A;  1F2A A;  2JQF R;  3IEJ A;  2O6X A;  1EWO A;  2VHS A;  4RY2 A;  3HHI A;  4OEM A;  1AU0 A;  1BP4 A;  1AU2 A;  1PBH A;  1FH0 A;  3BWK A;  3I06 A;  2OP3 A;  4PAD A;  3RVX A;  1F2B A;  2HD5 A;  1PXV A;  1BGO A;  3NHE A;  3PNR A;  3RVV A;  2FQ9 A;  4CDF B;  3IUT A;  4WA6 A;  2R9M A;  2P0R A;  4PI3 A;  2DC7 A;  1Q6K A;  2C0Y A;  2DCC A;  2FYE A;  4X6H A;  2JQG R;  5PAD A;  3CBK A;  5EGW A;  4N79 A;  3P5W A;  1Y4H A;  1SNK A;  2HXZ A;  2HHN A;  2E01 A;  3PDF A;  3WXF A;  2P7U A;  2NQD B;  2E03 A;  3CH3 X;  6PAD A;  3WXE A;  3KSE A;  4FIP A;  5CVM A;  3F75 A;  3U8E A;  1PIP A;  3V6C A;  3N3G A;  3OF8 A;  2FRA A;  4BPV A;  1ATK A;  4XR7 A;  5CHT A;  2GFO A;  4MZS A;  3P5U A;  1A6R A;  2YJ9 A;  2YJC A;  4DMX A;  4K7C A;  2FT2 A;  2DZY A;  3TNX A;  2FUD A;  3M99 A;  3OVX A;  1MS6 A;  2CB5 A;  4XUI A;  5CHV A;  1EF7 A;  4AXL A;  3BPM A;  4QRG A;  1CV8 A;  2R6N A;  2IPP B;  1NLJ A;  1GCB A;  3MHH A;  4ZUX U;  2G6D A;  3CH2 X;  1CVZ A;  1AYV A;  3B79 A;  1EWP A;  4W5C A;  2DZZ A;  1NPZ A;  4N4Z A;  1NL6 A;  3H6S A;  5A24 A;  2E00 A;  4OEL A;  4YVA A;  2YJ2 A;  1PPP A;  3HD3 A;  1TL9 A;  4W4U A;  4P6G A;  1PE6 A;  2AS8 A;  1PPO A;  1GEC E;  1U9W A;  3E1Z B;  1POP A;  4QH6 A;  1F29 A;  4MSX A;  1XKG A;  2F1G A;  2E02 A;  1AEC A;  2GHU A;  4I04 A;  2DC8 A;  2DCB A;  2PNS A;  2H7J A;  1MEG A;  2VHF A;  5J94 A;  2BDZ A;  3K24 A;  3IMA A;  2DC6 A;  4PP2 E;  4X6I A;  1YT7 A;  1PCI A; 
#chains in the Genus database with same CATH topology
 2DCA A;  1NB5 A;  1KHP A;  2PBH A;  4OVZ B;  4BS5 A;  4CDE B;  1CS8 A;  1DKI A;  2XU3 A;  1UKF A;  2G8J A;  1THE A;  2AYO A;  3RVW A;  2OZ2 A;  4XZX A;  1NB3 A;  3S3Q A;  4X6J A;  3MTN A;  1ITO A;  1CTE A;  3MJ5 A;  2AVW A;  2PAD A;  2AUZ A;  1PVJ A;  3OVZ A;  3ZUA A;  4ZTB A;  3D6S A;  2AGA A;  3KX1 A;  2DCD A;  1AU4 A;  4QRV A;  4IUM A;  1U5I A;  2BU3 A;  1F2C A;  4N8W A;  4OW0 A;  1GLO A;  3H89 A;  3V6E A;  4BOP A;  3RNV A;  4MZO A;  2R9C A;  1TU6 A;  1TLO A;  4WUR A;  4A5U A;  4R3D A;  2FO5 A;  2XU1 A;  2XU4 A;  3S3R A;  4BSQ A;  2DOS A;  3O1G A;  4KLB A;  3KKU A;  3PSE A;  1YK8 A;  3O65 A;  5JH3 A;  2Y6E A;  3E9S A;  2DJF B;  2NQA A;  3PT2 A;  1QXP A;  2CIO A;  3ZNH A;  7PCK A;  4M0W A;  4YYW A;  3I3T A;  3TMP A;  4GUA A;  3KWZ A;  5JA7 A;  2AYN A;  3P5V A;  4I05 A;  1KHQ A;  1MDW A;  1AU3 A;  1M6D A;  5E6J A;  2IBI A;  3PHX A;  3MOR A;  1VSN A;  3K8U A;  1VJV A;  1HUC B;  2AU1 A;  4BOQ A;  4RKX A;  1AIM A;  2R9N A;  1AYU A;  2P86 A;  3H8B A;  4HWY A;  1EWL A;  5CVO B;  4RF0 A;  1YZB A;  3P5X A;  4YYR A;  5F02 A;  4CDD B;  1BY8 A;  3OF9 A;  3H7D A;  1SP4 B;  3MHS A;  1GMY A;  1KXR A;  3BBA A;  3KWB X;  1MEM A;  5JZE A;  4P6E A;  2G8E A;  1S4V A;  1U9V A;  3CBJ A;  2F7D A;  4HXD B;  4PP1 A;  2B1M A;  1CPJ A;  2YJ8 A;  3IOQ A;  2AUX A;  4YYQ A;  1Y08 A;  2BDL A;  3W31 A;  2J7Q C;  1IWD A;  2HWK A;  1ICF A;  3HWN A;  2FRQ A;  1PAD A;  1KFU L;  3QSD A;  1AYW A;  2Z84 A;  4QBB A;  3N3K A;  9PAP A;  3OQC A;  2NQG A;  3KW9 A;  4D8B A;  1QMY A;  2YJB A;  3TRK A;  2R9O A;  3IV2 A;  1CJL A;  1PPD A;  3K9M A;  4CDC B;  2HH5 A;  4CZW A;  3ERV A;  2G7Y A;  3O0U A;  4AXM A;  3F5V A;  2WBF X;  4P16 A;  3BPF A;  1PPN A;  3KFQ A;  4YV8 A;  3IHP A;  3PHU A;  1ZCM A;  3C0R A;  3H8C A;  1DEU A;  3QJ3 A;  4BOZ A;  5KO3 A;  3BB7 A;  1EWM A;  5K16 A;  3PW3 A;  2Y5B A;  1X9Y A;  3GCB A;  1YAL A;  4QRX A;  3HHA A;  4YYS A;  2UZJ A;  3DF0 A;  1CQD A;  1K3B B;  1STF E;  2AIM A;  4BQV A;  4W5B A;  2ATO A;  4FK5 A;  5CVN B;  4YYU A;  3LFY A;  3WXG A;  8PCH A;  4YYV A;  3QT4 A;  3AI8 A;  2B1N A;  2PRE A;  3USV A;  4G54 A;  3C9E A;  1DF0 A;  2DC9 A;  4D8E A;  1QOL A;  2JTC A;  3LXS A;  1CB5 A;  1BQI A;  4BS6 A;  2R9F A;  2NQI A;  1U9X A;  3BOW A;  3BC3 A;  1YK7 A;  3PBH A;  1NQC A;  1ZIV A;  1U9Q X;  2ACT A;  4I07 A;  5EZS A;  2FTD A;  4RNA A;  3OIS A;  4Q8G A;  2ARY A;  1QDQ A;  4DMY A;  1CSB B;  1O0E A;  4FJC A;  1ME4 A;  2BTW A;  2OUL A;  3PRM A;  2XU5 A;  1MHW A;  2DJG B;  1JQP A;  5EF4 A;  1MIR A;  1KFX L;  4Q8H A;  1ME3 A;  3N4C A;  1YVB A;  3BCN A;  5FPW A;  1F2A A;  2JQF R;  3IEJ A;  2O6X A;  1EWO A;  2VHS A;  4RY2 A;  3HHI A;  4OEM A;  1AU0 A;  2J7Q A;  1BP4 A;  1AU2 A;  1PBH A;  1FH0 A;  3BWK A;  3I06 A;  2OP3 A;  4PAD A;  3RVX A;  1F2B A;  2HD5 A;  1PXV A;  1BGO A;  3PRP A;  3NHE A;  3PNR A;  3RVV A;  4BOS A;  2FQ9 A;  4OVZ A;  4CDF B;  3IUT A;  2JRI A;  4WA6 A;  2R9M A;  2P0R A;  4PI3 A;  2DC7 A;  1Q6K A;  4IP3 A;  2C0Y A;  2DCC A;  3BY4 A;  2FYE A;  4X6H A;  2JQG R;  5PAD A;  3CBK A;  5EGW A;  4N79 A;  3P5W A;  3W30 A;  1Y4H A;  1SNK A;  2HXZ A;  2HHN A;  2FE8 A;  5EZQ A;  2E01 A;  3PDF A;  3WXF A;  2P7U A;  2NQD B;  2E03 A;  3CH3 X;  6PAD A;  3IFU A;  3WXE A;  3KSE A;  4FIP A;  5CVM A;  3F75 A;  3U8E A;  1PIP A;  3V6C A;  3N3G A;  3OF8 A;  2FRA A;  4BPV A;  1ATK A;  4XR7 A;  5CHT A;  2GFO A;  4MZS A;  3P5U A;  1A6R A;  2YJ9 A;  2YJC A;  4DMX A;  4K7C A;  3MTV A;  2FT2 A;  2DZY A;  3TNX A;  3MP2 A;  2FUD A;  3M99 A;  3OVX A;  1MS6 A;  2CB5 A;  4XUI A;  5CHV A;  3B21 A;  1EF7 A;  4AXL A;  3BPM A;  4QRG A;  1CV8 A;  2R6N A;  2IPP B;  1NLJ A;  1GCB A;  3MHH A;  4ZUX U;  2G6D A;  3CH2 X;  1CVZ A;  2BTW B;  1AYV A;  3B79 A;  4PT5 A;  1EWP A;  4W5C A;  2DZZ A;  1NPZ A;  4N4Z A;  1NL6 A;  4D8I A;  3H6S A;  5A24 A;  2E00 A;  4OEL A;  4YVA A;  2YJ2 A;  1PPP A;  3HD3 A;  1TL9 A;  4W4U A;  4P6G A;  1PE6 A;  2AS8 A;  1PPO A;  1GEC E;  1U9W A;  3E1Z B;  1POP A;  3PHW A;  4QH6 A;  1F29 A;  4MM3 B;  4MSX A;  1XKG A;  2F1G A;  4RF1 A;  2E02 A;  1AEC A;  2GHU A;  4I04 A;  2DC8 A;  2DCB A;  2PNS A;  2H7J A;  1MEG A;  2VHF A;  4MI7 A;  5J94 A;  2BDZ A;  3K24 A;  4REZ A;  3IMA A;  2DC6 A;  4PP2 E;  4X6I A;  4BOU A;  1YT7 A;  1PCI A; 
#chains in the Genus database with same CATH homology
 2DCA A;  1NB5 A;  1KHP A;  2PBH A;  4BS5 A;  4CDE B;  1CS8 A;  2XU3 A;  2G8J A;  1THE A;  2AYO A;  3RVW A;  2OZ2 A;  1NB3 A;  3S3Q A;  4X6J A;  3MTN A;  1ITO A;  1CTE A;  2AVW A;  2PAD A;  2AUZ A;  3OVZ A;  3LTW A;  3ZUA A;  3D6S A;  3KX1 A;  2DCD A;  1AU4 A;  4QRV A;  1U5I A;  1F2C A;  4N8W A;  1GLO A;  3H89 A;  3V6E A;  1W5R A;  4MZO A;  2R9C A;  1TU6 A;  1TLO A;  2FO5 A;  2XU1 A;  2XU4 A;  3S3R A;  4BSQ A;  3O1G A;  4KLB A;  3KKU A;  2VFB A;  1YK8 A;  5JH3 A;  2Y6E A;  2DJF B;  2NQA A;  1QXP A;  2CIO A;  7PCK A;  4YYW A;  3I3T A;  3KWZ A;  5JA7 A;  2AYN A;  3P5V A;  4I05 A;  1KHQ A;  1MDW A;  1AU3 A;  1M6D A;  2IBI A;  1E2T A;  3MOR A;  1VSN A;  3K8U A;  1VJV A;  1W4T A;  1HUC B;  2AU1 A;  1AIM A;  2R9N A;  1AYU A;  2P86 A;  3H8B A;  4HWY A;  1EWL A;  5CVO B;  3P5X A;  4YYR A;  5F02 A;  4CDD B;  1BY8 A;  1GX3 A;  3OF9 A;  3H7D A;  1SP4 B;  3MHS A;  1GMY A;  1KXR A;  3KWB X;  1MEM A;  4P6E A;  2G8E A;  1S4V A;  1U9V A;  3CBJ A;  2F7D A;  4PP1 A;  2B1M A;  1CPJ A;  2YJ8 A;  3IOQ A;  2AUX A;  4YYQ A;  1Y08 A;  2BDL A;  1IWD A;  1ICF A;  3HWN A;  2FRQ A;  1PAD A;  1KFU L;  3QSD A;  1AYW A;  4QBB A;  3N3K A;  9PAP A;  2NQG A;  3KW9 A;  1QMY A;  2YJB A;  2R9O A;  3IV2 A;  1CJL A;  1PPD A;  3K9M A;  4CDC B;  2HH5 A;  4CZW A;  3ERV A;  2G7Y A;  3O0U A;  4AXM A;  3F5V A;  2WBF X;  3BPF A;  1PPN A;  3KFQ A;  4YV8 A;  3IHP A;  1ZCM A;  3H8C A;  1DEU A;  3QJ3 A;  1EWM A;  2VFC A;  5K16 A;  3PW3 A;  2Y5B A;  1X9Y A;  3GCB A;  1YAL A;  4QRX A;  3HHA A;  4YYS A;  3DF0 A;  1CQD A;  1K3B B;  4NV7 A;  1STF E;  2AIM A;  4BQV A;  4W5B A;  2ATO A;  4FK5 A;  5CVN B;  4YYU A;  3LFY A;  3WXG A;  8PCH A;  4YYV A;  3QT4 A;  3AI8 A;  2B1N A;  2PRE A;  3USV A;  4G54 A;  3C9E A;  1DF0 A;  2DC9 A;  1QOL A;  3LXS A;  1CB5 A;  1BQI A;  4BS6 A;  2R9F A;  2NQI A;  1U9X A;  3BOW A;  3BC3 A;  1YK7 A;  3PBH A;  1NQC A;  1ZIV A;  1U9Q X;  2ACT A;  4I07 A;  2FTD A;  2BSZ A;  3OIS A;  4Q8G A;  2ARY A;  1QDQ A;  4DMY A;  1CSB B;  1O0E A;  4FJC A;  1ME4 A;  2OUL A;  2XU5 A;  1MHW A;  2DJG B;  1JQP A;  5EF4 A;  1MIR A;  1KFX L;  4Q8H A;  1ME3 A;  3N4C A;  1YVB A;  3BCN A;  5FPW A;  1F2A A;  4B55 A;  2JQF R;  3IEJ A;  2O6X A;  1EWO A;  2VHS A;  4RY2 A;  3HHI A;  4OEM A;  1AU0 A;  1BP4 A;  1AU2 A;  1PBH A;  1FH0 A;  3BWK A;  3I06 A;  2OP3 A;  4PAD A;  3RVX A;  1F2B A;  2HD5 A;  1PXV A;  1BGO A;  3NHE A;  3PNR A;  3RVV A;  2FQ9 A;  1W6F A;  4CDF B;  3IUT A;  4WA6 A;  2R9M A;  2P0R A;  4PI3 A;  2DC7 A;  1Q6K A;  2C0Y A;  2DCC A;  2FYE A;  4X6H A;  2JQG R;  5PAD A;  3CBK A;  5EGW A;  4BGF A;  4N79 A;  3P5W A;  1Y4H A;  1SNK A;  2HXZ A;  2HHN A;  2E01 A;  3D9W A;  4NV8 A;  3PDF A;  3WXF A;  2P7U A;  2NQD B;  2E03 A;  3CH3 X;  6PAD A;  3WXE A;  3KSE A;  4FIP A;  5CVM A;  3F75 A;  3U8E A;  1PIP A;  3V6C A;  3N3G A;  3OF8 A;  2FRA A;  4BPV A;  1ATK A;  4XR7 A;  5CHT A;  2GFO A;  4MZS A;  3P5U A;  1A6R A;  2YJ9 A;  2YJC A;  4DMX A;  4K7C A;  2FT2 A;  2DZY A;  3TNX A;  2FUD A;  3M99 A;  3OVX A;  1MS6 A;  2CB5 A;  4XUI A;  5CHV A;  1EF7 A;  4AXL A;  3BPM A;  4QRG A;  1CV8 A;  2R6N A;  2IPP B;  1NLJ A;  1GCB A;  3MHH A;  4C5P A;  4ZUX U;  2G6D A;  3CH2 X;  1CVZ A;  1AYV A;  3B79 A;  1EWP A;  4W5C A;  2DZZ A;  4GUZ A;  1NPZ A;  4N4Z A;  1NL6 A;  3H6S A;  5A24 A;  2E00 A;  4OEL A;  4YVA A;  2YJ2 A;  1PPP A;  3HD3 A;  1TL9 A;  4W4U A;  4P6G A;  1PE6 A;  2AS8 A;  1PPO A;  1GEC E;  1U9W A;  3E1Z B;  1POP A;  4QH6 A;  1F29 A;  4MSX A;  1XKG A;  2F1G A;  2E02 A;  1AEC A;  2GHU A;  4I04 A;  2DC8 A;  2DCB A;  2PNS A;  2H7J A;  1MEG A;  2VHF A;  5J94 A;  2BDZ A;  3K24 A;  3IMA A;  2DC6 A;  4PP2 E;  4X6I A;  1YT7 A;  1PCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...