1QOLA

Structure of the fmdv leader protease
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
173
structure length
166
Chain Sequence
MELTLYNGEKKTFYSRPNNHDNAWLNAILQLFRYVEEPFFDWVYSSPENLTLEAIKQLEDLTGLELHEGGPPALVIWNIKHLLHTGIGTASRPSEVCVVDGTDMCLADFHAGIFLKGQEHAVFACVTSNGWYAIDDEDFYPWTPDPSDVLVFVPYDQKAKVQRKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEASE (NONSTRUCTURAL PROTEIN P20A)
publication title Structure of the Foot-and-Mouth Disease Virus Leader Protease: A Papain-Like Fold Adapted for Self-Processing and Eif4G Recognition.
pubmed doi rcsb
source organism Foot-and-mouth disease virus
total genus 38
structure length 166
sequence length 173
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1qolA00
3WXGA 1PCIA 2XU5A 1K3BB 3KFQA 1STFE 1ME3A 1PPOA 2DJFB 4OELA 4N8WA 2YJCA 3U8EA 4I04A 2BDZA 3CH3X 2AYOA 3S3QA 4X6IA 4CDFB 2AYNA 1YVBA 3N4CA 1PPPA 2G8JA 4PP2E 2HD5A 3AI8A 3ERVA 4YYQA 2DZZA 4CDEB 2ACTA 4CZWA 1AYUA 4X6HA 4AXMA 1PBHA 1JQPA 4K7CA 4RY2A 2P86A 1X9YA 1U9XA 1NPZA 3P5VA 1AECA 2P7UA 3CBJA 3IEJA 2JQFR 7PCKA 1CPJA 3O1GA 2JQGR 2E03A 6PADA 1IWDA 1SP4B 1CJLA 2PBHA 2R9MA 2PNSA 2DC7A 3TNXA 2G7YA 3HD3A 3I06A 2XU1A 1QOLA 5CHVA 2WBFX 4OEMA 4QRXA 1GLOA 5JH3A 4FJCA 2GFOA 4P6EA 4BQVA 5CVOB 4YYRA 4BS5A 3MORA 1KFXL 3N3KA 1TL9A 2YJ8A 1U9VA 2DC9A 4BPVA 1F29A 1MEGA 3O0UA 4X6JA 2VHSA 1ME4A 1TU6A 1AU3A 1XKGA 3OF9A 3F5VA 4FK5A 5PADA 2DCAA 2DC6A 1NL6A 3IOQA 2YJ9A 1KHQA 2F7DA 5K16A 5CVNB 3KW9A 3BPFA 4Q8GA 1DEUA 3E1ZB 2G6DA 3LFYA 3QSDA 4HWYA 3LXSA 4G54A 2PADA 2IPPB 3K8UA 1NB5A 1MHWA 1GMYA 1EWLA 1DF0A 3H89A 1BY8A 3KX1A 1CB5A 2GHUA 2AU1A 4QRVA 2FO5A 2NQIA 1S4VA 2HH5A 2DCCA 1PPDA 1PXVA 3HHIA 4YV8A 4W5BA 3D6SA 4BS6A 2PREA 3P5XA 3N3GA 2HHNA 4YVAA 2AS8A 2AUZA 2DC8A 3CBKA 1NQCA 1PPNA 2P0RA 3PW3A 2AVWA 5CHTA 1GCBA 4QBBA 2DCDA 1AU4A 3NHEA 1SNKA 1AU2A 1ITOA 2Y5BA 4W5CA 4W4UA 4XR7A 1AU0A 3CH2X 2FYEA 2BDLA 4PI3A 1Y08A 3QJ3A 4WA6A 3KWZA 1Y4HA 3S3RA 4PP1A 4I05A 2C0YA 1U9QX 2NQAA 4Q8HA 3MHHA 1EWPA 3USVA 2DZYA 4PADA 3H8BA 5J94A 4YYSA 1YT7A 2R9OA 2YJ2A 2H7JA 4N4ZA 3H7DA 3GCBA 2IBIA 1HUCB 2R9NA 2B1MA 2XU3A 1YALA 3I3TA 2FRAA 1AYWA 4XUIA 3PBHA 3BPMA 1F2CA 2FUDA 1F2BA 1QXPA 2DJGB 1U5IA 1F2AA 3HHAA 2CIOA 3H6SA 3C9EA 4FIPA 1ZIVA 1KHPA 2FTDA 4P6GA 5A24A 3F75A 2O6XA 1MEMA 3PDFA 1CV8A 3H8CA 1POPA 1A6RA 4YYUA 1CQDA 3HWNA 3OVXA 2FQ9A 5EGWA 4MZOA 3RVXA 1QMYA 2R6NA 3WXEA 3KSEA 3IUTA 4YYWA 1ICFA 1QDQA 1AYVA 2VHFA 5EF4A 4DMXA 1NLJA 1TLOA 3QT4A 4YYVA 1U9WA 3DF0A 3KWBX 3BWKA 8PCHA 3V6EA 2YJBA 1BGOA 1MIRA 2B1NA 5F02A 2CB5A 4N79A 3KKUA 3K9MA 2AUXA 1THEA 4CDDB 5JA7A 4AXLA 1NB3A 4I07A 3MHSA 2FRQA 3OF8A 1EWMA 2NQGA 4CDCB 1PE6A 2HXZA 3M99A 1CS8A 3BC3A 4BSQA 2XU4A 1ATKA 1VJVA 4ZUXU 2G8EA 1YK8A 1MDWA 3K24A 3P5UA 3MTNA 4QRGA 2R9FA 2F1GA 3P5WA 1BP4A 1YK7A 3B79A 2R9CA 1CSBB 1M6DA 4DMYA 3PNRA 4KLBA 2OULA 2Y6EA 4MSXA 1VSNA 2ATOA 2OP3A 5CVMA 2E02A 4MZSA 2E01A 4QH6A 3IV2A 1O0EA 3IHPA 3RVWA 1Q6KA 1MS6A 3OVZA 3IMAA 1CVZA 1GECE 9PAPA 2ARYA 1CTEA 2AIMA 3OISA 3BOWA 3RVVA 1AIMA 1ZCMA 1EWOA 1BQIA 1KFUL 2E00A 5FPWA 3BCNA 2DCBA 1FH0A 1PIPA 2NQDB 3V6CA 1PADA 2OZ2A 3WXFA 1KXRA 1EF7A 3ZUAA 2FT2A
chains in the Genus database with same CATH superfamily
5JZEA 3BBAA 3WXGA 1PCIA 2XU5A 1UKFA 1K3BB 3KFQA 1STFE 1ME3A 1PPOA 2DJFB 4OELA 4N8WA 2YJCA 3U8EA 4I04A 2BDZA 3CH3X 2AYOA 3S3QA 4X6IA 4CDFB 2AYNA 1YVBA 3O65A 3N4CA 1PPPA 2G8JA 4PP2E 2HD5A 3AI8A 3ERVA 3PT2A 4YYQA 2DZZA 4CDEB 2ACTA 4CZWA 1AYUA 4X6HA 4AXMA 1PBHA 1JQPA 4K7CA 4RY2A 2P86A 1X9YA 1U9XA 1NPZA 3P5VA 1AECA 3PHUA 2P7UA 3CBJA 3IEJA 2JQFR 4A5UA 7PCKA 1CPJA 3O1GA 2JQGR 2E03A 2J7QC 3TMPA 6PADA 1IWDA 1SP4B 1CJLA 2PBHA 2R9MA 2PNSA 2DC7A 3TNXA 2G7YA 3HD3A 3I06A 2XU1A 1QOLA 5CHVA 4PT5A 2WBFX 3OQCA 4OEMA 4QRXA 1GLOA 5JH3A 4FJCA 2GFOA 2UZJA 4P6EA 3RNVA 4BQVA 5CVOB 4YYRA 4BS5A 3MORA 4D8BA 1KFXL 3N3KA 1TL9A 2YJ8A 1U9VA 2DC9A 4BPVA 1F29A 1MEGA 3O0UA 4X6JA 2VHSA 1ME4A 3MJ5A 1TU6A 1AU3A 1XKGA 3OF9A 3F5VA 4FK5A 5PADA 2DCAA 2DC6A 1NL6A 3IOQA 2YJ9A 1KHQA 2F7DA 5K16A 5CVNB 3KW9A 3BPFA 4Q8GA 1DEUA 3E1ZB 2G6DA 3LFYA 3QSDA 4HWYA 3LXSA 4G54A 2PADA 2IPPB 3K8UA 2HWKA 3PSEA 1NB5A 1MHWA 1GMYA 1EWLA 1DF0A 3H89A 4WURA 1BY8A 3BY4A 3KX1A 5EZSA 2FE8A 1CB5A 2GHUA 2AGAA 2AU1A 2J7QA 3E9SA 4QRVA 2FO5A 2NQIA 1S4VA 2HH5A 2DCCA 1PPDA 1PXVA 3HHIA 4YV8A 4W5BA 3D6SA 4BS6A 2PREA 3P5XA 4RF0A 3N3GA 3PRPA 4M0WA 2HHNA 4YVAA 5E6JA 2AS8A 2AUZA 2DC8A 3CBKA 2Z84A 1NQCA 1PPNA 2P0RA 3PW3A 2AVWA 5CHTA 1GCBA 4QBBA 2DCDA 1AU4A 3NHEA 1SNKA 1AU2A 2DOSA 1ITOA 2Y5BA 4W5CA 4W4UA 4XR7A 2BTWA 1AU0A 3CH2X 2FYEA 2BDLA 4PI3A 1Y08A 3QJ3A 4WA6A 3KWZA 1Y4HA 3S3RA 4PP1A 4I05A 2C0YA 1U9QX 2NQAA 4Q8HA 3MHHA 1EWPA 3USVA 2DZYA 4D8IA 4PADA 3H8BA 3PHWA 5J94A 4XZXA 4YYSA 1YT7A 2R9OA 2YJ2A 3W31A 2H7JA 4N4ZA 3H7DA 3GCBA 2IBIA 1HUCB 2R9NA 2B1MA 2XU3A 1YALA 3I3TA 2FRAA 1AYWA 4XUIA 5KO3A 3PBHA 3BPMA 4BOZA 4RNAA 1F2CA 2FUDA 1F2BA 3MP2A 1QXPA 2DJGB 1U5IA 1F2AA 3HHAA 1PVJA 2CIOA 3H6SA 3C9EA 4FIPA 1ZIVA 1KHPA 4BOPA 2FTDA 4P6GA 5A24A 4REZA 3F75A 2O6XA 1MEMA 3ZNHA 3PDFA 1CV8A 2BTWB 3H8CA 1POPA 1A6RA 4YYUA 1CQDA 3HWNA 3OVXA 2FQ9A 4BOUA 5EGWA 4MZOA 4ZTBA 3RVXA 1QMYA 2R6NA 4RF1A 3WXEA 3KSEA 3IUTA 4YYWA 2JRIA 3PHXA 1ICFA 1QDQA 1AYVA 2VHFA 5EF4A 4DMXA 1NLJA 1TLOA 3QT4A 4YYVA 3TRKA 1U9WA 3DF0A 4BOQA 2BU3A 3KWBX 3BWKA 8PCHA 3V6EA 2YJBA 1BGOA 1MIRA 2B1NA 3IFUA 2CB5A 5F02A 4N79A 3KKUA 3K9MA 3W30A 1YZBA 2AUXA 1THEA 4MM3B 4OVZA 4CDDB 4IUMA 4BOSA 5JA7A 4AXLA 1NB3A 4I07A 3MHSA 2FRQA 3OF8A 1EWMA 2NQGA 4CDCB 1PE6A 2HXZA 3M99A 1CS8A 3PRMA 3BC3A 4BSQA 2XU4A 1ATKA 1VJVA 4ZUXU 2G8EA 1YK8A 4D8EA 3MTVA 1MDWA 3K24A 3P5UA 3MTNA 4QRGA 2R9FA 2F1GA 4GUAA 3P5WA 1BP4A 1YK7A 4MI7A 3B79A 1DKIA 2R9CA 4RKXA 1CSBB 1M6DA 4HXDB 4DMYA 3PNRA 4KLBA 2OULA 2Y6EA 3B21A 3C0RA 4MSXA 1VSNA 2ATOA 2OP3A 5CVMA 4P16A 2E02A 4MZSA 2E01A 4QH6A 3IV2A 1O0EA 3IHPA 3RVWA 1Q6KA 4R3DA 1MS6A 3OVZA 3IMAA 1CVZA 1GECE 9PAPA 2ARYA 1CTEA 2AIMA 4OVZB 3OISA 3BOWA 3RVVA 1AIMA 2JTCA 4IP3A 1ZCMA 4OW0A 1EWOA 1BQIA 5EZQA 1KFUL 2E00A 5FPWA 3BCNA 2DCBA 1FH0A 1PIPA 2NQDB 3V6CA 1PADA 2OZ2A 3BB7A 3WXFA 1KXRA 1EF7A 3ZUAA 2FT2A
chains in the Genus database with same CATH topology
3WXGA 1PCIA 2XU5A 1K3BB 3KFQA 1STFE 1ME3A 1PPOA 2DJFB 4OELA 4N8WA 2YJCA 3U8EA 4I04A 2BDZA 3CH3X 2AYOA 3S3QA 4X6IA 4CDFB 2AYNA 1YVBA 3N4CA 1PPPA 2G8JA 4PP2E 2HD5A 3AI8A 3ERVA 4YYQA 2DZZA 4CDEB 2ACTA 2BSZA 4CZWA 1AYUA 4X6HA 4AXMA 1PBHA 1JQPA 4K7CA 4RY2A 2P86A 4C5PA 1X9YA 4NV8A 1U9XA 1NPZA 3P5VA 1AECA 2P7UA 3CBJA 3IEJA 2JQFR 7PCKA 1CPJA 3O1GA 2JQGR 2E03A 6PADA 1IWDA 1SP4B 1CJLA 2PBHA 2R9MA 2PNSA 1W4TA 2DC7A 3TNXA 2G7YA 3HD3A 3I06A 2XU1A 1QOLA 5CHVA 2WBFX 4OEMA 4QRXA 1GLOA 5JH3A 4FJCA 2GFOA 4P6EA 4BQVA 5CVOB 4YYRA 4BS5A 3MORA 3LTWA 1KFXL 3N3KA 1TL9A 2YJ8A 1U9VA 2DC9A 4BPVA 1F29A 1MEGA 3O0UA 4X6JA 2VHSA 1ME4A 1TU6A 1AU3A 1XKGA 3OF9A 3F5VA 4FK5A 5PADA 2DCAA 2DC6A 1NL6A 3IOQA 2YJ9A 1KHQA 2F7DA 5K16A 5CVNB 3KW9A 3BPFA 4Q8GA 3D9WA 1DEUA 3E1ZB 2G6DA 3LFYA 3QSDA 4HWYA 3LXSA 4G54A 2PADA 2IPPB 3K8UA 1NB5A 1MHWA 1GMYA 1EWLA 1DF0A 3H89A 1BY8A 3KX1A 1CB5A 2GHUA 2AU1A 2VFCA 4QRVA 2FO5A 2NQIA 1S4VA 1W6FA 2HH5A 2DCCA 1PPDA 1PXVA 3HHIA 4YV8A 4W5BA 3D6SA 4BS6A 2PREA 3P5XA 1W5RA 3N3GA 2HHNA 4YVAA 2AS8A 2AUZA 2DC8A 3CBKA 1NQCA 1PPNA 2P0RA 3PW3A 2AVWA 5CHTA 1GCBA 4QBBA 2DCDA 1AU4A 3NHEA 1SNKA 1AU2A 1ITOA 2Y5BA 4W5CA 4W4UA 4XR7A 1AU0A 3CH2X 2FYEA 2BDLA 4PI3A 1Y08A 3QJ3A 4WA6A 3KWZA 1Y4HA 3S3RA 4PP1A 4I05A 2C0YA 1U9QX 2NQAA 4Q8HA 3MHHA 1EWPA 3USVA 2DZYA 4PADA 3H8BA 5J94A 4YYSA 1YT7A 2R9OA 2YJ2A 2H7JA 4N4ZA 3H7DA 3GCBA 2IBIA 1HUCB 2R9NA 2B1MA 2XU3A 1YALA 3I3TA 2FRAA 4NV7A 4BGFA 1AYWA 4GUZA 4XUIA 3PBHA 3BPMA 1F2CA 2FUDA 1F2BA 1QXPA 2DJGB 1U5IA 1F2AA 3HHAA 2CIOA 3H6SA 3C9EA 4FIPA 1ZIVA 1KHPA 2FTDA 4P6GA 5A24A 3F75A 2O6XA 1MEMA 3PDFA 1CV8A 3H8CA 1POPA 1A6RA 4YYUA 1CQDA 3HWNA 3OVXA 2FQ9A 5EGWA 4MZOA 3RVXA 1QMYA 2R6NA 3WXEA 3KSEA 3IUTA 4YYWA 1ICFA 1QDQA 1AYVA 2VHFA 5EF4A 4DMXA 1NLJA 1TLOA 3QT4A 4YYVA 1U9WA 3DF0A 3KWBX 3BWKA 8PCHA 3V6EA 2YJBA 1BGOA 1MIRA 2B1NA 5F02A 2CB5A 4N79A 3KKUA 3K9MA 2AUXA 1THEA 4CDDB 5JA7A 4AXLA 1NB3A 4I07A 3MHSA 2FRQA 3OF8A 1EWMA 2NQGA 4CDCB 1PE6A 2HXZA 3M99A 1CS8A 3BC3A 4BSQA 2XU4A 1ATKA 1VJVA 1GX3A 4ZUXU 2G8EA 1YK8A 1MDWA 3K24A 4B55A 3P5UA 3MTNA 4QRGA 2R9FA 2F1GA 3P5WA 1BP4A 1YK7A 3B79A 2R9CA 1CSBB 1M6DA 4DMYA 3PNRA 4KLBA 2OULA 2Y6EA 4MSXA 1VSNA 2ATOA 2OP3A 5CVMA 2E02A 4MZSA 2E01A 1E2TA 4QH6A 3IV2A 1O0EA 3IHPA 3RVWA 1Q6KA 1MS6A 3OVZA 3IMAA 1CVZA 1GECE 9PAPA 2ARYA 1CTEA 2AIMA 3OISA 3BOWA 3RVVA 1AIMA 2VFBA 1ZCMA 1EWOA 1BQIA 1KFUL 2E00A 5FPWA 3BCNA 2DCBA 1FH0A 1PIPA 2NQDB 3V6CA 1PADA 2OZ2A 3WXFA 1KXRA 1EF7A 3ZUAA 2FT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WXG A;  1PCI A;  2XU5 A;  1K3B B;  3KFQ A;  1STF E;  1ME3 A;  1PPO A;  2DJF B;  4OEL A;  4N8W A;  2YJC A;  3U8E A;  4I04 A;  2BDZ A;  3CH3 X;  2AYO A;  3S3Q A;  4X6I A;  4CDF B;  2AYN A;  1YVB A;  3N4C A;  1PPP A;  2G8J A;  4PP2 E;  2HD5 A;  3AI8 A;  3ERV A;  4YYQ A;  2DZZ A;  4CDE B;  2ACT A;  4CZW A;  1AYU A;  4X6H A;  4AXM A;  1PBH A;  1JQP A;  4K7C A;  4RY2 A;  2P86 A;  1X9Y A;  1U9X A;  1NPZ A;  3P5V A;  1AEC A;  2P7U A;  3CBJ A;  3IEJ A;  2JQF R;  7PCK A;  1CPJ A;  3O1G A;  2JQG R;  2E03 A;  6PAD A;  1IWD A;  1SP4 B;  1CJL A;  2PBH A;  2R9M A;  2PNS A;  2DC7 A;  3TNX A;  2G7Y A;  3HD3 A;  3I06 A;  2XU1 A;  1QOL A;  5CHV A;  2WBF X;  4OEM A;  4QRX A;  1GLO A;  5JH3 A;  4FJC A;  2GFO A;  4P6E A;  4BQV A;  5CVO B;  4YYR A;  4BS5 A;  3MOR A;  1KFX L;  3N3K A;  1TL9 A;  2YJ8 A;  1U9V A;  2DC9 A;  4BPV A;  1F29 A;  1MEG A;  3O0U A;  4X6J A;  2VHS A;  1ME4 A;  1TU6 A;  1AU3 A;  1XKG A;  3OF9 A;  3F5V A;  4FK5 A;  5PAD A;  2DCA A;  2DC6 A;  1NL6 A;  3IOQ A;  2YJ9 A;  1KHQ A;  2F7D A;  5K16 A;  5CVN B;  3KW9 A;  3BPF A;  4Q8G A;  1DEU A;  3E1Z B;  2G6D A;  3LFY A;  3QSD A;  4HWY A;  3LXS A;  4G54 A;  2PAD A;  2IPP B;  3K8U A;  1NB5 A;  1MHW A;  1GMY A;  1EWL A;  1DF0 A;  3H89 A;  1BY8 A;  3KX1 A;  1CB5 A;  2GHU A;  2AU1 A;  4QRV A;  2FO5 A;  2NQI A;  1S4V A;  2HH5 A;  2DCC A;  1PPD A;  1PXV A;  3HHI A;  4YV8 A;  4W5B A;  3D6S A;  4BS6 A;  2PRE A;  3P5X A;  3N3G A;  2HHN A;  4YVA A;  2AS8 A;  2AUZ A;  2DC8 A;  3CBK A;  1NQC A;  1PPN A;  2P0R A;  3PW3 A;  2AVW A;  5CHT A;  1GCB A;  4QBB A;  2DCD A;  1AU4 A;  3NHE A;  1SNK A;  1AU2 A;  1ITO A;  2Y5B A;  4W5C A;  4W4U A;  4XR7 A;  1AU0 A;  3CH2 X;  2FYE A;  2BDL A;  4PI3 A;  1Y08 A;  3QJ3 A;  4WA6 A;  3KWZ A;  1Y4H A;  3S3R A;  4PP1 A;  4I05 A;  2C0Y A;  1U9Q X;  2NQA A;  4Q8H A;  3MHH A;  1EWP A;  3USV A;  2DZY A;  4PAD A;  3H8B A;  5J94 A;  4YYS A;  1YT7 A;  2R9O A;  2YJ2 A;  2H7J A;  4N4Z A;  3H7D A;  3GCB A;  2IBI A;  1HUC B;  2R9N A;  2B1M A;  2XU3 A;  1YAL A;  3I3T A;  2FRA A;  1AYW A;  4XUI A;  3PBH A;  3BPM A;  1F2C A;  2FUD A;  1F2B A;  1QXP A;  2DJG B;  1U5I A;  1F2A A;  3HHA A;  2CIO A;  3H6S A;  3C9E A;  4FIP A;  1ZIV A;  1KHP A;  2FTD A;  4P6G A;  5A24 A;  3F75 A;  2O6X A;  1MEM A;  3PDF A;  1CV8 A;  3H8C A;  1POP A;  1A6R A;  4YYU A;  1CQD A;  3HWN A;  3OVX A;  2FQ9 A;  5EGW A;  4MZO A;  3RVX A;  1QMY A;  2R6N A;  3WXE A;  3KSE A;  3IUT A;  4YYW A;  1ICF A;  1QDQ A;  1AYV A;  2VHF A;  5EF4 A;  4DMX A;  1NLJ A;  1TLO A;  3QT4 A;  4YYV A;  1U9W A;  3DF0 A;  3KWB X;  3BWK A;  8PCH A;  3V6E A;  2YJB A;  1BGO A;  1MIR A;  2B1N A;  5F02 A;  2CB5 A;  4N79 A;  3KKU A;  3K9M A;  2AUX A;  1THE A;  4CDD B;  5JA7 A;  4AXL A;  1NB3 A;  4I07 A;  3MHS A;  2FRQ A;  3OF8 A;  1EWM A;  2NQG A;  4CDC B;  1PE6 A;  2HXZ A;  3M99 A;  1CS8 A;  3BC3 A;  4BSQ A;  2XU4 A;  1ATK A;  1VJV A;  4ZUX U;  2G8E A;  1YK8 A;  1MDW A;  3K24 A;  3P5U A;  3MTN A;  4QRG A;  2R9F A;  2F1G A;  3P5W A;  1BP4 A;  1YK7 A;  3B79 A;  2R9C A;  1CSB B;  1M6D A;  4DMY A;  3PNR A;  4KLB A;  2OUL A;  2Y6E A;  4MSX A;  1VSN A;  2ATO A;  2OP3 A;  5CVM A;  2E02 A;  4MZS A;  2E01 A;  4QH6 A;  3IV2 A;  1O0E A;  3IHP A;  3RVW A;  1Q6K A;  1MS6 A;  3OVZ A;  3IMA A;  1CVZ A;  1GEC E;  9PAP A;  2ARY A;  1CTE A;  2AIM A;  3OIS A;  3BOW A;  3RVV A;  1AIM A;  1ZCM A;  1EWO A;  1BQI A;  1KFU L;  2E00 A;  5FPW A;  3BCN A;  2DCB A;  1FH0 A;  1PIP A;  2NQD B;  3V6C A;  1PAD A;  2OZ2 A;  3WXF A;  1KXR A;  1EF7 A;  3ZUA A;  2FT2 A; 
#chains in the Genus database with same CATH topology
 5JZE A;  3BBA A;  3WXG A;  1PCI A;  2XU5 A;  1UKF A;  1K3B B;  3KFQ A;  1STF E;  1ME3 A;  1PPO A;  2DJF B;  4OEL A;  4N8W A;  2YJC A;  3U8E A;  4I04 A;  2BDZ A;  3CH3 X;  2AYO A;  3S3Q A;  4X6I A;  4CDF B;  2AYN A;  1YVB A;  3O65 A;  3N4C A;  1PPP A;  2G8J A;  4PP2 E;  2HD5 A;  3AI8 A;  3ERV A;  3PT2 A;  4YYQ A;  2DZZ A;  4CDE B;  2ACT A;  4CZW A;  1AYU A;  4X6H A;  4AXM A;  1PBH A;  1JQP A;  4K7C A;  4RY2 A;  2P86 A;  1X9Y A;  1U9X A;  1NPZ A;  3P5V A;  1AEC A;  3PHU A;  2P7U A;  3CBJ A;  3IEJ A;  2JQF R;  4A5U A;  7PCK A;  1CPJ A;  3O1G A;  2JQG R;  2E03 A;  2J7Q C;  3TMP A;  6PAD A;  1IWD A;  1SP4 B;  1CJL A;  2PBH A;  2R9M A;  2PNS A;  2DC7 A;  3TNX A;  2G7Y A;  3HD3 A;  3I06 A;  2XU1 A;  1QOL A;  5CHV A;  4PT5 A;  2WBF X;  3OQC A;  4OEM A;  4QRX A;  1GLO A;  5JH3 A;  4FJC A;  2GFO A;  2UZJ A;  4P6E A;  3RNV A;  4BQV A;  5CVO B;  4YYR A;  4BS5 A;  3MOR A;  4D8B A;  1KFX L;  3N3K A;  1TL9 A;  2YJ8 A;  1U9V A;  2DC9 A;  4BPV A;  1F29 A;  1MEG A;  3O0U A;  4X6J A;  2VHS A;  1ME4 A;  3MJ5 A;  1TU6 A;  1AU3 A;  1XKG A;  3OF9 A;  3F5V A;  4FK5 A;  5PAD A;  2DCA A;  2DC6 A;  1NL6 A;  3IOQ A;  2YJ9 A;  1KHQ A;  2F7D A;  5K16 A;  5CVN B;  3KW9 A;  3BPF A;  4Q8G A;  1DEU A;  3E1Z B;  2G6D A;  3LFY A;  3QSD A;  4HWY A;  3LXS A;  4G54 A;  2PAD A;  2IPP B;  3K8U A;  2HWK A;  3PSE A;  1NB5 A;  1MHW A;  1GMY A;  1EWL A;  1DF0 A;  3H89 A;  4WUR A;  1BY8 A;  3BY4 A;  3KX1 A;  5EZS A;  2FE8 A;  1CB5 A;  2GHU A;  2AGA A;  2AU1 A;  2J7Q A;  3E9S A;  4QRV A;  2FO5 A;  2NQI A;  1S4V A;  2HH5 A;  2DCC A;  1PPD A;  1PXV A;  3HHI A;  4YV8 A;  4W5B A;  3D6S A;  4BS6 A;  2PRE A;  3P5X A;  4RF0 A;  3N3G A;  3PRP A;  4M0W A;  2HHN A;  4YVA A;  5E6J A;  2AS8 A;  2AUZ A;  2DC8 A;  3CBK A;  2Z84 A;  1NQC A;  1PPN A;  2P0R A;  3PW3 A;  2AVW A;  5CHT A;  1GCB A;  4QBB A;  2DCD A;  1AU4 A;  3NHE A;  1SNK A;  1AU2 A;  2DOS A;  1ITO A;  2Y5B A;  4W5C A;  4W4U A;  4XR7 A;  2BTW A;  1AU0 A;  3CH2 X;  2FYE A;  2BDL A;  4PI3 A;  1Y08 A;  3QJ3 A;  4WA6 A;  3KWZ A;  1Y4H A;  3S3R A;  4PP1 A;  4I05 A;  2C0Y A;  1U9Q X;  2NQA A;  4Q8H A;  3MHH A;  1EWP A;  3USV A;  2DZY A;  4D8I A;  4PAD A;  3H8B A;  3PHW A;  5J94 A;  4XZX A;  4YYS A;  1YT7 A;  2R9O A;  2YJ2 A;  3W31 A;  2H7J A;  4N4Z A;  3H7D A;  3GCB A;  2IBI A;  1HUC B;  2R9N A;  2B1M A;  2XU3 A;  1YAL A;  3I3T A;  2FRA A;  1AYW A;  4XUI A;  5KO3 A;  3PBH A;  3BPM A;  4BOZ A;  4RNA A;  1F2C A;  2FUD A;  1F2B A;  3MP2 A;  1QXP A;  2DJG B;  1U5I A;  1F2A A;  3HHA A;  1PVJ A;  2CIO A;  3H6S A;  3C9E A;  4FIP A;  1ZIV A;  1KHP A;  4BOP A;  2FTD A;  4P6G A;  5A24 A;  4REZ A;  3F75 A;  2O6X A;  1MEM A;  3ZNH A;  3PDF A;  1CV8 A;  2BTW B;  3H8C A;  1POP A;  1A6R A;  4YYU A;  1CQD A;  3HWN A;  3OVX A;  2FQ9 A;  4BOU A;  5EGW A;  4MZO A;  4ZTB A;  3RVX A;  1QMY A;  2R6N A;  4RF1 A;  3WXE A;  3KSE A;  3IUT A;  4YYW A;  2JRI A;  3PHX A;  1ICF A;  1QDQ A;  1AYV A;  2VHF A;  5EF4 A;  4DMX A;  1NLJ A;  1TLO A;  3QT4 A;  4YYV A;  3TRK A;  1U9W A;  3DF0 A;  4BOQ A;  2BU3 A;  3KWB X;  3BWK A;  8PCH A;  3V6E A;  2YJB A;  1BGO A;  1MIR A;  2B1N A;  3IFU A;  2CB5 A;  5F02 A;  4N79 A;  3KKU A;  3K9M A;  3W30 A;  1YZB A;  2AUX A;  1THE A;  4MM3 B;  4OVZ A;  4CDD B;  4IUM A;  4BOS A;  5JA7 A;  4AXL A;  1NB3 A;  4I07 A;  3MHS A;  2FRQ A;  3OF8 A;  1EWM A;  2NQG A;  4CDC B;  1PE6 A;  2HXZ A;  3M99 A;  1CS8 A;  3PRM A;  3BC3 A;  4BSQ A;  2XU4 A;  1ATK A;  1VJV A;  4ZUX U;  2G8E A;  1YK8 A;  4D8E A;  3MTV A;  1MDW A;  3K24 A;  3P5U A;  3MTN A;  4QRG A;  2R9F A;  2F1G A;  4GUA A;  3P5W A;  1BP4 A;  1YK7 A;  4MI7 A;  3B79 A;  1DKI A;  2R9C A;  4RKX A;  1CSB B;  1M6D A;  4HXD B;  4DMY A;  3PNR A;  4KLB A;  2OUL A;  2Y6E A;  3B21 A;  3C0R A;  4MSX A;  1VSN A;  2ATO A;  2OP3 A;  5CVM A;  4P16 A;  2E02 A;  4MZS A;  2E01 A;  4QH6 A;  3IV2 A;  1O0E A;  3IHP A;  3RVW A;  1Q6K A;  4R3D A;  1MS6 A;  3OVZ A;  3IMA A;  1CVZ A;  1GEC E;  9PAP A;  2ARY A;  1CTE A;  2AIM A;  4OVZ B;  3OIS A;  3BOW A;  3RVV A;  1AIM A;  2JTC A;  4IP3 A;  1ZCM A;  4OW0 A;  1EWO A;  1BQI A;  5EZQ A;  1KFU L;  2E00 A;  5FPW A;  3BCN A;  2DCB A;  1FH0 A;  1PIP A;  2NQD B;  3V6C A;  1PAD A;  2OZ2 A;  3BB7 A;  3WXF A;  1KXR A;  1EF7 A;  3ZUA A;  2FT2 A; 
#chains in the Genus database with same CATH homology
 3WXG A;  1PCI A;  2XU5 A;  1K3B B;  3KFQ A;  1STF E;  1ME3 A;  1PPO A;  2DJF B;  4OEL A;  4N8W A;  2YJC A;  3U8E A;  4I04 A;  2BDZ A;  3CH3 X;  2AYO A;  3S3Q A;  4X6I A;  4CDF B;  2AYN A;  1YVB A;  3N4C A;  1PPP A;  2G8J A;  4PP2 E;  2HD5 A;  3AI8 A;  3ERV A;  4YYQ A;  2DZZ A;  4CDE B;  2ACT A;  2BSZ A;  4CZW A;  1AYU A;  4X6H A;  4AXM A;  1PBH A;  1JQP A;  4K7C A;  4RY2 A;  2P86 A;  4C5P A;  1X9Y A;  4NV8 A;  1U9X A;  1NPZ A;  3P5V A;  1AEC A;  2P7U A;  3CBJ A;  3IEJ A;  2JQF R;  7PCK A;  1CPJ A;  3O1G A;  2JQG R;  2E03 A;  6PAD A;  1IWD A;  1SP4 B;  1CJL A;  2PBH A;  2R9M A;  2PNS A;  1W4T A;  2DC7 A;  3TNX A;  2G7Y A;  3HD3 A;  3I06 A;  2XU1 A;  1QOL A;  5CHV A;  2WBF X;  4OEM A;  4QRX A;  1GLO A;  5JH3 A;  4FJC A;  2GFO A;  4P6E A;  4BQV A;  5CVO B;  4YYR A;  4BS5 A;  3MOR A;  3LTW A;  1KFX L;  3N3K A;  1TL9 A;  2YJ8 A;  1U9V A;  2DC9 A;  4BPV A;  1F29 A;  1MEG A;  3O0U A;  4X6J A;  2VHS A;  1ME4 A;  1TU6 A;  1AU3 A;  1XKG A;  3OF9 A;  3F5V A;  4FK5 A;  5PAD A;  2DCA A;  2DC6 A;  1NL6 A;  3IOQ A;  2YJ9 A;  1KHQ A;  2F7D A;  5K16 A;  5CVN B;  3KW9 A;  3BPF A;  4Q8G A;  3D9W A;  1DEU A;  3E1Z B;  2G6D A;  3LFY A;  3QSD A;  4HWY A;  3LXS A;  4G54 A;  2PAD A;  2IPP B;  3K8U A;  1NB5 A;  1MHW A;  1GMY A;  1EWL A;  1DF0 A;  3H89 A;  1BY8 A;  3KX1 A;  1CB5 A;  2GHU A;  2AU1 A;  2VFC A;  4QRV A;  2FO5 A;  2NQI A;  1S4V A;  1W6F A;  2HH5 A;  2DCC A;  1PPD A;  1PXV A;  3HHI A;  4YV8 A;  4W5B A;  3D6S A;  4BS6 A;  2PRE A;  3P5X A;  1W5R A;  3N3G A;  2HHN A;  4YVA A;  2AS8 A;  2AUZ A;  2DC8 A;  3CBK A;  1NQC A;  1PPN A;  2P0R A;  3PW3 A;  2AVW A;  5CHT A;  1GCB A;  4QBB A;  2DCD A;  1AU4 A;  3NHE A;  1SNK A;  1AU2 A;  1ITO A;  2Y5B A;  4W5C A;  4W4U A;  4XR7 A;  1AU0 A;  3CH2 X;  2FYE A;  2BDL A;  4PI3 A;  1Y08 A;  3QJ3 A;  4WA6 A;  3KWZ A;  1Y4H A;  3S3R A;  4PP1 A;  4I05 A;  2C0Y A;  1U9Q X;  2NQA A;  4Q8H A;  3MHH A;  1EWP A;  3USV A;  2DZY A;  4PAD A;  3H8B A;  5J94 A;  4YYS A;  1YT7 A;  2R9O A;  2YJ2 A;  2H7J A;  4N4Z A;  3H7D A;  3GCB A;  2IBI A;  1HUC B;  2R9N A;  2B1M A;  2XU3 A;  1YAL A;  3I3T A;  2FRA A;  4NV7 A;  4BGF A;  1AYW A;  4GUZ A;  4XUI A;  3PBH A;  3BPM A;  1F2C A;  2FUD A;  1F2B A;  1QXP A;  2DJG B;  1U5I A;  1F2A A;  3HHA A;  2CIO A;  3H6S A;  3C9E A;  4FIP A;  1ZIV A;  1KHP A;  2FTD A;  4P6G A;  5A24 A;  3F75 A;  2O6X A;  1MEM A;  3PDF A;  1CV8 A;  3H8C A;  1POP A;  1A6R A;  4YYU A;  1CQD A;  3HWN A;  3OVX A;  2FQ9 A;  5EGW A;  4MZO A;  3RVX A;  1QMY A;  2R6N A;  3WXE A;  3KSE A;  3IUT A;  4YYW A;  1ICF A;  1QDQ A;  1AYV A;  2VHF A;  5EF4 A;  4DMX A;  1NLJ A;  1TLO A;  3QT4 A;  4YYV A;  1U9W A;  3DF0 A;  3KWB X;  3BWK A;  8PCH A;  3V6E A;  2YJB A;  1BGO A;  1MIR A;  2B1N A;  5F02 A;  2CB5 A;  4N79 A;  3KKU A;  3K9M A;  2AUX A;  1THE A;  4CDD B;  5JA7 A;  4AXL A;  1NB3 A;  4I07 A;  3MHS A;  2FRQ A;  3OF8 A;  1EWM A;  2NQG A;  4CDC B;  1PE6 A;  2HXZ A;  3M99 A;  1CS8 A;  3BC3 A;  4BSQ A;  2XU4 A;  1ATK A;  1VJV A;  1GX3 A;  4ZUX U;  2G8E A;  1YK8 A;  1MDW A;  3K24 A;  4B55 A;  3P5U A;  3MTN A;  4QRG A;  2R9F A;  2F1G A;  3P5W A;  1BP4 A;  1YK7 A;  3B79 A;  2R9C A;  1CSB B;  1M6D A;  4DMY A;  3PNR A;  4KLB A;  2OUL A;  2Y6E A;  4MSX A;  1VSN A;  2ATO A;  2OP3 A;  5CVM A;  2E02 A;  4MZS A;  2E01 A;  1E2T A;  4QH6 A;  3IV2 A;  1O0E A;  3IHP A;  3RVW A;  1Q6K A;  1MS6 A;  3OVZ A;  3IMA A;  1CVZ A;  1GEC E;  9PAP A;  2ARY A;  1CTE A;  2AIM A;  3OIS A;  3BOW A;  3RVV A;  1AIM A;  2VFB A;  1ZCM A;  1EWO A;  1BQI A;  1KFU L;  2E00 A;  5FPW A;  3BCN A;  2DCB A;  1FH0 A;  1PIP A;  2NQD B;  3V6C A;  1PAD A;  2OZ2 A;  3WXF A;  1KXR A;  1EF7 A;  3ZUA A;  2FT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...