1QOLA

Structure of the fmdv leader protease
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
173
structure length
166
Chain Sequence
MELTLYNGEKKTFYSRPNNHDNAWLNAILQLFRYVEEPFFDWVYSSPENLTLEAIKQLEDLTGLELHEGGPPALVIWNIKHLLHTGIGTASRPSEVCVVDGTDMCLADFHAGIFLKGQEHAVFACVTSNGWYAIDDEDFYPWTPDPSDVLVFVPYDQKAKVQRKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEASE (NONSTRUCTURAL PROTEIN P20A)
publication title Structure of the Foot-and-Mouth Disease Virus Leader Protease: A Papain-Like Fold Adapted for Self-Processing and Eif4G Recognition.
pubmed doi rcsb
source organism Foot-and-mouth disease virus
molecule tags Hydrolase
total genus 38
structure length 166
sequence length 173
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1qolA00
1M6DA 1NB3A 4XR7A 2ARYA 2OP3A 1ME3A 2FRAA 2YJ2A 1NPZA 5PADA 3PBHA 4BSQA 2IPPB 9PAPA 1MS6A 2R9MA 3QSDA 1AECA 1AU4A 1U5IA 3CBKA 4G54A 2H7JA 2G6DA 2R9NA 3BPMA 5J94A 1HUCB 2Y5BA 2XU4A 1GCBA 2R9FA 2B1NA 2BDLA 2AUXA 2YJ8A 2F7DA 3AI8A 7PCKA 4OELA 3KSEA 4RY2A 1NLJA 2FRQA 1CSBB 1QMYA 3KWBX 2DZZA 1MEMA 2P7UA 3D6SA 3H6SA 4P6EA 2R6NA 3KFQA 5EF4A 4YYVA 1CQDA 2FTDA 2YJCA 8PCHA 4N79A 4PI3A 4MSXA 1XKGA 1U9WA 3RVVA 1QXPA 3O1GA 1AYWA 2G7YA 2ATOA 1ZIVA 4X6HA 2CIOA 1CPJA 3IOQA 2FUDA 1X9YA 1PPOA 4DMXA 1TLOA 2NQAA 3N4CA 2JQGR 4N4ZA 3IEJA 1BGOA 1GMYA 3CH3X 2E03A 2ACTA 2PADA 3MHHA 2VHFA 2XU5A 1PPNA 2E01A 1K3BB 1F2AA 1Q6KA 3P5VA 5CVOB 4CDDB 2DC8A 5FPWA 1PPPA 5CVMA 3RVXA 4BPVA 3ERVA 1PE6A 1POPA 1AIMA 4QH6A 1JQPA 2AS8A 3P5WA 1O0EA 3PNRA 1GLOA 2BDZA 5EGWA 4CDEB 3S3QA 4Q8HA 4X6JA 3CH2X 2NQDB 1S4VA 4BQVA 4HWYA 4AXLA 5CHVA 2FYEA 3LXSA 4QRXA 1BY8A 3P5UA 5F02A 3N3KA 2R9OA 4W4UA 3P5XA 3E1ZB 1ICFA 1VJVA 2HD5A 4CDFB 3B79A 3PDFA 2OZ2A 5CHTA 1TU6A 1CVZA 3KW9A 6PADA 3I06A 3HHIA 4ZUXU 1YK7A 1DEUA 3HD3A 4W5CA 1KHPA 4OEMA 2OULA 1AYUA 3NHEA 3HHAA 4YVAA 2G8JA 2G8EA 3U8EA 5K16A 1MEGA 4MZOA 4BS6A 1YVBA 4FK5A 1PADA 3LFYA 3V6CA 2DJFB 2FQ9A 1BP4A 2AVWA 2P0RA 1AU2A 1SP4B 2HXZA 1A6RA 2XU1A 1VSNA 1F29A 3MHSA 1YT7A 3CBJA 4DMYA 1EWLA 4FJCA 1QDQA 2DZYA 4YYRA 2DCCA 2AUZA 4YYQA 4YV8A 1PBHA 3BWKA 3OF9A 1KFXL 2YJ9A 3KX1A 1QOLA 2DC6A 2JQFR 3USVA 3C9EA 3KWZA 2DCBA 2HH5A 2PNSA 2XU3A 1SNKA 4K7CA 3F5VA 4I05A 4AXMA 4FIPA 4PP1A 3MORA 3WXGA 4Q8GA 3BCNA 2GFOA 4I07A 1THEA 1U9QX 2DJGB 1Y08A 2AU1A 4QRVA 1U9VA 2O6XA 1KXRA 2DC7A 4CZWA 3DF0A 3OF8A 1MDWA 2F1GA 1ITOA 1BQIA 1NB5A 3F75A 2HHNA 3HWNA 4P6GA 3S3RA 3OISA 1EWOA 1AU0A 3ZUAA 3OVZA 4XUIA 4QBBA 1Y4HA 2C0YA 1YALA 1CS8A 3K8UA 1ZCMA 3QJ3A 3N3GA 1AYVA 1PIPA 2AIMA 3MTNA 1FH0A 3K9MA 1NQCA 1TL9A 4YYWA 3BC3A 1KFUL 2Y6EA 3IHPA 1STFE 2R9CA 3RVWA 4WA6A 3H8BA 1CV8A 4YYUA 2GHUA 1GECE 3PW3A 1CTEA 2E00A 3H7DA 5CVNB 2E02A 1F2BA 1ATKA 3WXEA 3I3TA 4N8WA 3OVXA 2AYOA 3H8CA 1PPDA 2DCDA 2DCAA 2IBIA 2YJBA 4PP2E 5A24A 1CB5A 3QT4A 3IV2A 3H89A 4X6IA 1DF0A 2NQGA 4QRGA 3WXFA 3TNXA 2P86A 2VHSA 2NQIA 3BPFA 1CJLA 2FO5A 5JH3A 4CDCB 3BOWA 2DC9A 1EF7A 1PCIA 3KKUA 2AYNA 3IUTA 3K24A 1NL6A 1PXVA 1IWDA 3M99A 2B1MA 3IMAA 4I04A 3GCBA 5JA7A 1EWMA 1MHWA 1YK8A 2PREA 2CB5A 2WBFX 4YYSA 4PADA 3V6EA 1U9XA 1MIRA 1EWPA 1AU3A 1KHQA 2FT2A 4MZSA 3O0UA 4W5BA 4KLBA 2PBHA 4BS5A 1F2CA 1ME4A
chains in the Genus database with same CATH superfamily
1M6DA 1NB3A 4XR7A 2ARYA 2OP3A 1ME3A 2FRAA 2YJ2A 1NPZA 5PADA 3PBHA 4BSQA 2IPPB 9PAPA 1MS6A 2R9MA 3QSDA 4WURA 1AECA 1AU4A 1U5IA 3CBKA 4G54A 2H7JA 2G6DA 2R9NA 3BPMA 4BOQA 5J94A 2BTWA 1HUCB 2Y5BA 2XU4A 1GCBA 2R9FA 2B1NA 2BDLA 2AUXA 4BOSA 2YJ8A 2F7DA 3BBAA 3AI8A 7PCKA 4A5UA 4OELA 3KSEA 3MTVA 4RY2A 4D8EA 3PHUA 1NLJA 2FRQA 1CSBB 1QMYA 3KWBX 2DZZA 1MEMA 2P7UA 3D6SA 3H6SA 4P6EA 2R6NA 3KFQA 5EF4A 4YYVA 1CQDA 2FTDA 3TRKA 2YJCA 8PCHA 4N79A 2BU3A 4BOZA 4PI3A 4MSXA 1XKGA 1U9WA 3RVVA 1QXPA 3O1GA 5EZQA 1AYWA 2G7YA 2ATOA 1ZIVA 5KO3A 4X6HA 2CIOA 1CPJA 3IOQA 2FUDA 1X9YA 2JTCA 1PPOA 4DMXA 1TLOA 2NQAA 3N4CA 2JQGR 4N4ZA 3IEJA 2FE8A 4R3DA 3W31A 1BGOA 1GMYA 3CH3X 2E03A 2ACTA 2PADA 3MHHA 2VHFA 2XU5A 1PPNA 2E01A 1K3BB 3IFUA 1F2AA 1Q6KA 3P5VA 3W30A 5CVOB 4CDDB 2DC8A 5FPWA 1PPPA 5CVMA 3RVXA 4BPVA 3ERVA 1PE6A 1POPA 1AIMA 4QH6A 1JQPA 2AS8A 3E9SA 3P5WA 1O0EA 3PNRA 1GLOA 2BDZA 5EGWA 4CDEB 2J7QC 4BOUA 3S3QA 4Q8HA 2DOSA 3CH2X 4X6JA 2NQDB 1S4VA 4BQVA 4HWYA 4AXLA 5CHVA 2FYEA 3LXSA 4QRXA 1BY8A 3P5UA 5F02A 3N3KA 2R9OA 4W4UA 3P5XA 3E1ZB 3PRPA 1ICFA 1VJVA 2HD5A 4CDFB 4RF1A 3B79A 3PDFA 2OZ2A 5CHTA 1TU6A 4REZA 1CVZA 3KW9A 6PADA 3I06A 3HHIA 4ZUXU 1YK7A 5JZEA 1DEUA 3TMPA 3HD3A 4W5CA 1KHPA 4OEMA 3C0RA 2OULA 1AYUA 3NHEA 3HHAA 4YVAA 4BOPA 2G8JA 2G8EA 3U8EA 5K16A 1MEGA 4RNAA 4MZOA 4BS6A 1YVBA 4FK5A 4IUMA 1PADA 3LFYA 3V6CA 2DJFB 2FQ9A 1BP4A 4PT5A 2AVWA 2P0RA 1AU2A 1SP4B 2HXZA 1A6RA 2XU1A 1VSNA 1F29A 4M0WA 3MHSA 1YT7A 3ZNHA 3PHWA 3CBJA 4HXDB 4DMYA 1EWLA 3PHXA 4FJCA 1QDQA 2DZYA 4YYRA 4MI7A 2DCCA 2AUZA 4YYQA 2AGAA 4YV8A 1PBHA 3BWKA 3OF9A 1KFXL 2YJ9A 3KX1A 1QOLA 2DC6A 2JQFR 3USVA 3C9EA 3KWZA 2DCBA 2HH5A 2PNSA 2XU3A 4MM3B 1SNKA 4K7CA 1DKIA 3F5VA 4ZTBA 4I05A 4OVZB 4AXMA 4FIPA 4PP1A 3MORA 3WXGA 4Q8GA 3BCNA 2GFOA 4I07A 1THEA 1U9QX 1UKFA 2DJGB 4D8IA 1Y08A 2AU1A 4QRVA 1U9VA 2O6XA 1YZBA 1KXRA 2DC7A 4CZWA 3DF0A 3OF8A 1MDWA 2UZJA 2F1GA 1ITOA 1BQIA 1NB5A 3F75A 3RNVA 2HHNA 2JRIA 3HWNA 4P6GA 3S3RA 3OISA 1EWOA 1AU0A 3ZUAA 4XZXA 3OVZA 4XUIA 4QBBA 1Y4HA 2C0YA 1YALA 4OVZA 1CS8A 3MJ5A 3K8UA 1ZCMA 3QJ3A 3N3GA 1AYVA 3BY4A 1PIPA 2AIMA 4RF0A 3MTNA 1FH0A 3K9MA 1NQCA 1TL9A 4YYWA 3BC3A 1KFUL 2Y6EA 3IHPA 1STFE 2R9CA 3RVWA 4WA6A 3H8BA 1CV8A 4YYUA 3PSEA 2GHUA 1GECE 3PW3A 3B21A 1CTEA 3OQCA 2E00A 3H7DA 5CVNB 2E02A 1F2BA 1ATKA 3WXEA 3I3TA 4N8WA 3OVXA 2AYOA 3H8CA 1PPDA 2DCDA 2DCAA 2IBIA 2YJBA 4PP2E 5A24A 1CB5A 3QT4A 3IV2A 3H89A 3BB7A 4X6IA 1DF0A 2NQGA 4IP3A 4QRGA 4RKXA 3WXFA 3TNXA 2P86A 2VHSA 3MP2A 2NQIA 3BPFA 4D8BA 1CJLA 2FO5A 5JH3A 3PRMA 4CDCB 3BOWA 2DC9A 1EF7A 1PCIA 3KKUA 2AYNA 3IUTA 3K24A 4GUAA 1NL6A 1PXVA 1IWDA 3M99A 2B1MA 3IMAA 4I04A 3GCBA 3PT2A 5JA7A 1EWMA 1MHWA 2BTWB 1YK8A 2PREA 2CB5A 2WBFX 4YYSA 2HWKA 4PADA 3V6EA 1U9XA 1MIRA 1EWPA 3O65A 1AU3A 1KHQA 5E6JA 2FT2A 4MZSA 3O0UA 4W5BA 4KLBA 2J7QA 2PBHA 1PVJA 4P16A 2Z84A 4OW0A 4BS5A 1F2CA 1ME4A 5EZSA
chains in the Genus database with same CATH topology
1M6DA 1NB3A 4XR7A 2ARYA 2OP3A 1ME3A 2FRAA 2YJ2A 1NPZA 5PADA 2BSZA 3PBHA 4NV8A 4BSQA 2IPPB 9PAPA 1MS6A 2R9MA 3QSDA 1AECA 1AU4A 1U5IA 3CBKA 4G54A 2H7JA 2G6DA 2R9NA 3BPMA 5J94A 1HUCB 2Y5BA 2XU4A 1GCBA 2R9FA 2B1NA 2BDLA 2AUXA 2YJ8A 2F7DA 3AI8A 7PCKA 4OELA 3KSEA 4RY2A 1NLJA 2FRQA 1CSBB 1QMYA 3KWBX 2DZZA 1MEMA 1W5RA 2P7UA 3D6SA 3H6SA 4P6EA 2R6NA 3KFQA 5EF4A 4YYVA 1CQDA 2FTDA 2YJCA 8PCHA 4N79A 4PI3A 4MSXA 1XKGA 1U9WA 3RVVA 1QXPA 3O1GA 4B55A 1AYWA 2G7YA 2ATOA 1ZIVA 4X6HA 2CIOA 1CPJA 3IOQA 2FUDA 1X9YA 1PPOA 4DMXA 1TLOA 2NQAA 3N4CA 2JQGR 4N4ZA 3IEJA 1BGOA 1GMYA 3CH3X 2E03A 2ACTA 2PADA 3MHHA 2VHFA 2XU5A 1PPNA 2E01A 1K3BB 1F2AA 1Q6KA 3P5VA 5CVOB 4CDDB 2DC8A 5FPWA 1PPPA 5CVMA 3RVXA 4BPVA 3ERVA 1PE6A 1POPA 1AIMA 4QH6A 1JQPA 2AS8A 3P5WA 1O0EA 3PNRA 1GLOA 2BDZA 5EGWA 4CDEB 3S3QA 4Q8HA 4X6JA 3CH2X 2NQDB 1S4VA 4BQVA 4HWYA 4AXLA 5CHVA 2FYEA 3LXSA 4QRXA 1BY8A 3P5UA 5F02A 3N3KA 2R9OA 4W4UA 3P5XA 3E1ZB 1ICFA 1VJVA 2HD5A 4CDFB 3B79A 3PDFA 2OZ2A 5CHTA 1TU6A 1CVZA 3KW9A 6PADA 3I06A 3HHIA 4ZUXU 1YK7A 1DEUA 3HD3A 4W5CA 1KHPA 4OEMA 2OULA 1AYUA 3NHEA 3HHAA 4YVAA 2G8JA 2G8EA 3U8EA 5K16A 1MEGA 4MZOA 4BS6A 1YVBA 4FK5A 1PADA 3LFYA 3V6CA 2DJFB 2FQ9A 1BP4A 2AVWA 2P0RA 1AU2A 1SP4B 2HXZA 1A6RA 2XU1A 1VSNA 1F29A 3MHSA 1YT7A 3CBJA 4DMYA 1EWLA 4FJCA 1QDQA 2DZYA 4YYRA 2DCCA 2AUZA 4YYQA 4YV8A 1PBHA 3BWKA 3OF9A 1KFXL 2YJ9A 3KX1A 1QOLA 2DC6A 2JQFR 3USVA 3C9EA 3KWZA 2DCBA 2HH5A 2PNSA 2XU3A 4NV7A 1SNKA 4K7CA 2VFBA 3F5VA 4I05A 4AXMA 4FIPA 4PP1A 3MORA 3WXGA 4Q8GA 3BCNA 2GFOA 4I07A 1THEA 1U9QX 2DJGB 1Y08A 2AU1A 4QRVA 1U9VA 2O6XA 1KXRA 2DC7A 4CZWA 3DF0A 3OF8A 1MDWA 2F1GA 1ITOA 1BQIA 1NB5A 3F75A 2HHNA 3HWNA 4P6GA 3S3RA 3OISA 1EWOA 1AU0A 3ZUAA 3OVZA 4XUIA 4QBBA 1Y4HA 2C0YA 1YALA 1CS8A 4C5PA 3K8UA 1ZCMA 3QJ3A 3N3GA 1AYVA 1PIPA 2AIMA 3MTNA 1FH0A 3K9MA 1NQCA 1W4TA 1TL9A 4YYWA 3BC3A 1KFUL 2Y6EA 3IHPA 1STFE 2R9CA 3RVWA 4WA6A 1E2TA 3H8BA 1CV8A 4YYUA 2VFCA 2GHUA 1GECE 1W6FA 3PW3A 1CTEA 2E00A 3H7DA 5CVNB 2E02A 1F2BA 1ATKA 3WXEA 3I3TA 4N8WA 3OVXA 2AYOA 3H8CA 1PPDA 2DCDA 2DCAA 2IBIA 2YJBA 4PP2E 5A24A 1CB5A 3QT4A 3IV2A 3H89A 4BGFA 4X6IA 1DF0A 2NQGA 4GUZA 4QRGA 3WXFA 3TNXA 2P86A 2VHSA 2NQIA 3BPFA 1CJLA 2FO5A 5JH3A 4CDCB 3BOWA 2DC9A 1EF7A 1PCIA 3KKUA 2AYNA 3IUTA 3K24A 1GX3A 1NL6A 1PXVA 1IWDA 3M99A 2B1MA 3IMAA 4I04A 3GCBA 5JA7A 1EWMA 1MHWA 1YK8A 2PREA 2CB5A 2WBFX 4YYSA 4PADA 3V6EA 1U9XA 1MIRA 1EWPA 1AU3A 1KHQA 2FT2A 4MZSA 3O0UA 4W5BA 4KLBA 2PBHA 3LTWA 4BS5A 1F2CA 3D9WA 1ME4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M6D A;  1NB3 A;  4XR7 A;  2ARY A;  2OP3 A;  1ME3 A;  2FRA A;  2YJ2 A;  1NPZ A;  5PAD A;  3PBH A;  4BSQ A;  2IPP B;  9PAP A;  1MS6 A;  2R9M A;  3QSD A;  1AEC A;  1AU4 A;  1U5I A;  3CBK A;  4G54 A;  2H7J A;  2G6D A;  2R9N A;  3BPM A;  5J94 A;  1HUC B;  2Y5B A;  2XU4 A;  1GCB A;  2R9F A;  2B1N A;  2BDL A;  2AUX A;  2YJ8 A;  2F7D A;  3AI8 A;  7PCK A;  4OEL A;  3KSE A;  4RY2 A;  1NLJ A;  2FRQ A;  1CSB B;  1QMY A;  3KWB X;  2DZZ A;  1MEM A;  2P7U A;  3D6S A;  3H6S A;  4P6E A;  2R6N A;  3KFQ A;  5EF4 A;  4YYV A;  1CQD A;  2FTD A;  2YJC A;  8PCH A;  4N79 A;  4PI3 A;  4MSX A;  1XKG A;  1U9W A;  3RVV A;  1QXP A;  3O1G A;  1AYW A;  2G7Y A;  2ATO A;  1ZIV A;  4X6H A;  2CIO A;  1CPJ A;  3IOQ A;  2FUD A;  1X9Y A;  1PPO A;  4DMX A;  1TLO A;  2NQA A;  3N4C A;  2JQG R;  4N4Z A;  3IEJ A;  1BGO A;  1GMY A;  3CH3 X;  2E03 A;  2ACT A;  2PAD A;  3MHH A;  2VHF A;  2XU5 A;  1PPN A;  2E01 A;  1K3B B;  1F2A A;  1Q6K A;  3P5V A;  5CVO B;  4CDD B;  2DC8 A;  5FPW A;  1PPP A;  5CVM A;  3RVX A;  4BPV A;  3ERV A;  1PE6 A;  1POP A;  1AIM A;  4QH6 A;  1JQP A;  2AS8 A;  3P5W A;  1O0E A;  3PNR A;  1GLO A;  2BDZ A;  5EGW A;  4CDE B;  3S3Q A;  4Q8H A;  4X6J A;  3CH2 X;  2NQD B;  1S4V A;  4BQV A;  4HWY A;  4AXL A;  5CHV A;  2FYE A;  3LXS A;  4QRX A;  1BY8 A;  3P5U A;  5F02 A;  3N3K A;  2R9O A;  4W4U A;  3P5X A;  3E1Z B;  1ICF A;  1VJV A;  2HD5 A;  4CDF B;  3B79 A;  3PDF A;  2OZ2 A;  5CHT A;  1TU6 A;  1CVZ A;  3KW9 A;  6PAD A;  3I06 A;  3HHI A;  4ZUX U;  1YK7 A;  1DEU A;  3HD3 A;  4W5C A;  1KHP A;  4OEM A;  2OUL A;  1AYU A;  3NHE A;  3HHA A;  4YVA A;  2G8J A;  2G8E A;  3U8E A;  5K16 A;  1MEG A;  4MZO A;  4BS6 A;  1YVB A;  4FK5 A;  1PAD A;  3LFY A;  3V6C A;  2DJF B;  2FQ9 A;  1BP4 A;  2AVW A;  2P0R A;  1AU2 A;  1SP4 B;  2HXZ A;  1A6R A;  2XU1 A;  1VSN A;  1F29 A;  3MHS A;  1YT7 A;  3CBJ A;  4DMY A;  1EWL A;  4FJC A;  1QDQ A;  2DZY A;  4YYR A;  2DCC A;  2AUZ A;  4YYQ A;  4YV8 A;  1PBH A;  3BWK A;  3OF9 A;  1KFX L;  2YJ9 A;  3KX1 A;  1QOL A;  2DC6 A;  2JQF R;  3USV A;  3C9E A;  3KWZ A;  2DCB A;  2HH5 A;  2PNS A;  2XU3 A;  1SNK A;  4K7C A;  3F5V A;  4I05 A;  4AXM A;  4FIP A;  4PP1 A;  3MOR A;  3WXG A;  4Q8G A;  3BCN A;  2GFO A;  4I07 A;  1THE A;  1U9Q X;  2DJG B;  1Y08 A;  2AU1 A;  4QRV A;  1U9V A;  2O6X A;  1KXR A;  2DC7 A;  4CZW A;  3DF0 A;  3OF8 A;  1MDW A;  2F1G A;  1ITO A;  1BQI A;  1NB5 A;  3F75 A;  2HHN A;  3HWN A;  4P6G A;  3S3R A;  3OIS A;  1EWO A;  1AU0 A;  3ZUA A;  3OVZ A;  4XUI A;  4QBB A;  1Y4H A;  2C0Y A;  1YAL A;  1CS8 A;  3K8U A;  1ZCM A;  3QJ3 A;  3N3G A;  1AYV A;  1PIP A;  2AIM A;  3MTN A;  1FH0 A;  3K9M A;  1NQC A;  1TL9 A;  4YYW A;  3BC3 A;  1KFU L;  2Y6E A;  3IHP A;  1STF E;  2R9C A;  3RVW A;  4WA6 A;  3H8B A;  1CV8 A;  4YYU A;  2GHU A;  1GEC E;  3PW3 A;  1CTE A;  2E00 A;  3H7D A;  5CVN B;  2E02 A;  1F2B A;  1ATK A;  3WXE A;  3I3T A;  4N8W A;  3OVX A;  2AYO A;  3H8C A;  1PPD A;  2DCD A;  2DCA A;  2IBI A;  2YJB A;  4PP2 E;  5A24 A;  1CB5 A;  3QT4 A;  3IV2 A;  3H89 A;  4X6I A;  1DF0 A;  2NQG A;  4QRG A;  3WXF A;  3TNX A;  2P86 A;  2VHS A;  2NQI A;  3BPF A;  1CJL A;  2FO5 A;  5JH3 A;  4CDC B;  3BOW A;  2DC9 A;  1EF7 A;  1PCI A;  3KKU A;  2AYN A;  3IUT A;  3K24 A;  1NL6 A;  1PXV A;  1IWD A;  3M99 A;  2B1M A;  3IMA A;  4I04 A;  3GCB A;  5JA7 A;  1EWM A;  1MHW A;  1YK8 A;  2PRE A;  2CB5 A;  2WBF X;  4YYS A;  4PAD A;  3V6E A;  1U9X A;  1MIR A;  1EWP A;  1AU3 A;  1KHQ A;  2FT2 A;  4MZS A;  3O0U A;  4W5B A;  4KLB A;  2PBH A;  4BS5 A;  1F2C A;  1ME4 A; 
#chains in the Genus database with same CATH topology
 1M6D A;  1NB3 A;  4XR7 A;  2ARY A;  2OP3 A;  1ME3 A;  2FRA A;  2YJ2 A;  1NPZ A;  5PAD A;  3PBH A;  4BSQ A;  2IPP B;  9PAP A;  1MS6 A;  2R9M A;  3QSD A;  4WUR A;  1AEC A;  1AU4 A;  1U5I A;  3CBK A;  4G54 A;  2H7J A;  2G6D A;  2R9N A;  3BPM A;  4BOQ A;  5J94 A;  2BTW A;  1HUC B;  2Y5B A;  2XU4 A;  1GCB A;  2R9F A;  2B1N A;  2BDL A;  2AUX A;  4BOS A;  2YJ8 A;  2F7D A;  3BBA A;  3AI8 A;  7PCK A;  4A5U A;  4OEL A;  3KSE A;  3MTV A;  4RY2 A;  4D8E A;  3PHU A;  1NLJ A;  2FRQ A;  1CSB B;  1QMY A;  3KWB X;  2DZZ A;  1MEM A;  2P7U A;  3D6S A;  3H6S A;  4P6E A;  2R6N A;  3KFQ A;  5EF4 A;  4YYV A;  1CQD A;  2FTD A;  3TRK A;  2YJC A;  8PCH A;  4N79 A;  2BU3 A;  4BOZ A;  4PI3 A;  4MSX A;  1XKG A;  1U9W A;  3RVV A;  1QXP A;  3O1G A;  5EZQ A;  1AYW A;  2G7Y A;  2ATO A;  1ZIV A;  5KO3 A;  4X6H A;  2CIO A;  1CPJ A;  3IOQ A;  2FUD A;  1X9Y A;  2JTC A;  1PPO A;  4DMX A;  1TLO A;  2NQA A;  3N4C A;  2JQG R;  4N4Z A;  3IEJ A;  2FE8 A;  4R3D A;  3W31 A;  1BGO A;  1GMY A;  3CH3 X;  2E03 A;  2ACT A;  2PAD A;  3MHH A;  2VHF A;  2XU5 A;  1PPN A;  2E01 A;  1K3B B;  3IFU A;  1F2A A;  1Q6K A;  3P5V A;  3W30 A;  5CVO B;  4CDD B;  2DC8 A;  5FPW A;  1PPP A;  5CVM A;  3RVX A;  4BPV A;  3ERV A;  1PE6 A;  1POP A;  1AIM A;  4QH6 A;  1JQP A;  2AS8 A;  3E9S A;  3P5W A;  1O0E A;  3PNR A;  1GLO A;  2BDZ A;  5EGW A;  4CDE B;  2J7Q C;  4BOU A;  3S3Q A;  4Q8H A;  2DOS A;  3CH2 X;  4X6J A;  2NQD B;  1S4V A;  4BQV A;  4HWY A;  4AXL A;  5CHV A;  2FYE A;  3LXS A;  4QRX A;  1BY8 A;  3P5U A;  5F02 A;  3N3K A;  2R9O A;  4W4U A;  3P5X A;  3E1Z B;  3PRP A;  1ICF A;  1VJV A;  2HD5 A;  4CDF B;  4RF1 A;  3B79 A;  3PDF A;  2OZ2 A;  5CHT A;  1TU6 A;  4REZ A;  1CVZ A;  3KW9 A;  6PAD A;  3I06 A;  3HHI A;  4ZUX U;  1YK7 A;  5JZE A;  1DEU A;  3TMP A;  3HD3 A;  4W5C A;  1KHP A;  4OEM A;  3C0R A;  2OUL A;  1AYU A;  3NHE A;  3HHA A;  4YVA A;  4BOP A;  2G8J A;  2G8E A;  3U8E A;  5K16 A;  1MEG A;  4RNA A;  4MZO A;  4BS6 A;  1YVB A;  4FK5 A;  4IUM A;  1PAD A;  3LFY A;  3V6C A;  2DJF B;  2FQ9 A;  1BP4 A;  4PT5 A;  2AVW A;  2P0R A;  1AU2 A;  1SP4 B;  2HXZ A;  1A6R A;  2XU1 A;  1VSN A;  1F29 A;  4M0W A;  3MHS A;  1YT7 A;  3ZNH A;  3PHW A;  3CBJ A;  4HXD B;  4DMY A;  1EWL A;  3PHX A;  4FJC A;  1QDQ A;  2DZY A;  4YYR A;  4MI7 A;  2DCC A;  2AUZ A;  4YYQ A;  2AGA A;  4YV8 A;  1PBH A;  3BWK A;  3OF9 A;  1KFX L;  2YJ9 A;  3KX1 A;  1QOL A;  2DC6 A;  2JQF R;  3USV A;  3C9E A;  3KWZ A;  2DCB A;  2HH5 A;  2PNS A;  2XU3 A;  4MM3 B;  1SNK A;  4K7C A;  1DKI A;  3F5V A;  4ZTB A;  4I05 A;  4OVZ B;  4AXM A;  4FIP A;  4PP1 A;  3MOR A;  3WXG A;  4Q8G A;  3BCN A;  2GFO A;  4I07 A;  1THE A;  1U9Q X;  1UKF A;  2DJG B;  4D8I A;  1Y08 A;  2AU1 A;  4QRV A;  1U9V A;  2O6X A;  1YZB A;  1KXR A;  2DC7 A;  4CZW A;  3DF0 A;  3OF8 A;  1MDW A;  2UZJ A;  2F1G A;  1ITO A;  1BQI A;  1NB5 A;  3F75 A;  3RNV A;  2HHN A;  2JRI A;  3HWN A;  4P6G A;  3S3R A;  3OIS A;  1EWO A;  1AU0 A;  3ZUA A;  4XZX A;  3OVZ A;  4XUI A;  4QBB A;  1Y4H A;  2C0Y A;  1YAL A;  4OVZ A;  1CS8 A;  3MJ5 A;  3K8U A;  1ZCM A;  3QJ3 A;  3N3G A;  1AYV A;  3BY4 A;  1PIP A;  2AIM A;  4RF0 A;  3MTN A;  1FH0 A;  3K9M A;  1NQC A;  1TL9 A;  4YYW A;  3BC3 A;  1KFU L;  2Y6E A;  3IHP A;  1STF E;  2R9C A;  3RVW A;  4WA6 A;  3H8B A;  1CV8 A;  4YYU A;  3PSE A;  2GHU A;  1GEC E;  3PW3 A;  3B21 A;  1CTE A;  3OQC A;  2E00 A;  3H7D A;  5CVN B;  2E02 A;  1F2B A;  1ATK A;  3WXE A;  3I3T A;  4N8W A;  3OVX A;  2AYO A;  3H8C A;  1PPD A;  2DCD A;  2DCA A;  2IBI A;  2YJB A;  4PP2 E;  5A24 A;  1CB5 A;  3QT4 A;  3IV2 A;  3H89 A;  3BB7 A;  4X6I A;  1DF0 A;  2NQG A;  4IP3 A;  4QRG A;  4RKX A;  3WXF A;  3TNX A;  2P86 A;  2VHS A;  3MP2 A;  2NQI A;  3BPF A;  4D8B A;  1CJL A;  2FO5 A;  5JH3 A;  3PRM A;  4CDC B;  3BOW A;  2DC9 A;  1EF7 A;  1PCI A;  3KKU A;  2AYN A;  3IUT A;  3K24 A;  4GUA A;  1NL6 A;  1PXV A;  1IWD A;  3M99 A;  2B1M A;  3IMA A;  4I04 A;  3GCB A;  3PT2 A;  5JA7 A;  1EWM A;  1MHW A;  2BTW B;  1YK8 A;  2PRE A;  2CB5 A;  2WBF X;  4YYS A;  2HWK A;  4PAD A;  3V6E A;  1U9X A;  1MIR A;  1EWP A;  3O65 A;  1AU3 A;  1KHQ A;  5E6J A;  2FT2 A;  4MZS A;  3O0U A;  4W5B A;  4KLB A;  2J7Q A;  2PBH A;  1PVJ A;  4P16 A;  2Z84 A;  4OW0 A;  4BS5 A;  1F2C A;  1ME4 A;  5EZS A; 
#chains in the Genus database with same CATH homology
 1M6D A;  1NB3 A;  4XR7 A;  2ARY A;  2OP3 A;  1ME3 A;  2FRA A;  2YJ2 A;  1NPZ A;  5PAD A;  2BSZ A;  3PBH A;  4NV8 A;  4BSQ A;  2IPP B;  9PAP A;  1MS6 A;  2R9M A;  3QSD A;  1AEC A;  1AU4 A;  1U5I A;  3CBK A;  4G54 A;  2H7J A;  2G6D A;  2R9N A;  3BPM A;  5J94 A;  1HUC B;  2Y5B A;  2XU4 A;  1GCB A;  2R9F A;  2B1N A;  2BDL A;  2AUX A;  2YJ8 A;  2F7D A;  3AI8 A;  7PCK A;  4OEL A;  3KSE A;  4RY2 A;  1NLJ A;  2FRQ A;  1CSB B;  1QMY A;  3KWB X;  2DZZ A;  1MEM A;  1W5R A;  2P7U A;  3D6S A;  3H6S A;  4P6E A;  2R6N A;  3KFQ A;  5EF4 A;  4YYV A;  1CQD A;  2FTD A;  2YJC A;  8PCH A;  4N79 A;  4PI3 A;  4MSX A;  1XKG A;  1U9W A;  3RVV A;  1QXP A;  3O1G A;  4B55 A;  1AYW A;  2G7Y A;  2ATO A;  1ZIV A;  4X6H A;  2CIO A;  1CPJ A;  3IOQ A;  2FUD A;  1X9Y A;  1PPO A;  4DMX A;  1TLO A;  2NQA A;  3N4C A;  2JQG R;  4N4Z A;  3IEJ A;  1BGO A;  1GMY A;  3CH3 X;  2E03 A;  2ACT A;  2PAD A;  3MHH A;  2VHF A;  2XU5 A;  1PPN A;  2E01 A;  1K3B B;  1F2A A;  1Q6K A;  3P5V A;  5CVO B;  4CDD B;  2DC8 A;  5FPW A;  1PPP A;  5CVM A;  3RVX A;  4BPV A;  3ERV A;  1PE6 A;  1POP A;  1AIM A;  4QH6 A;  1JQP A;  2AS8 A;  3P5W A;  1O0E A;  3PNR A;  1GLO A;  2BDZ A;  5EGW A;  4CDE B;  3S3Q A;  4Q8H A;  4X6J A;  3CH2 X;  2NQD B;  1S4V A;  4BQV A;  4HWY A;  4AXL A;  5CHV A;  2FYE A;  3LXS A;  4QRX A;  1BY8 A;  3P5U A;  5F02 A;  3N3K A;  2R9O A;  4W4U A;  3P5X A;  3E1Z B;  1ICF A;  1VJV A;  2HD5 A;  4CDF B;  3B79 A;  3PDF A;  2OZ2 A;  5CHT A;  1TU6 A;  1CVZ A;  3KW9 A;  6PAD A;  3I06 A;  3HHI A;  4ZUX U;  1YK7 A;  1DEU A;  3HD3 A;  4W5C A;  1KHP A;  4OEM A;  2OUL A;  1AYU A;  3NHE A;  3HHA A;  4YVA A;  2G8J A;  2G8E A;  3U8E A;  5K16 A;  1MEG A;  4MZO A;  4BS6 A;  1YVB A;  4FK5 A;  1PAD A;  3LFY A;  3V6C A;  2DJF B;  2FQ9 A;  1BP4 A;  2AVW A;  2P0R A;  1AU2 A;  1SP4 B;  2HXZ A;  1A6R A;  2XU1 A;  1VSN A;  1F29 A;  3MHS A;  1YT7 A;  3CBJ A;  4DMY A;  1EWL A;  4FJC A;  1QDQ A;  2DZY A;  4YYR A;  2DCC A;  2AUZ A;  4YYQ A;  4YV8 A;  1PBH A;  3BWK A;  3OF9 A;  1KFX L;  2YJ9 A;  3KX1 A;  1QOL A;  2DC6 A;  2JQF R;  3USV A;  3C9E A;  3KWZ A;  2DCB A;  2HH5 A;  2PNS A;  2XU3 A;  4NV7 A;  1SNK A;  4K7C A;  2VFB A;  3F5V A;  4I05 A;  4AXM A;  4FIP A;  4PP1 A;  3MOR A;  3WXG A;  4Q8G A;  3BCN A;  2GFO A;  4I07 A;  1THE A;  1U9Q X;  2DJG B;  1Y08 A;  2AU1 A;  4QRV A;  1U9V A;  2O6X A;  1KXR A;  2DC7 A;  4CZW A;  3DF0 A;  3OF8 A;  1MDW A;  2F1G A;  1ITO A;  1BQI A;  1NB5 A;  3F75 A;  2HHN A;  3HWN A;  4P6G A;  3S3R A;  3OIS A;  1EWO A;  1AU0 A;  3ZUA A;  3OVZ A;  4XUI A;  4QBB A;  1Y4H A;  2C0Y A;  1YAL A;  1CS8 A;  4C5P A;  3K8U A;  1ZCM A;  3QJ3 A;  3N3G A;  1AYV A;  1PIP A;  2AIM A;  3MTN A;  1FH0 A;  3K9M A;  1NQC A;  1W4T A;  1TL9 A;  4YYW A;  3BC3 A;  1KFU L;  2Y6E A;  3IHP A;  1STF E;  2R9C A;  3RVW A;  4WA6 A;  1E2T A;  3H8B A;  1CV8 A;  4YYU A;  2VFC A;  2GHU A;  1GEC E;  1W6F A;  3PW3 A;  1CTE A;  2E00 A;  3H7D A;  5CVN B;  2E02 A;  1F2B A;  1ATK A;  3WXE A;  3I3T A;  4N8W A;  3OVX A;  2AYO A;  3H8C A;  1PPD A;  2DCD A;  2DCA A;  2IBI A;  2YJB A;  4PP2 E;  5A24 A;  1CB5 A;  3QT4 A;  3IV2 A;  3H89 A;  4BGF A;  4X6I A;  1DF0 A;  2NQG A;  4GUZ A;  4QRG A;  3WXF A;  3TNX A;  2P86 A;  2VHS A;  2NQI A;  3BPF A;  1CJL A;  2FO5 A;  5JH3 A;  4CDC B;  3BOW A;  2DC9 A;  1EF7 A;  1PCI A;  3KKU A;  2AYN A;  3IUT A;  3K24 A;  1GX3 A;  1NL6 A;  1PXV A;  1IWD A;  3M99 A;  2B1M A;  3IMA A;  4I04 A;  3GCB A;  5JA7 A;  1EWM A;  1MHW A;  1YK8 A;  2PRE A;  2CB5 A;  2WBF X;  4YYS A;  4PAD A;  3V6E A;  1U9X A;  1MIR A;  1EWP A;  1AU3 A;  1KHQ A;  2FT2 A;  4MZS A;  3O0U A;  4W5B A;  4KLB A;  2PBH A;  3LTW A;  4BS5 A;  1F2C A;  3D9W A;  1ME4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...