1QOLA

Structure of the fmdv leader protease
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
173
structure length
166
Chain Sequence
b'MELTLYNGEKKTFYSRPNNHDNAWLNAILQLFRYVEEPFFDWVYSSPENLTLEAIKQLEDLTGLELHEGGPPALVIWNIKHLLHTGIGTASRPSEVCVVDGTDMCLADFHAGIFLKGQEHAVFACVTSNGWYAIDDEDFYPWTPDPSDVLVFVPYDQKAKVQRKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEASE (NONSTRUCTURAL PROTEIN P20A)
publication title Structure of the Foot-and-Mouth Disease Virus Leader Protease: A Papain-Like Fold Adapted for Self-Processing and Eif4G Recognition.
pubmed doi rcsb
source organism Foot-and-mouth disease virus
molecule tags Hydrolase
total genus 38
structure length 166
sequence length 173
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1qolA00
1MIRA 3IEJA 3H89A 4CDFB 1MS6A 2P0RA 2R9FA 2G8EA 2IPPB 3P5WA 1AECA 4YVAA 2DZYA 2YJBA 3DF0A 1CVZA 2G7YA 4CDDB 1GCBA 4Q8GA 2XU4A 3ERVA 3KW9A 1PPNA 2G8JA 1CSBB 3USVA 2ACTA 3S3QA 3U8EA 3QT4A 1KFUL 4MZOA 2FRQA 1CJLA 1A6RA 3OVXA 4AXMA 2FTDA 4QH6A 3NHEA 1ITOA 3IMAA 1BY8A 4OEMA 2DJFB 1PADA 3OF8A 2OP3A 3HD3A 2BDLA 3V6EA 2CB5A 1THEA 3BCNA 2FUDA 1IWDA 4OELA 3PNRA 1TL9A 4BS5A 1PPPA 2GHUA 3LFYA 1YT7A 1PPOA 5K16A 4ZUXU 3QSDA 2FQ9A 4YV8A 3H8CA 3ZUAA 2E02A 4WA6A 3OVZA 1KHQA 4BPVA 3KFQA 1NB5A 4YYRA 3OISA 4DMXA 1S4VA 2AS8A 1SP4B 2DCAA 1EWMA 5CHVA 2AUZA 3OF9A 1AU4A 3QJ3A 9PAPA 1QOLA 2JQFR 2PBHA 2AYNA 1BQIA 2PADA 4XUIA 3I3TA 1AU3A 1F2CA 1EWLA 1EWOA 1ICFA 3AI8A 1GECE 3B79A 3BC3A 1U9QX 3RVWA 2F7DA 2NQAA 2E01A 5A24A 3RVVA 1YVBA 1XKGA 3IUTA 3MORA 1PPDA 3N4CA 1TLOA 5FPWA 2YJ9A 3RVXA 3BPFA 4CZWA 2YJ8A 1VSNA 5CHTA 4YYWA 2ATOA 4PADA 4YYUA 3CBJA 1MEGA 7PCKA 1Q6KA 2GFOA 4MZSA 3S3RA 3F75A 1KHPA 6PADA 2HXZA 4DMYA 1AYUA 4KLBA 1AU2A 3HHIA 1CPJA 1FH0A 2DJGB 1GLOA 4P6EA 1ATKA 4I04A 1AYVA 3KX1A 3IOQA 2BDZA 2CIOA 2O6XA 2C0YA 3BOWA 4XR7A 4FK5A 2Y5BA 2B1MA 1ZIVA 1NQCA 4X6IA 4G54A 3H6SA 2YJCA 1QMYA 1YALA 2PNSA 2Y6EA 3I06A 2E03A 4K7CA 2P86A 4BQVA 1EWPA 4YYVA 2FYEA 1PE6A 3MHHA 1POPA 3KWBX 2G6DA 3E1ZB 1PCIA 3WXFA 2R9MA 1U5IA 4W5BA 1KXRA 4PP1A 2XU5A 2FO5A 3M99A 3K24A 1CV8A 1CTEA 1AYWA 2OULA 3KSEA 2HHNA 2FT2A 3D6SA 5EF4A 1ZCMA 2R6NA 2IBIA 2DCDA 4QRVA 2DC9A 2R9NA 1O0EA 3KKUA 4AXLA 3PW3A 2AU1A 4I05A 1M6DA 1BGOA 2DC8A 8PCHA 2HD5A 3K9MA 2DCBA 2R9OA 1NB3A 5CVOB 3H7DA 2AVWA 2DZZA 1GMYA 3CH2X 3F5VA 1AIMA 1PXVA 1U9XA 1KFXL 1PBHA 1HUCB 1STFE 4FJCA 3WXGA 1QXPA 2P7UA 4BS6A 3P5XA 4QBBA 3HHAA 5EGWA 1CS8A 1CB5A 4N8WA 4RY2A 4W5CA 3WXEA 4P6GA 3N3GA 2AIMA 2DCCA 2YJ2A 3LXSA 1EF7A 2B1NA 5CVNB 2F1GA 1QDQA 1F2BA 2R9CA 2VHFA 2ARYA 3V6CA 5JA7A 2JQGR 1NLJA 1BP4A 1Y4HA 2H7JA 3P5VA 3MTNA 3KWZA 1PIPA 3C9EA 1MHWA 4X6HA 4BSQA 4HWYA 3IV2A 4I07A 1U9VA 4N79A 3PBHA 2HH5A 3MHSA 1CQDA 4Q8HA 3O0UA 2WBFX 3O1GA 2XU1A 1K3BB 3BWKA 4W4UA 4X6JA 1F29A 4FIPA 2NQIA 3IHPA 1YK7A 3PDFA 1NPZA 3H8BA 4YYQA 2AYOA 3CH3X 3K8UA 1ME4A 2DC7A 4N4ZA 3HWNA 1YK8A 2OZ2A 5CVMA 4QRXA 3GCBA 5F02A 1JQPA 2VHSA 1Y08A 1DEUA 1ME3A 1MDWA 4CDEB 4CDCB 5PADA 2E00A 1X9YA 1DF0A 1VJVA 5JH3A 3TNXA 1AU0A 1TU6A 4QRGA 2FRAA 4YYSA 1U9WA 3BPMA 1MEMA 1SNKA 5J94A 2AUXA 2PREA 3P5UA 4PI3A 2XU3A 2DC6A 1F2AA 1NL6A 2NQDB 4PP2E 3CBKA 4MSXA 3N3KA 2NQGA
chains in the Genus database with same CATH superfamily
1MIRA 3IEJA 4D8EA 3H89A 4CDFB 1MS6A 2P0RA 2R9FA 2G8EA 2IPPB 1PVJA 3P5WA 1AECA 4YVAA 2DZYA 2YJBA 3DF0A 1CVZA 2G7YA 4CDDB 1GCBA 4Q8GA 2XU4A 3ERVA 2DOSA 3PHWA 3TRKA 3KW9A 1PPNA 2G8JA 1CSBB 3USVA 2ACTA 3S3QA 3U8EA 3QT4A 1KFUL 4MZOA 2FRQA 1CJLA 1A6RA 3O65A 3MJ5A 3OVXA 4AXMA 2FTDA 3PHUA 4QH6A 3NHEA 2JRIA 1ITOA 3IMAA 1BY8A 4OEMA 2DJFB 1PADA 3OF8A 2OP3A 4IUMA 3HD3A 2BDLA 3V6EA 2CB5A 1THEA 3BCNA 2FUDA 1IWDA 3BBAA 4OELA 2BTWA 3PNRA 1TL9A 4A5UA 4BS5A 1PPPA 2GHUA 3LFYA 1YT7A 1PPOA 5K16A 4ZUXU 3QSDA 2FQ9A 4YV8A 3H8CA 3ZUAA 2E02A 4BOPA 4WA6A 3OVZA 1KHQA 4BPVA 3KFQA 1NB5A 4YYRA 3OISA 4DMXA 1S4VA 2AS8A 1SP4B 4OVZB 2DCAA 1EWMA 5CHVA 2AUZA 3OF9A 1AU4A 3QJ3A 9PAPA 1QOLA 2JQFR 2PBHA 2AYNA 1BQIA 2PADA 4XUIA 3I3TA 1AU3A 1F2CA 1EWLA 1EWOA 1ICFA 3AI8A 1GECE 3B79A 3BC3A 1U9QX 2AGAA 3RVWA 2F7DA 2JTCA 2NQAA 2E01A 5A24A 3RVVA 1YVBA 1XKGA 3IUTA 3MORA 1PPDA 3N4CA 3E9SA 1TLOA 5FPWA 2YJ9A 3RVXA 3BPFA 4CZWA 2YJ8A 4RF1A 1VSNA 5CHTA 2HWKA 4YYWA 4MM3B 2ATOA 5JZEA 4GUAA 4PADA 4ZTBA 4YYUA 3CBJA 1MEGA 7PCKA 1Q6KA 2GFOA 4MZSA 3S3RA 4P16A 3F75A 1KHPA 6PADA 4HXDB 2HXZA 3PT2A 2Z84A 4DMYA 1AYUA 4KLBA 1AU2A 3HHIA 1CPJA 1FH0A 2DJGB 1GLOA 4WURA 4P6EA 1ATKA 4I04A 1AYVA 2FE8A 3KX1A 3IOQA 2BDZA 4BOQA 2CIOA 2O6XA 2C0YA 2J7QC 3BOWA 4XR7A 4FK5A 2Y5BA 2B1MA 1ZIVA 1NQCA 4X6IA 4G54A 4IP3A 3H6SA 2YJCA 1QMYA 1YALA 2PNSA 2Y6EA 3I06A 2E03A 4K7CA 2J7QA 2P86A 4BQVA 1EWPA 4M0WA 3W30A 4YYVA 2FYEA 3PRPA 1PE6A 2BTWB 3RNVA 3MHHA 1POPA 3KWBX 2G6DA 3E1ZB 1PCIA 3WXFA 2R9MA 4RKXA 1U5IA 4W5BA 1KXRA 4PP1A 2XU5A 2FO5A 3M99A 3K24A 1CV8A 1CTEA 1AYWA 2OULA 3KSEA 2HHNA 2FT2A 3D6SA 5EF4A 1ZCMA 2R6NA 4RNAA 2IBIA 1DKIA 2DCDA 4QRVA 2DC9A 2R9NA 1O0EA 3KKUA 4AXLA 3PW3A 2AU1A 4I05A 1M6DA 1BGOA 4BOZA 2DC8A 8PCHA 1UKFA 3PRMA 2UZJA 2HD5A 3K9MA 2DCBA 3ZNHA 4BOSA 4RF0A 4XZXA 2R9OA 1NB3A 5CVOB 3H7DA 2AVWA 2DZZA 1GMYA 3CH2X 3F5VA 1AIMA 4D8BA 1PXVA 1U9XA 1KFXL 1PBHA 1HUCB 1STFE 4FJCA 3WXGA 1QXPA 1YZBA 2P7UA 4BS6A 5EZQA 3P5XA 4QBBA 3HHAA 3BB7A 5EGWA 1CS8A 1CB5A 4N8WA 4RY2A 4W5CA 3PSEA 4OW0A 3WXEA 4P6GA 3N3GA 2AIMA 2DCCA 3MP2A 2YJ2A 3LXSA 4D8IA 1EF7A 2B1NA 3PHXA 5CVNB 2F1GA 3C0RA 1QDQA 1F2BA 2R9CA 2VHFA 2ARYA 3V6CA 5JA7A 2JQGR 1NLJA 1BP4A 1Y4HA 2H7JA 3P5VA 3MTNA 3KWZA 1PIPA 3C9EA 1MHWA 4X6HA 4BSQA 4HWYA 3IV2A 3B21A 4I07A 1U9VA 4N79A 3PBHA 2HH5A 3MHSA 1CQDA 4Q8HA 3O0UA 2WBFX 3BY4A 3O1GA 2XU1A 1K3BB 3BWKA 4W4UA 4X6JA 1F29A 4FIPA 2BU3A 2NQIA 5E6JA 3IHPA 1YK7A 3PDFA 1NPZA 3H8BA 4YYQA 2AYOA 4REZA 3CH3X 4BOUA 4OVZA 3K8UA 4R3DA 1ME4A 5KO3A 2DC7A 4N4ZA 3HWNA 1YK8A 2OZ2A 5CVMA 4QRXA 3GCBA 5F02A 1JQPA 3MTVA 2VHSA 1Y08A 1DEUA 1ME3A 3W31A 1MDWA 4CDEB 4CDCB 5PADA 2E00A 3IFUA 4PT5A 1X9YA 1DF0A 1VJVA 5EZSA 5JH3A 3TNXA 1AU0A 1TU6A 3OQCA 4QRGA 3TMPA 2FRAA 4YYSA 1U9WA 3BPMA 1MEMA 1SNKA 5J94A 2AUXA 2PREA 3P5UA 4PI3A 2XU3A 2DC6A 1F2AA 1NL6A 2NQDB 3CBKA 4PP2E 4MSXA 3N3KA 4MI7A 2NQGA
chains in the Genus database with same CATH topology
1MIRA 3IEJA 3LTWA 3H89A 4CDFB 1MS6A 2P0RA 2R9FA 2G8EA 2IPPB 3P5WA 1AECA 4YVAA 2DZYA 2YJBA 3DF0A 1CVZA 2G7YA 4CDDB 1GCBA 4Q8GA 2XU4A 3ERVA 3KW9A 1PPNA 2G8JA 1CSBB 3USVA 2ACTA 3S3QA 3U8EA 3QT4A 4NV7A 4GUZA 1KFUL 4MZOA 2FRQA 1CJLA 1A6RA 3OVXA 4AXMA 2FTDA 4QH6A 3NHEA 1ITOA 4C5PA 3IMAA 1BY8A 4OEMA 2DJFB 1PADA 3OF8A 2OP3A 3HD3A 2BDLA 3V6EA 2CB5A 1THEA 3BCNA 2FUDA 1IWDA 4OELA 3PNRA 1TL9A 4BS5A 1PPPA 2GHUA 3LFYA 1YT7A 1PPOA 5K16A 4ZUXU 3QSDA 2FQ9A 4YV8A 3H8CA 3ZUAA 2E02A 4WA6A 3OVZA 1KHQA 4BPVA 3KFQA 1NB5A 4YYRA 3OISA 4DMXA 1S4VA 2AS8A 1SP4B 2DCAA 1EWMA 5CHVA 2AUZA 3OF9A 2VFBA 1AU4A 3QJ3A 9PAPA 1QOLA 2JQFR 2PBHA 2AYNA 1BQIA 2PADA 4XUIA 3I3TA 1AU3A 1F2CA 1EWLA 1EWOA 1ICFA 3AI8A 1GECE 3B79A 3BC3A 1U9QX 3RVWA 2F7DA 2NQAA 2E01A 5A24A 1GX3A 3RVVA 1YVBA 1XKGA 3IUTA 3MORA 1PPDA 3N4CA 1TLOA 5FPWA 2YJ9A 3RVXA 3BPFA 4CZWA 2YJ8A 1VSNA 5CHTA 4YYWA 2ATOA 4PADA 4YYUA 3CBJA 1MEGA 7PCKA 1Q6KA 2GFOA 4MZSA 3S3RA 3F75A 1KHPA 6PADA 2HXZA 4DMYA 1AYUA 4KLBA 1AU2A 3HHIA 1CPJA 1FH0A 2DJGB 1GLOA 4P6EA 1ATKA 3D9WA 1AYVA 4I04A 3KX1A 3IOQA 2BDZA 2CIOA 2O6XA 2C0YA 3BOWA 4XR7A 4FK5A 2Y5BA 2B1MA 4BGFA 1ZIVA 1NQCA 4X6IA 4G54A 3H6SA 2YJCA 1QMYA 1YALA 2PNSA 2Y6EA 3I06A 2E03A 4K7CA 2P86A 4BQVA 1EWPA 4YYVA 2FYEA 1PE6A 3MHHA 1POPA 3KWBX 2G6DA 3E1ZB 1PCIA 3WXFA 2R9MA 1U5IA 4W5BA 1KXRA 4PP1A 2XU5A 2FO5A 3M99A 3K24A 1CV8A 1CTEA 1AYWA 2OULA 3KSEA 2HHNA 2FT2A 3D6SA 1W6FA 5EF4A 1ZCMA 2R6NA 1W4TA 2IBIA 2DCDA 4QRVA 2DC9A 2R9NA 1O0EA 3KKUA 4AXLA 3PW3A 2AU1A 4I05A 1M6DA 1BGOA 2DC8A 8PCHA 4NV8A 2HD5A 3K9MA 2DCBA 2BSZA 2R9OA 1NB3A 5CVOB 3H7DA 1W5RA 2AVWA 2DZZA 1GMYA 3CH2X 3F5VA 1AIMA 1E2TA 1PXVA 1U9XA 1KFXL 1PBHA 1HUCB 1STFE 4FJCA 3WXGA 1QXPA 2P7UA 4BS6A 3P5XA 4QBBA 3HHAA 5EGWA 1CS8A 1CB5A 4N8WA 4RY2A 4W5CA 3WXEA 4P6GA 3N3GA 2AIMA 2DCCA 2VFCA 2YJ2A 3LXSA 1EF7A 2B1NA 5CVNB 2F1GA 1QDQA 1F2BA 2R9CA 2VHFA 2ARYA 3V6CA 5JA7A 2JQGR 1NLJA 1BP4A 1Y4HA 2H7JA 3P5VA 3MTNA 3KWZA 1PIPA 3C9EA 1MHWA 4X6HA 4BSQA 4HWYA 3IV2A 4I07A 1U9VA 4N79A 3PBHA 2HH5A 3MHSA 1CQDA 4Q8HA 3O0UA 2WBFX 3O1GA 2XU1A 1K3BB 3BWKA 4W4UA 4X6JA 1F29A 4FIPA 2NQIA 3IHPA 1YK7A 3PDFA 1NPZA 3H8BA 4YYQA 2AYOA 3CH3X 3K8UA 1ME4A 2DC7A 4N4ZA 3HWNA 1YK8A 2OZ2A 5CVMA 4QRXA 3GCBA 5F02A 1JQPA 2VHSA 1Y08A 4B55A 1DEUA 1ME3A 1MDWA 4CDEB 4CDCB 5PADA 2E00A 1X9YA 1DF0A 1VJVA 5JH3A 3TNXA 1AU0A 1TU6A 4QRGA 2FRAA 4YYSA 1U9WA 3BPMA 1MEMA 1SNKA 5J94A 2AUXA 2PREA 3P5UA 4PI3A 2XU3A 2DC6A 1F2AA 1NL6A 2NQDB 3CBKA 4PP2E 4MSXA 3N3KA 2NQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MIR A;  3IEJ A;  3H89 A;  4CDF B;  1MS6 A;  2P0R A;  2R9F A;  2G8E A;  2IPP B;  3P5W A;  1AEC A;  4YVA A;  2DZY A;  2YJB A;  3DF0 A;  1CVZ A;  2G7Y A;  4CDD B;  1GCB A;  4Q8G A;  2XU4 A;  3ERV A;  3KW9 A;  1PPN A;  2G8J A;  1CSB B;  3USV A;  2ACT A;  3S3Q A;  3U8E A;  3QT4 A;  1KFU L;  4MZO A;  2FRQ A;  1CJL A;  1A6R A;  3OVX A;  4AXM A;  2FTD A;  4QH6 A;  3NHE A;  1ITO A;  3IMA A;  1BY8 A;  4OEM A;  2DJF B;  1PAD A;  3OF8 A;  2OP3 A;  3HD3 A;  2BDL A;  3V6E A;  2CB5 A;  1THE A;  3BCN A;  2FUD A;  1IWD A;  4OEL A;  3PNR A;  1TL9 A;  4BS5 A;  1PPP A;  2GHU A;  3LFY A;  1YT7 A;  1PPO A;  5K16 A;  4ZUX U;  3QSD A;  2FQ9 A;  4YV8 A;  3H8C A;  3ZUA A;  2E02 A;  4WA6 A;  3OVZ A;  1KHQ A;  4BPV A;  3KFQ A;  1NB5 A;  4YYR A;  3OIS A;  4DMX A;  1S4V A;  2AS8 A;  1SP4 B;  2DCA A;  1EWM A;  5CHV A;  2AUZ A;  3OF9 A;  1AU4 A;  3QJ3 A;  9PAP A;  1QOL A;  2JQF R;  2PBH A;  2AYN A;  1BQI A;  2PAD A;  4XUI A;  3I3T A;  1AU3 A;  1F2C A;  1EWL A;  1EWO A;  1ICF A;  3AI8 A;  1GEC E;  3B79 A;  3BC3 A;  1U9Q X;  3RVW A;  2F7D A;  2NQA A;  2E01 A;  5A24 A;  3RVV A;  1YVB A;  1XKG A;  3IUT A;  3MOR A;  1PPD A;  3N4C A;  1TLO A;  5FPW A;  2YJ9 A;  3RVX A;  3BPF A;  4CZW A;  2YJ8 A;  1VSN A;  5CHT A;  4YYW A;  2ATO A;  4PAD A;  4YYU A;  3CBJ A;  1MEG A;  7PCK A;  1Q6K A;  2GFO A;  4MZS A;  3S3R A;  3F75 A;  1KHP A;  6PAD A;  2HXZ A;  4DMY A;  1AYU A;  4KLB A;  1AU2 A;  3HHI A;  1CPJ A;  1FH0 A;  2DJG B;  1GLO A;  4P6E A;  1ATK A;  4I04 A;  1AYV A;  3KX1 A;  3IOQ A;  2BDZ A;  2CIO A;  2O6X A;  2C0Y A;  3BOW A;  4XR7 A;  4FK5 A;  2Y5B A;  2B1M A;  1ZIV A;  1NQC A;  4X6I A;  4G54 A;  3H6S A;  2YJC A;  1QMY A;  1YAL A;  2PNS A;  2Y6E A;  3I06 A;  2E03 A;  4K7C A;  2P86 A;  4BQV A;  1EWP A;  4YYV A;  2FYE A;  1PE6 A;  3MHH A;  1POP A;  3KWB X;  2G6D A;  3E1Z B;  1PCI A;  3WXF A;  2R9M A;  1U5I A;  4W5B A;  1KXR A;  4PP1 A;  2XU5 A;  2FO5 A;  3M99 A;  3K24 A;  1CV8 A;  1CTE A;  1AYW A;  2OUL A;  3KSE A;  2HHN A;  2FT2 A;  3D6S A;  5EF4 A;  1ZCM A;  2R6N A;  2IBI A;  2DCD A;  4QRV A;  2DC9 A;  2R9N A;  1O0E A;  3KKU A;  4AXL A;  3PW3 A;  2AU1 A;  4I05 A;  1M6D A;  1BGO A;  2DC8 A;  8PCH A;  2HD5 A;  3K9M A;  2DCB A;  2R9O A;  1NB3 A;  5CVO B;  3H7D A;  2AVW A;  2DZZ A;  1GMY A;  3CH2 X;  3F5V A;  1AIM A;  1PXV A;  1U9X A;  1KFX L;  1PBH A;  1HUC B;  1STF E;  4FJC A;  3WXG A;  1QXP A;  2P7U A;  4BS6 A;  3P5X A;  4QBB A;  3HHA A;  5EGW A;  1CS8 A;  1CB5 A;  4N8W A;  4RY2 A;  4W5C A;  3WXE A;  4P6G A;  3N3G A;  2AIM A;  2DCC A;  2YJ2 A;  3LXS A;  1EF7 A;  2B1N A;  5CVN B;  2F1G A;  1QDQ A;  1F2B A;  2R9C A;  2VHF A;  2ARY A;  3V6C A;  5JA7 A;  2JQG R;  1NLJ A;  1BP4 A;  1Y4H A;  2H7J A;  3P5V A;  3MTN A;  3KWZ A;  1PIP A;  3C9E A;  1MHW A;  4X6H A;  4BSQ A;  4HWY A;  3IV2 A;  4I07 A;  1U9V A;  4N79 A;  3PBH A;  2HH5 A;  3MHS A;  1CQD A;  4Q8H A;  3O0U A;  2WBF X;  3O1G A;  2XU1 A;  1K3B B;  3BWK A;  4W4U A;  4X6J A;  1F29 A;  4FIP A;  2NQI A;  3IHP A;  1YK7 A;  3PDF A;  1NPZ A;  3H8B A;  4YYQ A;  2AYO A;  3CH3 X;  3K8U A;  1ME4 A;  2DC7 A;  4N4Z A;  3HWN A;  1YK8 A;  2OZ2 A;  5CVM A;  4QRX A;  3GCB A;  5F02 A;  1JQP A;  2VHS A;  1Y08 A;  1DEU A;  1ME3 A;  1MDW A;  4CDE B;  4CDC B;  5PAD A;  2E00 A;  1X9Y A;  1DF0 A;  1VJV A;  5JH3 A;  3TNX A;  1AU0 A;  1TU6 A;  4QRG A;  2FRA A;  4YYS A;  1U9W A;  3BPM A;  1MEM A;  1SNK A;  5J94 A;  2AUX A;  2PRE A;  3P5U A;  4PI3 A;  2XU3 A;  2DC6 A;  1F2A A;  1NL6 A;  2NQD B;  4PP2 E;  3CBK A;  4MSX A;  3N3K A;  2NQG A; 
#chains in the Genus database with same CATH topology
 1MIR A;  3IEJ A;  4D8E A;  3H89 A;  4CDF B;  1MS6 A;  2P0R A;  2R9F A;  2G8E A;  2IPP B;  1PVJ A;  3P5W A;  1AEC A;  4YVA A;  2DZY A;  2YJB A;  3DF0 A;  1CVZ A;  2G7Y A;  4CDD B;  1GCB A;  4Q8G A;  2XU4 A;  3ERV A;  2DOS A;  3PHW A;  3TRK A;  3KW9 A;  1PPN A;  2G8J A;  1CSB B;  3USV A;  2ACT A;  3S3Q A;  3U8E A;  3QT4 A;  1KFU L;  4MZO A;  2FRQ A;  1CJL A;  1A6R A;  3O65 A;  3MJ5 A;  3OVX A;  4AXM A;  2FTD A;  3PHU A;  4QH6 A;  3NHE A;  2JRI A;  1ITO A;  3IMA A;  1BY8 A;  4OEM A;  2DJF B;  1PAD A;  3OF8 A;  2OP3 A;  4IUM A;  3HD3 A;  2BDL A;  3V6E A;  2CB5 A;  1THE A;  3BCN A;  2FUD A;  1IWD A;  3BBA A;  4OEL A;  2BTW A;  3PNR A;  1TL9 A;  4A5U A;  4BS5 A;  1PPP A;  2GHU A;  3LFY A;  1YT7 A;  1PPO A;  5K16 A;  4ZUX U;  3QSD A;  2FQ9 A;  4YV8 A;  3H8C A;  3ZUA A;  2E02 A;  4BOP A;  4WA6 A;  3OVZ A;  1KHQ A;  4BPV A;  3KFQ A;  1NB5 A;  4YYR A;  3OIS A;  4DMX A;  1S4V A;  2AS8 A;  1SP4 B;  4OVZ B;  2DCA A;  1EWM A;  5CHV A;  2AUZ A;  3OF9 A;  1AU4 A;  3QJ3 A;  9PAP A;  1QOL A;  2JQF R;  2PBH A;  2AYN A;  1BQI A;  2PAD A;  4XUI A;  3I3T A;  1AU3 A;  1F2C A;  1EWL A;  1EWO A;  1ICF A;  3AI8 A;  1GEC E;  3B79 A;  3BC3 A;  1U9Q X;  2AGA A;  3RVW A;  2F7D A;  2JTC A;  2NQA A;  2E01 A;  5A24 A;  3RVV A;  1YVB A;  1XKG A;  3IUT A;  3MOR A;  1PPD A;  3N4C A;  3E9S A;  1TLO A;  5FPW A;  2YJ9 A;  3RVX A;  3BPF A;  4CZW A;  2YJ8 A;  4RF1 A;  1VSN A;  5CHT A;  2HWK A;  4YYW A;  4MM3 B;  2ATO A;  5JZE A;  4GUA A;  4PAD A;  4ZTB A;  4YYU A;  3CBJ A;  1MEG A;  7PCK A;  1Q6K A;  2GFO A;  4MZS A;  3S3R A;  4P16 A;  3F75 A;  1KHP A;  6PAD A;  4HXD B;  2HXZ A;  3PT2 A;  2Z84 A;  4DMY A;  1AYU A;  4KLB A;  1AU2 A;  3HHI A;  1CPJ A;  1FH0 A;  2DJG B;  1GLO A;  4WUR A;  4P6E A;  1ATK A;  4I04 A;  1AYV A;  2FE8 A;  3KX1 A;  3IOQ A;  2BDZ A;  4BOQ A;  2CIO A;  2O6X A;  2C0Y A;  2J7Q C;  3BOW A;  4XR7 A;  4FK5 A;  2Y5B A;  2B1M A;  1ZIV A;  1NQC A;  4X6I A;  4G54 A;  4IP3 A;  3H6S A;  2YJC A;  1QMY A;  1YAL A;  2PNS A;  2Y6E A;  3I06 A;  2E03 A;  4K7C A;  2J7Q A;  2P86 A;  4BQV A;  1EWP A;  4M0W A;  3W30 A;  4YYV A;  2FYE A;  3PRP A;  1PE6 A;  2BTW B;  3RNV A;  3MHH A;  1POP A;  3KWB X;  2G6D A;  3E1Z B;  1PCI A;  3WXF A;  2R9M A;  4RKX A;  1U5I A;  4W5B A;  1KXR A;  4PP1 A;  2XU5 A;  2FO5 A;  3M99 A;  3K24 A;  1CV8 A;  1CTE A;  1AYW A;  2OUL A;  3KSE A;  2HHN A;  2FT2 A;  3D6S A;  5EF4 A;  1ZCM A;  2R6N A;  4RNA A;  2IBI A;  1DKI A;  2DCD A;  4QRV A;  2DC9 A;  2R9N A;  1O0E A;  3KKU A;  4AXL A;  3PW3 A;  2AU1 A;  4I05 A;  1M6D A;  1BGO A;  4BOZ A;  2DC8 A;  8PCH A;  1UKF A;  3PRM A;  2UZJ A;  2HD5 A;  3K9M A;  2DCB A;  3ZNH A;  4BOS A;  4RF0 A;  4XZX A;  2R9O A;  1NB3 A;  5CVO B;  3H7D A;  2AVW A;  2DZZ A;  1GMY A;  3CH2 X;  3F5V A;  1AIM A;  4D8B A;  1PXV A;  1U9X A;  1KFX L;  1PBH A;  1HUC B;  1STF E;  4FJC A;  3WXG A;  1QXP A;  1YZB A;  2P7U A;  4BS6 A;  5EZQ A;  3P5X A;  4QBB A;  3HHA A;  3BB7 A;  5EGW A;  1CS8 A;  1CB5 A;  4N8W A;  4RY2 A;  4W5C A;  3PSE A;  4OW0 A;  3WXE A;  4P6G A;  3N3G A;  2AIM A;  2DCC A;  3MP2 A;  2YJ2 A;  3LXS A;  4D8I A;  1EF7 A;  2B1N A;  3PHX A;  5CVN B;  2F1G A;  3C0R A;  1QDQ A;  1F2B A;  2R9C A;  2VHF A;  2ARY A;  3V6C A;  5JA7 A;  2JQG R;  1NLJ A;  1BP4 A;  1Y4H A;  2H7J A;  3P5V A;  3MTN A;  3KWZ A;  1PIP A;  3C9E A;  1MHW A;  4X6H A;  4BSQ A;  4HWY A;  3IV2 A;  3B21 A;  4I07 A;  1U9V A;  4N79 A;  3PBH A;  2HH5 A;  3MHS A;  1CQD A;  4Q8H A;  3O0U A;  2WBF X;  3BY4 A;  3O1G A;  2XU1 A;  1K3B B;  3BWK A;  4W4U A;  4X6J A;  1F29 A;  4FIP A;  2BU3 A;  2NQI A;  5E6J A;  3IHP A;  1YK7 A;  3PDF A;  1NPZ A;  3H8B A;  4YYQ A;  2AYO A;  4REZ A;  3CH3 X;  4BOU A;  4OVZ A;  3K8U A;  4R3D A;  1ME4 A;  5KO3 A;  2DC7 A;  4N4Z A;  3HWN A;  1YK8 A;  2OZ2 A;  5CVM A;  4QRX A;  3GCB A;  5F02 A;  1JQP A;  3MTV A;  2VHS A;  1Y08 A;  1DEU A;  1ME3 A;  3W31 A;  1MDW A;  4CDE B;  4CDC B;  5PAD A;  2E00 A;  3IFU A;  4PT5 A;  1X9Y A;  1DF0 A;  1VJV A;  5EZS A;  5JH3 A;  3TNX A;  1AU0 A;  1TU6 A;  3OQC A;  4QRG A;  3TMP A;  2FRA A;  4YYS A;  1U9W A;  3BPM A;  1MEM A;  1SNK A;  5J94 A;  2AUX A;  2PRE A;  3P5U A;  4PI3 A;  2XU3 A;  2DC6 A;  1F2A A;  1NL6 A;  2NQD B;  3CBK A;  4PP2 E;  4MSX A;  3N3K A;  4MI7 A;  2NQG A; 
#chains in the Genus database with same CATH homology
 1MIR A;  3IEJ A;  3LTW A;  3H89 A;  4CDF B;  1MS6 A;  2P0R A;  2R9F A;  2G8E A;  2IPP B;  3P5W A;  1AEC A;  4YVA A;  2DZY A;  2YJB A;  3DF0 A;  1CVZ A;  2G7Y A;  4CDD B;  1GCB A;  4Q8G A;  2XU4 A;  3ERV A;  3KW9 A;  1PPN A;  2G8J A;  1CSB B;  3USV A;  2ACT A;  3S3Q A;  3U8E A;  3QT4 A;  4NV7 A;  4GUZ A;  1KFU L;  4MZO A;  2FRQ A;  1CJL A;  1A6R A;  3OVX A;  4AXM A;  2FTD A;  4QH6 A;  3NHE A;  1ITO A;  4C5P A;  3IMA A;  1BY8 A;  4OEM A;  2DJF B;  1PAD A;  3OF8 A;  2OP3 A;  3HD3 A;  2BDL A;  3V6E A;  2CB5 A;  1THE A;  3BCN A;  2FUD A;  1IWD A;  4OEL A;  3PNR A;  1TL9 A;  4BS5 A;  1PPP A;  2GHU A;  3LFY A;  1YT7 A;  1PPO A;  5K16 A;  4ZUX U;  3QSD A;  2FQ9 A;  4YV8 A;  3H8C A;  3ZUA A;  2E02 A;  4WA6 A;  3OVZ A;  1KHQ A;  4BPV A;  3KFQ A;  1NB5 A;  4YYR A;  3OIS A;  4DMX A;  1S4V A;  2AS8 A;  1SP4 B;  2DCA A;  1EWM A;  5CHV A;  2AUZ A;  3OF9 A;  2VFB A;  1AU4 A;  3QJ3 A;  9PAP A;  1QOL A;  2JQF R;  2PBH A;  2AYN A;  1BQI A;  2PAD A;  4XUI A;  3I3T A;  1AU3 A;  1F2C A;  1EWL A;  1EWO A;  1ICF A;  3AI8 A;  1GEC E;  3B79 A;  3BC3 A;  1U9Q X;  3RVW A;  2F7D A;  2NQA A;  2E01 A;  5A24 A;  1GX3 A;  3RVV A;  1YVB A;  1XKG A;  3IUT A;  3MOR A;  1PPD A;  3N4C A;  1TLO A;  5FPW A;  2YJ9 A;  3RVX A;  3BPF A;  4CZW A;  2YJ8 A;  1VSN A;  5CHT A;  4YYW A;  2ATO A;  4PAD A;  4YYU A;  3CBJ A;  1MEG A;  7PCK A;  1Q6K A;  2GFO A;  4MZS A;  3S3R A;  3F75 A;  1KHP A;  6PAD A;  2HXZ A;  4DMY A;  1AYU A;  4KLB A;  1AU2 A;  3HHI A;  1CPJ A;  1FH0 A;  2DJG B;  1GLO A;  4P6E A;  1ATK A;  3D9W A;  1AYV A;  4I04 A;  3KX1 A;  3IOQ A;  2BDZ A;  2CIO A;  2O6X A;  2C0Y A;  3BOW A;  4XR7 A;  4FK5 A;  2Y5B A;  2B1M A;  4BGF A;  1ZIV A;  1NQC A;  4X6I A;  4G54 A;  3H6S A;  2YJC A;  1QMY A;  1YAL A;  2PNS A;  2Y6E A;  3I06 A;  2E03 A;  4K7C A;  2P86 A;  4BQV A;  1EWP A;  4YYV A;  2FYE A;  1PE6 A;  3MHH A;  1POP A;  3KWB X;  2G6D A;  3E1Z B;  1PCI A;  3WXF A;  2R9M A;  1U5I A;  4W5B A;  1KXR A;  4PP1 A;  2XU5 A;  2FO5 A;  3M99 A;  3K24 A;  1CV8 A;  1CTE A;  1AYW A;  2OUL A;  3KSE A;  2HHN A;  2FT2 A;  3D6S A;  1W6F A;  5EF4 A;  1ZCM A;  2R6N A;  1W4T A;  2IBI A;  2DCD A;  4QRV A;  2DC9 A;  2R9N A;  1O0E A;  3KKU A;  4AXL A;  3PW3 A;  2AU1 A;  4I05 A;  1M6D A;  1BGO A;  2DC8 A;  8PCH A;  4NV8 A;  2HD5 A;  3K9M A;  2DCB A;  2BSZ A;  2R9O A;  1NB3 A;  5CVO B;  3H7D A;  1W5R A;  2AVW A;  2DZZ A;  1GMY A;  3CH2 X;  3F5V A;  1AIM A;  1E2T A;  1PXV A;  1U9X A;  1KFX L;  1PBH A;  1HUC B;  1STF E;  4FJC A;  3WXG A;  1QXP A;  2P7U A;  4BS6 A;  3P5X A;  4QBB A;  3HHA A;  5EGW A;  1CS8 A;  1CB5 A;  4N8W A;  4RY2 A;  4W5C A;  3WXE A;  4P6G A;  3N3G A;  2AIM A;  2DCC A;  2VFC A;  2YJ2 A;  3LXS A;  1EF7 A;  2B1N A;  5CVN B;  2F1G A;  1QDQ A;  1F2B A;  2R9C A;  2VHF A;  2ARY A;  3V6C A;  5JA7 A;  2JQG R;  1NLJ A;  1BP4 A;  1Y4H A;  2H7J A;  3P5V A;  3MTN A;  3KWZ A;  1PIP A;  3C9E A;  1MHW A;  4X6H A;  4BSQ A;  4HWY A;  3IV2 A;  4I07 A;  1U9V A;  4N79 A;  3PBH A;  2HH5 A;  3MHS A;  1CQD A;  4Q8H A;  3O0U A;  2WBF X;  3O1G A;  2XU1 A;  1K3B B;  3BWK A;  4W4U A;  4X6J A;  1F29 A;  4FIP A;  2NQI A;  3IHP A;  1YK7 A;  3PDF A;  1NPZ A;  3H8B A;  4YYQ A;  2AYO A;  3CH3 X;  3K8U A;  1ME4 A;  2DC7 A;  4N4Z A;  3HWN A;  1YK8 A;  2OZ2 A;  5CVM A;  4QRX A;  3GCB A;  5F02 A;  1JQP A;  2VHS A;  1Y08 A;  4B55 A;  1DEU A;  1ME3 A;  1MDW A;  4CDE B;  4CDC B;  5PAD A;  2E00 A;  1X9Y A;  1DF0 A;  1VJV A;  5JH3 A;  3TNX A;  1AU0 A;  1TU6 A;  4QRG A;  2FRA A;  4YYS A;  1U9W A;  3BPM A;  1MEM A;  1SNK A;  5J94 A;  2AUX A;  2PRE A;  3P5U A;  4PI3 A;  2XU3 A;  2DC6 A;  1F2A A;  1NL6 A;  2NQD B;  3CBK A;  4PP2 E;  4MSX A;  3N3K A;  2NQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...