1QOLA

Structure of the fmdv leader protease
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
173
structure length
166
Chain Sequence
MELTLYNGEKKTFYSRPNNHDNAWLNAILQLFRYVEEPFFDWVYSSPENLTLEAIKQLEDLTGLELHEGGPPALVIWNIKHLLHTGIGTASRPSEVCVVDGTDMCLADFHAGIFLKGQEHAVFACVTSNGWYAIDDEDFYPWTPDPSDVLVFVPYDQKAKVQRKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Foot-and-Mouth Disease Virus Leader Protease: A Papain-Like Fold Adapted for Self-Processing and Eif4G Recognition.
pubmed doi rcsb
source organism Foot-and-mouth disease virus
molecule tags Hydrolase
molecule keywords PROTEASE (NONSTRUCTURAL PROTEIN P20A)
total genus 38
structure length 166
sequence length 173
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1qolA00
5JH3A 1ATKA 1MS6A 3USVA 3PW3A 2GFOA 1M6DA 2DCCA 1NB5A 2BDZA 3O1GA 2R9OA 2E00A 1YK7A 1A6RA 4MZSA 4FIPA 9PAPA 3MORA 2HHNA 2AUZA 3QT4A 4N8WA 3BWKA 4PI3A 1QXPA 4QH6A 2IPPB 5EGWA 1ZIVA 3GCBA 3C9EA 5PADA 1CV8A 3KWZA 3H6SA 1CJLA 2F7DA 4PP1A 7PCKA 2FO5A 4I04A 1CB5A 1MEMA 3ERVA 1BQIA 4AXMA 2FYEA 1DEUA 5CVNB 2G8EA 2NQDB 1MHWA 1AU4A 1QOLA 2HD5A 2XU5A 4CZWA 1PBHA 3PNRA 2Y5BA 1AECA 2FT2A 1BP4A 2E02A 3MTNA 1DF0A 4W5CA 2DJGB 4PP2E 2VHFA 2XU4A 4YYWA 1O0EA 3OVXA 2PNSA 2DC7A 1EWPA 3BPFA 4X6IA 1U9WA 2G8JA 3QSDA 1AIMA 1AYWA 4BS5A 5CVOB 2AYNA 1HUCB 2DCDA 3KSEA 1F2BA 4QRVA 1S4VA 1GCBA 3AI8A 3V6EA 1PE6A 2DZZA 4MZOA 2AIMA 8PCHA 1PPNA 4FJCA 3KKUA 4BSQA 5CHTA 1AU2A 4N79A 3H7DA 2GHUA 3BPMA 3BOWA 4W4UA 2R6NA 1JQPA 3RVVA 2R9MA 4X6HA 1U5IA 3BCNA 2FQ9A 4DMXA 3CBJA 3IMAA 4FK5A 4I07A 3HHIA 3N3GA 2R9CA 4BS6A 2G6DA 1ZCMA 1KFUL 4Q8HA 1CQDA 2YJ8A 4KLBA 1PXVA 2OP3A 5CVMA 3KWBX 1NPZA 1KXRA 3N3KA 1SP4B 3P5UA 2G7YA 1KFXL 2O6XA 3S3QA 1PCIA 4YYSA 2YJ9A 3BC3A 1QMYA 2P7UA 1FH0A 4QRGA 4G54A 3IHPA 1F2AA 2B1NA 2NQGA 5JA7A 3KX1A 1CPJA 4AXLA 1YK8A 2DCBA 4DMYA 1PPPA 4YYVA 3CBKA 3S3RA 1KHQA 2AVWA 1NLJA 2E01A 2NQAA 1X9YA 3D6SA 2DC8A 1CVZA 2C0YA 1ME3A 1XKGA 4ZUXU 2YJ2A 4WA6A 2XU1A 2BDLA 4I05A 1BGOA 3H89A 4YVAA 5CHVA 4QRXA 1KHPA 3N4CA 3OF9A 3U8EA 2F1GA 1AU0A 1CSBB 5EF4A 1U9XA 2FTDA 2JQFR 1ICFA 4RY2A 1AYUA 1EWLA 4MSXA 2YJCA 1CS8A 2VHSA 4YYRA 2P0RA 1YALA 1STFE 5FPWA 4CDFB 4N4ZA 3I3TA 2OZ2A 1K3BB 3IUTA 5A24A 4XR7A 3MHHA 3WXFA 4OEMA 1GECE 2DJFB 4YV8A 3PDFA 3LXSA 3IEJA 1MIRA 3E1ZB 3P5WA 2E03A 2HH5A 1TU6A 3K8UA 5F02A 2YJBA 1IWDA 4OELA 3HWNA 4P6GA 4XUIA 4YYUA 3IV2A 1Y4HA 4K7CA 2JQGR 6PADA 1NQCA 2AUXA 3K24A 4QBBA 2DZYA 2R9FA 2DC6A 3OF8A 3H8CA 2WBFX 4YYQA 3HD3A 4CDDB 3KW9A 1F2CA 1U9QX 3H8BA 1U9VA 3OISA 1CTEA 4CDCB 1TLOA 2P86A 4PADA 1NB3A 2R9NA 1Y08A 2HXZA 4HWYA 1BY8A 1QDQA 5J94A 1VJVA 2AU1A 3WXGA 1POPA 1YVBA 1SNKA 3F75A 1VSNA 1MEGA 1PPOA 2IBIA 2NQIA 4W5BA 4Q8GA 2B1MA 2CB5A 4X6JA 2DC9A 1F29A 3NHEA 3IOQA 3P5VA 1AYVA 3TNXA 1GLOA 1Q6KA 1PADA 1ME4A 2PADA 3HHAA 1YT7A 3WXEA 3RVWA 1MDWA 3PBHA 3CH2X 1NL6A 2H7JA 3QJ3A 3V6CA 2OULA 2ARYA 2CIOA 3K9MA 2AYOA 4CDEB 1GMYA 3KFQA 4BPVA 2FRAA 2DCAA 3LFYA 1THEA 3DF0A 2Y6EA 3F5VA 1EWOA 4P6EA 3O0UA 3OVZA 3MHSA 2FRQA 1PPDA 2PREA 3CH3X 4BQVA 2FUDA 1EWMA 3ZUAA 5K16A 2XU3A 3RVXA 2ACTA 3M99A 3I06A 3B79A 1PIPA 3P5XA 2AS8A 2ATOA 1AU3A 1ITOA 1EF7A 2PBHA 1TL9A
chains in the Genus database with same CATH superfamily
5JH3A 5JZEA 1ATKA 1DKIA 1MS6A 3USVA 3PW3A 2GFOA 1M6DA 2DCCA 1NB5A 2BDZA 4MI7A 3O1GA 2R9OA 2E00A 1YK7A 5KO3A 1A6RA 4MZSA 4FIPA 9PAPA 3MORA 2HHNA 2AUZA 3QT4A 4N8WA 3BWKA 4PI3A 1QXPA 4QH6A 2IPPB 5EGWA 1ZIVA 3GCBA 3C9EA 5PADA 3PT2A 1CV8A 3KWZA 3PHWA 3H6SA 1CJLA 4M0WA 3TRKA 2F7DA 4PP1A 7PCKA 2FO5A 4I04A 1CB5A 1MEMA 3ERVA 1BQIA 4HXDB 4AXMA 2FYEA 1DEUA 3PHUA 5CVNB 2G8EA 2NQDB 1MHWA 1AU4A 1QOLA 2HD5A 2XU5A 4CZWA 1PBHA 3PNRA 2Y5BA 3MP2A 1AECA 2FT2A 1BP4A 2E02A 3MTNA 1DF0A 4W5CA 2DJGB 4PP2E 2VHFA 2XU4A 4YYWA 1O0EA 4IUMA 3OVXA 2PNSA 2DC7A 2FE8A 1EWPA 3BPFA 3PHXA 4X6IA 1U9WA 2G8JA 3QSDA 4BOUA 1AIMA 5EZQA 4D8IA 1AYWA 4BS5A 5CVOB 2AGAA 2AYNA 1HUCB 2DCDA 3KSEA 1F2BA 4QRVA 1S4VA 1GCBA 3AI8A 3V6EA 1PE6A 2DZZA 4MZOA 2AIMA 8PCHA 1PPNA 4FJCA 3KKUA 4BSQA 5CHTA 1AU2A 4N79A 3H7DA 2GHUA 3BPMA 3BOWA 4W4UA 2R6NA 3PRPA 1JQPA 4OW0A 3RVVA 2R9MA 4X6HA 1U5IA 3BY4A 3BCNA 3B21A 2FQ9A 4DMXA 3CBJA 3IMAA 4FK5A 4I07A 3HHIA 3N3GA 2R9CA 4BS6A 2G6DA 1ZCMA 1KFUL 4R3DA 4Q8HA 1CQDA 2YJ8A 4KLBA 1PXVA 2OP3A 5CVMA 3KWBX 1NPZA 1KXRA 3N3KA 1SP4B 3P5UA 3PSEA 2G7YA 1KFXL 2O6XA 3S3QA 1PCIA 4YYSA 2YJ9A 3BC3A 1QMYA 2P7UA 1FH0A 4QRGA 4G54A 3IHPA 1F2AA 2B1NA 4BOPA 2NQGA 5JA7A 3KX1A 1CPJA 4ZTBA 4AXLA 1YK8A 2DCBA 4DMYA 1PPPA 4BOQA 4YYVA 4OVZB 3O65A 3CBKA 3S3RA 4OVZA 1KHQA 2AVWA 1NLJA 2E01A 2NQAA 3TMPA 4P16A 1X9YA 3D6SA 2DC8A 3E9SA 1CVZA 3MJ5A 2C0YA 1ME3A 1XKGA 4WURA 4ZUXU 2YJ2A 4REZA 4WA6A 3OQCA 2XU1A 2BDLA 4I05A 4A5UA 1BGOA 3H89A 4YVAA 5CHVA 2JRIA 4QRXA 1KHPA 3N4CA 2BTWB 3OF9A 3U8EA 2F1GA 1AU0A 1CSBB 5EF4A 4RF0A 1U9XA 2FTDA 2JQFR 4RF1A 1ICFA 4RY2A 1AYUA 1EWLA 4MSXA 2YJCA 1CS8A 2VHSA 4YYRA 3C0RA 2P0RA 1YALA 1STFE 5FPWA 4CDFB 4N4ZA 3I3TA 2OZ2A 1K3BB 3IUTA 5A24A 4XR7A 3MHHA 3WXFA 4OEMA 3PRMA 1GECE 2DJFB 4YV8A 3PDFA 3LXSA 3IEJA 1MIRA 3E1ZB 3P5WA 2E03A 2HH5A 2HWKA 1TU6A 3K8UA 2YJBA 1IWDA 4OELA 4P6GA 3HWNA 4XUIA 5F02A 4YYUA 3IV2A 1Y4HA 4K7CA 2JQGR 6PADA 1NQCA 2AUXA 3K24A 2BTWA 4QBBA 2DZYA 2R9FA 2DC6A 3OF8A 3H8CA 2WBFX 4YYQA 3HD3A 4CDDB 3KW9A 1F2CA 3W30A 1U9QX 3H8BA 1U9VA 3MTVA 3OISA 1CTEA 4IP3A 4CDCB 1TLOA 2P86A 4PADA 1NB3A 2R9NA 1Y08A 2HXZA 1YZBA 4HWYA 1BY8A 1QDQA 5J94A 4RNAA 1VJVA 2AU1A 3WXGA 1POPA 1YVBA 1SNKA 3F75A 4GUAA 1VSNA 1MEGA 1PPOA 2UZJA 2IBIA 2NQIA 5E6JA 4W5BA 4Q8GA 4RKXA 2B1MA 4BOZA 2CB5A 4X6JA 3ZNHA 4PT5A 2DC9A 1F29A 3NHEA 3W31A 3IOQA 3P5VA 1AYVA 3TNXA 1GLOA 1Q6KA 1PADA 1ME4A 2PADA 3HHAA 1YT7A 3WXEA 3RVWA 1MDWA 3PBHA 3CH2X 1NL6A 2H7JA 3QJ3A 3V6CA 2OULA 2ARYA 2CIOA 3K9MA 4D8BA 4XZXA 2AYOA 4CDEB 2DOSA 1GMYA 3KFQA 4BPVA 2FRAA 5EZSA 2DCAA 4MM3B 3LFYA 2Z84A 1THEA 1PVJA 3RNVA 3DF0A 2Y6EA 3F5VA 1EWOA 4P6EA 4BOSA 3O0UA 3OVZA 3MHSA 2FRQA 1PPDA 2PREA 3CH3X 4BQVA 1UKFA 2FUDA 1EWMA 3ZUAA 3BBAA 5K16A 2XU3A 3RVXA 2ACTA 2J7QA 4D8EA 2J7QC 3BB7A 3M99A 3I06A 3B79A 1PIPA 3P5XA 2BU3A 2AS8A 2ATOA 1AU3A 1ITOA 1EF7A 2JTCA 3IFUA 2PBHA 1TL9A
chains in the Genus database with same CATH topology
5JH3A 1ATKA 1MS6A 3USVA 3PW3A 2GFOA 1M6DA 2DCCA 1NB5A 2BDZA 3O1GA 2R9OA 2E00A 1YK7A 1A6RA 4MZSA 4FIPA 9PAPA 3MORA 2HHNA 2AUZA 3QT4A 4N8WA 3BWKA 4PI3A 3LTWA 1QXPA 4QH6A 2IPPB 5EGWA 1ZIVA 3GCBA 3C9EA 5PADA 2BSZA 1CV8A 3KWZA 1GX3A 3H6SA 1CJLA 2F7DA 4PP1A 7PCKA 2FO5A 4I04A 1CB5A 1MEMA 3ERVA 1BQIA 4AXMA 2FYEA 1DEUA 5CVNB 2G8EA 2NQDB 1MHWA 1AU4A 1QOLA 2HD5A 2XU5A 4CZWA 1PBHA 3PNRA 2Y5BA 1AECA 2FT2A 1BP4A 2E02A 3MTNA 1DF0A 4W5CA 2DJGB 4PP2E 2VHFA 2XU4A 4YYWA 1O0EA 3OVXA 2PNSA 2DC7A 1EWPA 3BPFA 4X6IA 1U9WA 2G8JA 3QSDA 1AIMA 1AYWA 4BS5A 5CVOB 2AYNA 1HUCB 2DCDA 3KSEA 1F2BA 4QRVA 1S4VA 1GCBA 3AI8A 3V6EA 1PE6A 2DZZA 4MZOA 2AIMA 8PCHA 1PPNA 4FJCA 3KKUA 4BSQA 5CHTA 1AU2A 4N79A 3H7DA 2GHUA 3BPMA 3BOWA 4W4UA 2R6NA 1JQPA 3RVVA 2R9MA 4X6HA 1U5IA 3BCNA 2FQ9A 4DMXA 3CBJA 3IMAA 4FK5A 4I07A 3HHIA 3N3GA 2R9CA 4BS6A 2G6DA 1ZCMA 1KFUL 4Q8HA 1CQDA 2YJ8A 4KLBA 1PXVA 2OP3A 5CVMA 3KWBX 1NPZA 1W6FA 1KXRA 3N3KA 1SP4B 3P5UA 2G7YA 1KFXL 2O6XA 3S3QA 1PCIA 4YYSA 2YJ9A 3BC3A 1QMYA 2P7UA 1FH0A 4QRGA 4G54A 3IHPA 1F2AA 2B1NA 2NQGA 5JA7A 3KX1A 1CPJA 4AXLA 1YK8A 2DCBA 4DMYA 1PPPA 4YYVA 3CBKA 3S3RA 1KHQA 2AVWA 1NLJA 2E01A 2NQAA 1X9YA 3D6SA 2DC8A 1CVZA 2C0YA 1ME3A 1XKGA 4ZUXU 2YJ2A 4WA6A 1W5RA 2XU1A 4C5PA 2BDLA 4I05A 1BGOA 3H89A 4YVAA 5CHVA 4QRXA 1KHPA 4NV7A 3N4CA 3OF9A 3U8EA 2F1GA 1AU0A 1CSBB 5EF4A 1U9XA 2FTDA 2JQFR 1ICFA 4RY2A 1AYUA 1EWLA 4MSXA 2YJCA 1CS8A 2VHSA 4YYRA 2P0RA 1YALA 1STFE 5FPWA 4CDFB 4B55A 4N4ZA 3I3TA 2OZ2A 1K3BB 3IUTA 5A24A 4XR7A 3MHHA 3WXFA 4OEMA 1GECE 2DJFB 4YV8A 3PDFA 3LXSA 3IEJA 1MIRA 3E1ZB 4GUZA 3P5WA 2E03A 2HH5A 2VFBA 1TU6A 3K8UA 5F02A 2YJBA 1IWDA 4OELA 3HWNA 4P6GA 4XUIA 4YYUA 3IV2A 1Y4HA 4K7CA 2JQGR 6PADA 1NQCA 2AUXA 3K24A 2VFCA 4QBBA 2DZYA 3D9WA 2R9FA 2DC6A 3OF8A 3H8CA 2WBFX 4YYQA 3HD3A 4CDDB 3KW9A 1F2CA 1U9QX 1E2TA 3H8BA 1U9VA 3OISA 1CTEA 4CDCB 1TLOA 2P86A 4PADA 1NB3A 2R9NA 1Y08A 2HXZA 4HWYA 1BY8A 1QDQA 5J94A 1VJVA 2AU1A 3WXGA 1POPA 1YVBA 1SNKA 3F75A 1VSNA 1MEGA 1PPOA 2IBIA 2NQIA 4W5BA 4Q8GA 2B1MA 2CB5A 4X6JA 2DC9A 1F29A 3NHEA 3IOQA 3P5VA 1AYVA 3TNXA 1GLOA 1Q6KA 1PADA 1ME4A 4NV8A 2PADA 4BGFA 3HHAA 1YT7A 3WXEA 3RVWA 1MDWA 3PBHA 3CH2X 1NL6A 2H7JA 3QJ3A 3V6CA 2OULA 2ARYA 2CIOA 3K9MA 2AYOA 4CDEB 1W4TA 1GMYA 3KFQA 4BPVA 2FRAA 2DCAA 3LFYA 1THEA 3DF0A 2Y6EA 3F5VA 1EWOA 4P6EA 3O0UA 3OVZA 3MHSA 2FRQA 1PPDA 2PREA 3CH3X 4BQVA 2FUDA 1EWMA 3ZUAA 5K16A 2XU3A 3RVXA 2ACTA 3M99A 3I06A 3B79A 1PIPA 3P5XA 2AS8A 2ATOA 1AU3A 1ITOA 1EF7A 2PBHA 1TL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JH3 A;  1ATK A;  1MS6 A;  3USV A;  3PW3 A;  2GFO A;  1M6D A;  2DCC A;  1NB5 A;  2BDZ A;  3O1G A;  2R9O A;  2E00 A;  1YK7 A;  1A6R A;  4MZS A;  4FIP A;  9PAP A;  3MOR A;  2HHN A;  2AUZ A;  3QT4 A;  4N8W A;  3BWK A;  4PI3 A;  1QXP A;  4QH6 A;  2IPP B;  5EGW A;  1ZIV A;  3GCB A;  3C9E A;  5PAD A;  1CV8 A;  3KWZ A;  3H6S A;  1CJL A;  2F7D A;  4PP1 A;  7PCK A;  2FO5 A;  4I04 A;  1CB5 A;  1MEM A;  3ERV A;  1BQI A;  4AXM A;  2FYE A;  1DEU A;  5CVN B;  2G8E A;  2NQD B;  1MHW A;  1AU4 A;  1QOL A;  2HD5 A;  2XU5 A;  4CZW A;  1PBH A;  3PNR A;  2Y5B A;  1AEC A;  2FT2 A;  1BP4 A;  2E02 A;  3MTN A;  1DF0 A;  4W5C A;  2DJG B;  4PP2 E;  2VHF A;  2XU4 A;  4YYW A;  1O0E A;  3OVX A;  2PNS A;  2DC7 A;  1EWP A;  3BPF A;  4X6I A;  1U9W A;  2G8J A;  3QSD A;  1AIM A;  1AYW A;  4BS5 A;  5CVO B;  2AYN A;  1HUC B;  2DCD A;  3KSE A;  1F2B A;  4QRV A;  1S4V A;  1GCB A;  3AI8 A;  3V6E A;  1PE6 A;  2DZZ A;  4MZO A;  2AIM A;  8PCH A;  1PPN A;  4FJC A;  3KKU A;  4BSQ A;  5CHT A;  1AU2 A;  4N79 A;  3H7D A;  2GHU A;  3BPM A;  3BOW A;  4W4U A;  2R6N A;  1JQP A;  3RVV A;  2R9M A;  4X6H A;  1U5I A;  3BCN A;  2FQ9 A;  4DMX A;  3CBJ A;  3IMA A;  4FK5 A;  4I07 A;  3HHI A;  3N3G A;  2R9C A;  4BS6 A;  2G6D A;  1ZCM A;  1KFU L;  4Q8H A;  1CQD A;  2YJ8 A;  4KLB A;  1PXV A;  2OP3 A;  5CVM A;  3KWB X;  1NPZ A;  1KXR A;  3N3K A;  1SP4 B;  3P5U A;  2G7Y A;  1KFX L;  2O6X A;  3S3Q A;  1PCI A;  4YYS A;  2YJ9 A;  3BC3 A;  1QMY A;  2P7U A;  1FH0 A;  4QRG A;  4G54 A;  3IHP A;  1F2A A;  2B1N A;  2NQG A;  5JA7 A;  3KX1 A;  1CPJ A;  4AXL A;  1YK8 A;  2DCB A;  4DMY A;  1PPP A;  4YYV A;  3CBK A;  3S3R A;  1KHQ A;  2AVW A;  1NLJ A;  2E01 A;  2NQA A;  1X9Y A;  3D6S A;  2DC8 A;  1CVZ A;  2C0Y A;  1ME3 A;  1XKG A;  4ZUX U;  2YJ2 A;  4WA6 A;  2XU1 A;  2BDL A;  4I05 A;  1BGO A;  3H89 A;  4YVA A;  5CHV A;  4QRX A;  1KHP A;  3N4C A;  3OF9 A;  3U8E A;  2F1G A;  1AU0 A;  1CSB B;  5EF4 A;  1U9X A;  2FTD A;  2JQF R;  1ICF A;  4RY2 A;  1AYU A;  1EWL A;  4MSX A;  2YJC A;  1CS8 A;  2VHS A;  4YYR A;  2P0R A;  1YAL A;  1STF E;  5FPW A;  4CDF B;  4N4Z A;  3I3T A;  2OZ2 A;  1K3B B;  3IUT A;  5A24 A;  4XR7 A;  3MHH A;  3WXF A;  4OEM A;  1GEC E;  2DJF B;  4YV8 A;  3PDF A;  3LXS A;  3IEJ A;  1MIR A;  3E1Z B;  3P5W A;  2E03 A;  2HH5 A;  1TU6 A;  3K8U A;  5F02 A;  2YJB A;  1IWD A;  4OEL A;  3HWN A;  4P6G A;  4XUI A;  4YYU A;  3IV2 A;  1Y4H A;  4K7C A;  2JQG R;  6PAD A;  1NQC A;  2AUX A;  3K24 A;  4QBB A;  2DZY A;  2R9F A;  2DC6 A;  3OF8 A;  3H8C A;  2WBF X;  4YYQ A;  3HD3 A;  4CDD B;  3KW9 A;  1F2C A;  1U9Q X;  3H8B A;  1U9V A;  3OIS A;  1CTE A;  4CDC B;  1TLO A;  2P86 A;  4PAD A;  1NB3 A;  2R9N A;  1Y08 A;  2HXZ A;  4HWY A;  1BY8 A;  1QDQ A;  5J94 A;  1VJV A;  2AU1 A;  3WXG A;  1POP A;  1YVB A;  1SNK A;  3F75 A;  1VSN A;  1MEG A;  1PPO A;  2IBI A;  2NQI A;  4W5B A;  4Q8G A;  2B1M A;  2CB5 A;  4X6J A;  2DC9 A;  1F29 A;  3NHE A;  3IOQ A;  3P5V A;  1AYV A;  3TNX A;  1GLO A;  1Q6K A;  1PAD A;  1ME4 A;  2PAD A;  3HHA A;  1YT7 A;  3WXE A;  3RVW A;  1MDW A;  3PBH A;  3CH2 X;  1NL6 A;  2H7J A;  3QJ3 A;  3V6C A;  2OUL A;  2ARY A;  2CIO A;  3K9M A;  2AYO A;  4CDE B;  1GMY A;  3KFQ A;  4BPV A;  2FRA A;  2DCA A;  3LFY A;  1THE A;  3DF0 A;  2Y6E A;  3F5V A;  1EWO A;  4P6E A;  3O0U A;  3OVZ A;  3MHS A;  2FRQ A;  1PPD A;  2PRE A;  3CH3 X;  4BQV A;  2FUD A;  1EWM A;  3ZUA A;  5K16 A;  2XU3 A;  3RVX A;  2ACT A;  3M99 A;  3I06 A;  3B79 A;  1PIP A;  3P5X A;  2AS8 A;  2ATO A;  1AU3 A;  1ITO A;  1EF7 A;  2PBH A;  1TL9 A; 
#chains in the Genus database with same CATH topology
 5JH3 A;  5JZE A;  1ATK A;  1DKI A;  1MS6 A;  3USV A;  3PW3 A;  2GFO A;  1M6D A;  2DCC A;  1NB5 A;  2BDZ A;  4MI7 A;  3O1G A;  2R9O A;  2E00 A;  1YK7 A;  5KO3 A;  1A6R A;  4MZS A;  4FIP A;  9PAP A;  3MOR A;  2HHN A;  2AUZ A;  3QT4 A;  4N8W A;  3BWK A;  4PI3 A;  1QXP A;  4QH6 A;  2IPP B;  5EGW A;  1ZIV A;  3GCB A;  3C9E A;  5PAD A;  3PT2 A;  1CV8 A;  3KWZ A;  3PHW A;  3H6S A;  1CJL A;  4M0W A;  3TRK A;  2F7D A;  4PP1 A;  7PCK A;  2FO5 A;  4I04 A;  1CB5 A;  1MEM A;  3ERV A;  1BQI A;  4HXD B;  4AXM A;  2FYE A;  1DEU A;  3PHU A;  5CVN B;  2G8E A;  2NQD B;  1MHW A;  1AU4 A;  1QOL A;  2HD5 A;  2XU5 A;  4CZW A;  1PBH A;  3PNR A;  2Y5B A;  3MP2 A;  1AEC A;  2FT2 A;  1BP4 A;  2E02 A;  3MTN A;  1DF0 A;  4W5C A;  2DJG B;  4PP2 E;  2VHF A;  2XU4 A;  4YYW A;  1O0E A;  4IUM A;  3OVX A;  2PNS A;  2DC7 A;  2FE8 A;  1EWP A;  3BPF A;  3PHX A;  4X6I A;  1U9W A;  2G8J A;  3QSD A;  4BOU A;  1AIM A;  5EZQ A;  4D8I A;  1AYW A;  4BS5 A;  5CVO B;  2AGA A;  2AYN A;  1HUC B;  2DCD A;  3KSE A;  1F2B A;  4QRV A;  1S4V A;  1GCB A;  3AI8 A;  3V6E A;  1PE6 A;  2DZZ A;  4MZO A;  2AIM A;  8PCH A;  1PPN A;  4FJC A;  3KKU A;  4BSQ A;  5CHT A;  1AU2 A;  4N79 A;  3H7D A;  2GHU A;  3BPM A;  3BOW A;  4W4U A;  2R6N A;  3PRP A;  1JQP A;  4OW0 A;  3RVV A;  2R9M A;  4X6H A;  1U5I A;  3BY4 A;  3BCN A;  3B21 A;  2FQ9 A;  4DMX A;  3CBJ A;  3IMA A;  4FK5 A;  4I07 A;  3HHI A;  3N3G A;  2R9C A;  4BS6 A;  2G6D A;  1ZCM A;  1KFU L;  4R3D A;  4Q8H A;  1CQD A;  2YJ8 A;  4KLB A;  1PXV A;  2OP3 A;  5CVM A;  3KWB X;  1NPZ A;  1KXR A;  3N3K A;  1SP4 B;  3P5U A;  3PSE A;  2G7Y A;  1KFX L;  2O6X A;  3S3Q A;  1PCI A;  4YYS A;  2YJ9 A;  3BC3 A;  1QMY A;  2P7U A;  1FH0 A;  4QRG A;  4G54 A;  3IHP A;  1F2A A;  2B1N A;  4BOP A;  2NQG A;  5JA7 A;  3KX1 A;  1CPJ A;  4ZTB A;  4AXL A;  1YK8 A;  2DCB A;  4DMY A;  1PPP A;  4BOQ A;  4YYV A;  4OVZ B;  3O65 A;  3CBK A;  3S3R A;  4OVZ A;  1KHQ A;  2AVW A;  1NLJ A;  2E01 A;  2NQA A;  3TMP A;  4P16 A;  1X9Y A;  3D6S A;  2DC8 A;  3E9S A;  1CVZ A;  3MJ5 A;  2C0Y A;  1ME3 A;  1XKG A;  4WUR A;  4ZUX U;  2YJ2 A;  4REZ A;  4WA6 A;  3OQC A;  2XU1 A;  2BDL A;  4I05 A;  4A5U A;  1BGO A;  3H89 A;  4YVA A;  5CHV A;  2JRI A;  4QRX A;  1KHP A;  3N4C A;  2BTW B;  3OF9 A;  3U8E A;  2F1G A;  1AU0 A;  1CSB B;  5EF4 A;  4RF0 A;  1U9X A;  2FTD A;  2JQF R;  4RF1 A;  1ICF A;  4RY2 A;  1AYU A;  1EWL A;  4MSX A;  2YJC A;  1CS8 A;  2VHS A;  4YYR A;  3C0R A;  2P0R A;  1YAL A;  1STF E;  5FPW A;  4CDF B;  4N4Z A;  3I3T A;  2OZ2 A;  1K3B B;  3IUT A;  5A24 A;  4XR7 A;  3MHH A;  3WXF A;  4OEM A;  3PRM A;  1GEC E;  2DJF B;  4YV8 A;  3PDF A;  3LXS A;  3IEJ A;  1MIR A;  3E1Z B;  3P5W A;  2E03 A;  2HH5 A;  2HWK A;  1TU6 A;  3K8U A;  2YJB A;  1IWD A;  4OEL A;  4P6G A;  3HWN A;  4XUI A;  5F02 A;  4YYU A;  3IV2 A;  1Y4H A;  4K7C A;  2JQG R;  6PAD A;  1NQC A;  2AUX A;  3K24 A;  2BTW A;  4QBB A;  2DZY A;  2R9F A;  2DC6 A;  3OF8 A;  3H8C A;  2WBF X;  4YYQ A;  3HD3 A;  4CDD B;  3KW9 A;  1F2C A;  3W30 A;  1U9Q X;  3H8B A;  1U9V A;  3MTV A;  3OIS A;  1CTE A;  4IP3 A;  4CDC B;  1TLO A;  2P86 A;  4PAD A;  1NB3 A;  2R9N A;  1Y08 A;  2HXZ A;  1YZB A;  4HWY A;  1BY8 A;  1QDQ A;  5J94 A;  4RNA A;  1VJV A;  2AU1 A;  3WXG A;  1POP A;  1YVB A;  1SNK A;  3F75 A;  4GUA A;  1VSN A;  1MEG A;  1PPO A;  2UZJ A;  2IBI A;  2NQI A;  5E6J A;  4W5B A;  4Q8G A;  4RKX A;  2B1M A;  4BOZ A;  2CB5 A;  4X6J A;  3ZNH A;  4PT5 A;  2DC9 A;  1F29 A;  3NHE A;  3W31 A;  3IOQ A;  3P5V A;  1AYV A;  3TNX A;  1GLO A;  1Q6K A;  1PAD A;  1ME4 A;  2PAD A;  3HHA A;  1YT7 A;  3WXE A;  3RVW A;  1MDW A;  3PBH A;  3CH2 X;  1NL6 A;  2H7J A;  3QJ3 A;  3V6C A;  2OUL A;  2ARY A;  2CIO A;  3K9M A;  4D8B A;  4XZX A;  2AYO A;  4CDE B;  2DOS A;  1GMY A;  3KFQ A;  4BPV A;  2FRA A;  5EZS A;  2DCA A;  4MM3 B;  3LFY A;  2Z84 A;  1THE A;  1PVJ A;  3RNV A;  3DF0 A;  2Y6E A;  3F5V A;  1EWO A;  4P6E A;  4BOS A;  3O0U A;  3OVZ A;  3MHS A;  2FRQ A;  1PPD A;  2PRE A;  3CH3 X;  4BQV A;  1UKF A;  2FUD A;  1EWM A;  3ZUA A;  3BBA A;  5K16 A;  2XU3 A;  3RVX A;  2ACT A;  2J7Q A;  4D8E A;  2J7Q C;  3BB7 A;  3M99 A;  3I06 A;  3B79 A;  1PIP A;  3P5X A;  2BU3 A;  2AS8 A;  2ATO A;  1AU3 A;  1ITO A;  1EF7 A;  2JTC A;  3IFU A;  2PBH A;  1TL9 A; 
#chains in the Genus database with same CATH homology
 5JH3 A;  1ATK A;  1MS6 A;  3USV A;  3PW3 A;  2GFO A;  1M6D A;  2DCC A;  1NB5 A;  2BDZ A;  3O1G A;  2R9O A;  2E00 A;  1YK7 A;  1A6R A;  4MZS A;  4FIP A;  9PAP A;  3MOR A;  2HHN A;  2AUZ A;  3QT4 A;  4N8W A;  3BWK A;  4PI3 A;  3LTW A;  1QXP A;  4QH6 A;  2IPP B;  5EGW A;  1ZIV A;  3GCB A;  3C9E A;  5PAD A;  2BSZ A;  1CV8 A;  3KWZ A;  1GX3 A;  3H6S A;  1CJL A;  2F7D A;  4PP1 A;  7PCK A;  2FO5 A;  4I04 A;  1CB5 A;  1MEM A;  3ERV A;  1BQI A;  4AXM A;  2FYE A;  1DEU A;  5CVN B;  2G8E A;  2NQD B;  1MHW A;  1AU4 A;  1QOL A;  2HD5 A;  2XU5 A;  4CZW A;  1PBH A;  3PNR A;  2Y5B A;  1AEC A;  2FT2 A;  1BP4 A;  2E02 A;  3MTN A;  1DF0 A;  4W5C A;  2DJG B;  4PP2 E;  2VHF A;  2XU4 A;  4YYW A;  1O0E A;  3OVX A;  2PNS A;  2DC7 A;  1EWP A;  3BPF A;  4X6I A;  1U9W A;  2G8J A;  3QSD A;  1AIM A;  1AYW A;  4BS5 A;  5CVO B;  2AYN A;  1HUC B;  2DCD A;  3KSE A;  1F2B A;  4QRV A;  1S4V A;  1GCB A;  3AI8 A;  3V6E A;  1PE6 A;  2DZZ A;  4MZO A;  2AIM A;  8PCH A;  1PPN A;  4FJC A;  3KKU A;  4BSQ A;  5CHT A;  1AU2 A;  4N79 A;  3H7D A;  2GHU A;  3BPM A;  3BOW A;  4W4U A;  2R6N A;  1JQP A;  3RVV A;  2R9M A;  4X6H A;  1U5I A;  3BCN A;  2FQ9 A;  4DMX A;  3CBJ A;  3IMA A;  4FK5 A;  4I07 A;  3HHI A;  3N3G A;  2R9C A;  4BS6 A;  2G6D A;  1ZCM A;  1KFU L;  4Q8H A;  1CQD A;  2YJ8 A;  4KLB A;  1PXV A;  2OP3 A;  5CVM A;  3KWB X;  1NPZ A;  1W6F A;  1KXR A;  3N3K A;  1SP4 B;  3P5U A;  2G7Y A;  1KFX L;  2O6X A;  3S3Q A;  1PCI A;  4YYS A;  2YJ9 A;  3BC3 A;  1QMY A;  2P7U A;  1FH0 A;  4QRG A;  4G54 A;  3IHP A;  1F2A A;  2B1N A;  2NQG A;  5JA7 A;  3KX1 A;  1CPJ A;  4AXL A;  1YK8 A;  2DCB A;  4DMY A;  1PPP A;  4YYV A;  3CBK A;  3S3R A;  1KHQ A;  2AVW A;  1NLJ A;  2E01 A;  2NQA A;  1X9Y A;  3D6S A;  2DC8 A;  1CVZ A;  2C0Y A;  1ME3 A;  1XKG A;  4ZUX U;  2YJ2 A;  4WA6 A;  1W5R A;  2XU1 A;  4C5P A;  2BDL A;  4I05 A;  1BGO A;  3H89 A;  4YVA A;  5CHV A;  4QRX A;  1KHP A;  4NV7 A;  3N4C A;  3OF9 A;  3U8E A;  2F1G A;  1AU0 A;  1CSB B;  5EF4 A;  1U9X A;  2FTD A;  2JQF R;  1ICF A;  4RY2 A;  1AYU A;  1EWL A;  4MSX A;  2YJC A;  1CS8 A;  2VHS A;  4YYR A;  2P0R A;  1YAL A;  1STF E;  5FPW A;  4CDF B;  4B55 A;  4N4Z A;  3I3T A;  2OZ2 A;  1K3B B;  3IUT A;  5A24 A;  4XR7 A;  3MHH A;  3WXF A;  4OEM A;  1GEC E;  2DJF B;  4YV8 A;  3PDF A;  3LXS A;  3IEJ A;  1MIR A;  3E1Z B;  4GUZ A;  3P5W A;  2E03 A;  2HH5 A;  2VFB A;  1TU6 A;  3K8U A;  5F02 A;  2YJB A;  1IWD A;  4OEL A;  3HWN A;  4P6G A;  4XUI A;  4YYU A;  3IV2 A;  1Y4H A;  4K7C A;  2JQG R;  6PAD A;  1NQC A;  2AUX A;  3K24 A;  2VFC A;  4QBB A;  2DZY A;  3D9W A;  2R9F A;  2DC6 A;  3OF8 A;  3H8C A;  2WBF X;  4YYQ A;  3HD3 A;  4CDD B;  3KW9 A;  1F2C A;  1U9Q X;  1E2T A;  3H8B A;  1U9V A;  3OIS A;  1CTE A;  4CDC B;  1TLO A;  2P86 A;  4PAD A;  1NB3 A;  2R9N A;  1Y08 A;  2HXZ A;  4HWY A;  1BY8 A;  1QDQ A;  5J94 A;  1VJV A;  2AU1 A;  3WXG A;  1POP A;  1YVB A;  1SNK A;  3F75 A;  1VSN A;  1MEG A;  1PPO A;  2IBI A;  2NQI A;  4W5B A;  4Q8G A;  2B1M A;  2CB5 A;  4X6J A;  2DC9 A;  1F29 A;  3NHE A;  3IOQ A;  3P5V A;  1AYV A;  3TNX A;  1GLO A;  1Q6K A;  1PAD A;  1ME4 A;  4NV8 A;  2PAD A;  4BGF A;  3HHA A;  1YT7 A;  3WXE A;  3RVW A;  1MDW A;  3PBH A;  3CH2 X;  1NL6 A;  2H7J A;  3QJ3 A;  3V6C A;  2OUL A;  2ARY A;  2CIO A;  3K9M A;  2AYO A;  4CDE B;  1W4T A;  1GMY A;  3KFQ A;  4BPV A;  2FRA A;  2DCA A;  3LFY A;  1THE A;  3DF0 A;  2Y6E A;  3F5V A;  1EWO A;  4P6E A;  3O0U A;  3OVZ A;  3MHS A;  2FRQ A;  1PPD A;  2PRE A;  3CH3 X;  4BQV A;  2FUD A;  1EWM A;  3ZUA A;  5K16 A;  2XU3 A;  3RVX A;  2ACT A;  3M99 A;  3I06 A;  3B79 A;  1PIP A;  3P5X A;  2AS8 A;  2ATO A;  1AU3 A;  1ITO A;  1EF7 A;  2PBH A;  1TL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...