4BOZA

Structure of otud2 otu domain in complex with k11-linked di ubiquitin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
158
Chain Sequence
b'PVLTRTVVPADNSALFTSVYYVVEGGVLNPACAPEMRRLIAQIVASDPDFYSEAILGKTNQEYCDWIKRDDTWGGAIEISILSKFYQCEICVVDTQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRNFTPPLTIFSSNDDIVLVQALELADEARRRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN THIOESTERASE OTU1
publication title Otu Deubiquitinases Reveal Mechanisms of Linkage Specificity and Enable Ubiquitin Chain Restriction Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 50
structure length 158
sequence length 162
chains with identical sequence D
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4bozA00
3PT2A 4BOUA 4HXDB 3PHWA 3PSEA 4BOQA 3PHUA 3BY4A 3TMPA 3ZNHA 4BOZA 3PHXA 3C0RA 3PRPA 5JZEA 4BOSA 4BOPA 3PRMA
chains in the Genus database with same CATH superfamily
1ITOA 2FRQA 2DC9A 1NLJA 2IBIA 1M6DA 4MSXA 1ZCMA 4AXLA 3BPFA 2CIOA 3ERVA 1QXPA 1MDWA 5PADA 2ARYA 2G8JA 4MZOA 1EWMA 2YJBA 4DMXA 4QRVA 5CVMA 4PP1A 1BY8A 3HWNA 4Q8GA 3IOQA 4YYWA 3KX1A 1QDQA 3K9MA 4FIPA 2R9FA 1F29A 2AU1A 2AYOA 2PADA 3W31A 4ZTBA 3KWBX 1NB5A 1VSNA 2IPPB 1AU4A 4P6GA 1SNKA 3S3QA 3CBJA 4IP3A 3PHXA 3MTNA 1PPOA 3WXFA 3NHEA 1SP4B 4N79A 2C0YA 4N8WA 1Y08A 5JZEA 3P5XA 1PE6A 3BOWA 3BPMA 1AYUA 2PBHA 3V6EA 1AU0A 1MEGA 3MORA 5F02A 3CH2X 4MZSA 1CV8A 3MP2A 1YZBA 4REZA 2JTCA 3H7DA 1QOLA 3D6SA 2G8EA 2Y5BA 3H89A 3P5UA 4OEMA 3PNRA 1AU3A 2AUZA 1U9XA 4OVZB 2OZ2A 1ZIVA 1PBHA 4W5BA 1ATKA 1CJLA 3USVA 2XU4A 1YALA 5JH3A 1O0EA 1F2CA 2FO5A 2GFOA 4BOQA 2B1MA 3ZNHA 2E01A 3C0RA 3U8EA 4OW0A 4BOSA 2Z84A 2HHNA 1PPPA 3O1GA 1XKGA 2F7DA 4D8IA 4PI3A 2F1GA 1U9QX 1EWOA 4BOZA 2CB5A 1TU6A 3PRPA 4CDFB 3B21A 4FK5A 5EZSA 3KWZA 2HD5A 2O6XA 2JQFR 4YVAA 1NL6A 1U9VA 1AIMA 4XZXA 3F75A 3PW3A 1MIRA 2PREA 2FUDA 2XU5A 2DC8A 1AYWA 3KW9A 4BQVA 1EF7A 1JQPA 1GCBA 4HXDB 4PADA 4MM3B 1CSBB 1F2AA 1YK8A 3PSEA 3IHPA 5A24A 2YJ9A 2BDZA 3PT2A 1VJVA 4WURA 3MHHA 2DCDA 3PDFA 4BSQA 4X6IA 4CZWA 3MJ5A 5E6JA 2R6NA 3V6CA 4KLBA 2DCAA 2AS8A 3H8BA 3DF0A 3N3GA 1U9WA 2R9CA 4QH6A 1PVJA 5KO3A 2DZYA 2AUXA 5K16A 1TL9A 2DJGB 3OVZA 2HWKA 2B1NA 4AXMA 2NQIA 3OVXA 1PADA 1KXRA 2DJFB 3H8CA 5CVOB 3BY4A 4OVZA 2FT2A 4BOPA 4FJCA 4YYUA 4GUAA 3N4CA 3OISA 1MHWA 4MI7A 2AIMA 4K7CA 1YVBA 1HUCB 1YK7A 1Q6KA 1POPA 2XU3A 4YYVA 1CVZA 9PAPA 3BB7A 4PP2E 4BPVA 4XUIA 2ACTA 5CHTA 4DMYA 4XR7A 2DC6A 1S4VA 1PXVA 3IUTA 1KHQA 4X6HA 3F5VA 1ICFA 4YV8A 2GHUA 2HXZA 1ME4A 1TLOA 3KKUA 3LXSA 2YJ2A 2H7JA 3PRMA 3IMAA 1AU2A 4PT5A 3LFYA 8PCHA 1PPNA 2VHFA 1KHPA 4WA6A 2DOSA 4I04A 2G6DA 4QBBA 1GMYA 3H6SA 3CH3X 5CVNB 2DCCA 4IUMA 2PNSA 5EGWA 3HHAA 3I3TA 4A5UA 1ME3A 1CS8A 3P5WA 2NQDB 3WXEA 1BGOA 2E03A 1EWLA 2JQGR 2R9OA 3BC3A 3PHUA 2DZZA 3B79A 5CHVA 1Y4HA 3O65A 2DC7A 2DCBA 2YJCA 2AYNA 4CDCB 1PIPA 2ATOA 2FTDA 4I05A 2NQGA 3BWKA 1X9YA 2BDLA 3N3KA 3QSDA 2BU3A 1THEA 3E9SA 1UKFA 2J7QC 2YJ8A 4R3DA 4YYRA 3HD3A 1NB3A 7PCKA 2BTWB 2OP3A 3C9EA 2J7QA 1A6RA 1EWPA 4RF1A 1BP4A 3RNVA 3TNXA 1STFE 2FQ9A 1NQCA 3TMPA 4I07A 5EF4A 1NPZA 2P7UA 4BS6A 4RNAA 1AECA 4Q8HA 2XU1A 3K8UA 4CDEB 1CPJA 3MTVA 2P0RA 4YYSA 3KSEA 1GLOA 3M99A 4D8BA 2P86A 1YT7A 1QMYA 1CQDA 6PADA 2G7YA 1PCIA 3KFQA 3QT4A 3BCNA 1U5IA 3GCBA 3I06A 1KFXL 3W30A 3PHWA 4P6EA 3RVVA 4OELA 3OF9A 4BS5A 1DEUA 1IWDA 4RY2A 2NQAA 4M0WA 2AGAA 4X6JA 3IEJA 2AVWA 3PBHA 2R9NA 4YYQA 4P16A 3BBAA 5J94A 2JRIA 1KFUL 3OQCA 5FPWA 3IFUA 4CDDB 3O0UA 4RKXA 3K24A 1BQIA 3RVXA 2FRAA 4N4ZA 3MHSA 3IV2A 2UZJA 4QRGA 3ZUAA 3S3RA 2OULA 4W4UA 4D8EA 1F2BA 2Y6EA 3RVWA 1GECE 1K3BB 5EZQA 3WXGA 4G54A 1DF0A 4W5CA 4QRXA 2WBFX 1PPDA 3TRKA 2FE8A 1MS6A 3HHIA 1MEMA 2FYEA 4RF0A 1DKIA 4ZUXU 3E1ZB 2BTWA 3CBKA 4BOUA 2HH5A 3OF8A 2E02A 3AI8A 2R9MA 1AYVA 1FH0A 4HWYA 2E00A 3P5VA 2VHSA 3QJ3A 1CTEA 5JA7A 1CB5A
chains in the Genus database with same CATH topology
3MTVA 4BOZA 3PRPA 3BB7A 3B21A 5EZSA 4D8BA 3W30A 3PHWA 4XZXA 3PRMA 4PT5A 4M0WA 2AGAA 2DOSA 4HXDB 3W31A 4MM3B 4ZTBA 4IUMA 4P16A 3PSEA 3BBAA 4IP3A 3PHXA 2JRIA 3OQCA 4A5UA 3PT2A 3IFUA 4RKXA 4WURA 3MJ5A 2UZJA 5E6JA 3PHUA 5JZEA 3O65A 4D8EA 1PVJA 5EZQA 5KO3A 3MP2A 1YZBA 4REZA 2BU3A 2HWKA 2JTCA 3TRKA 3E9SA 1UKFA 2J7QC 2FE8A 4R3DA 4RF0A 4OVZB 2BTWB 3BY4A 1DKIA 4OVZA 2BTWA 2J7QA 4BOUA 4BOPA 4RF1A 3RNVA 4BOQA 3TMPA 3ZNHA 3C0RA 4BOSA 4OW0A 4GUAA 2Z84A 4RNAA 4MI7A 4D8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PT2 A;  4BOU A;  4HXD B;  3PHW A;  3PSE A;  4BOQ A;  3PHU A;  3BY4 A;  3TMP A;  3ZNH A;  4BOZ A;  3PHX A;  3C0R A;  3PRP A;  5JZE A;  4BOS A;  4BOP A;  3PRM A; 
#chains in the Genus database with same CATH topology
 1ITO A;  2FRQ A;  2DC9 A;  1NLJ A;  2IBI A;  1M6D A;  4MSX A;  1ZCM A;  4AXL A;  3BPF A;  2CIO A;  3ERV A;  1QXP A;  1MDW A;  5PAD A;  2ARY A;  2G8J A;  4MZO A;  1EWM A;  2YJB A;  4DMX A;  4QRV A;  5CVM A;  4PP1 A;  1BY8 A;  3HWN A;  4Q8G A;  3IOQ A;  4YYW A;  3KX1 A;  1QDQ A;  3K9M A;  4FIP A;  2R9F A;  1F29 A;  2AU1 A;  2AYO A;  2PAD A;  3W31 A;  4ZTB A;  3KWB X;  1NB5 A;  1VSN A;  2IPP B;  1AU4 A;  4P6G A;  1SNK A;  3S3Q A;  3CBJ A;  4IP3 A;  3PHX A;  3MTN A;  1PPO A;  3WXF A;  3NHE A;  1SP4 B;  4N79 A;  2C0Y A;  4N8W A;  1Y08 A;  5JZE A;  3P5X A;  1PE6 A;  3BOW A;  3BPM A;  1AYU A;  2PBH A;  3V6E A;  1AU0 A;  1MEG A;  3MOR A;  5F02 A;  3CH2 X;  4MZS A;  1CV8 A;  3MP2 A;  1YZB A;  4REZ A;  2JTC A;  3H7D A;  1QOL A;  3D6S A;  2G8E A;  2Y5B A;  3H89 A;  3P5U A;  4OEM A;  3PNR A;  1AU3 A;  2AUZ A;  1U9X A;  4OVZ B;  2OZ2 A;  1ZIV A;  1PBH A;  4W5B A;  1ATK A;  1CJL A;  3USV A;  2XU4 A;  1YAL A;  5JH3 A;  1O0E A;  1F2C A;  2FO5 A;  2GFO A;  4BOQ A;  2B1M A;  3ZNH A;  2E01 A;  3C0R A;  3U8E A;  4OW0 A;  4BOS A;  2Z84 A;  2HHN A;  1PPP A;  3O1G A;  1XKG A;  2F7D A;  4D8I A;  4PI3 A;  2F1G A;  1U9Q X;  1EWO A;  4BOZ A;  2CB5 A;  1TU6 A;  3PRP A;  4CDF B;  3B21 A;  4FK5 A;  5EZS A;  3KWZ A;  2HD5 A;  2O6X A;  2JQF R;  4YVA A;  1NL6 A;  1U9V A;  1AIM A;  4XZX A;  3F75 A;  3PW3 A;  1MIR A;  2PRE A;  2FUD A;  2XU5 A;  2DC8 A;  1AYW A;  3KW9 A;  4BQV A;  1EF7 A;  1JQP A;  1GCB A;  4HXD B;  4PAD A;  4MM3 B;  1CSB B;  1F2A A;  1YK8 A;  3PSE A;  3IHP A;  5A24 A;  2YJ9 A;  2BDZ A;  3PT2 A;  1VJV A;  4WUR A;  3MHH A;  2DCD A;  3PDF A;  4BSQ A;  4X6I A;  4CZW A;  3MJ5 A;  5E6J A;  2R6N A;  3V6C A;  4KLB A;  2DCA A;  2AS8 A;  3H8B A;  3DF0 A;  3N3G A;  1U9W A;  2R9C A;  4QH6 A;  1PVJ A;  5KO3 A;  2DZY A;  2AUX A;  5K16 A;  1TL9 A;  2DJG B;  3OVZ A;  2HWK A;  2B1N A;  4AXM A;  2NQI A;  3OVX A;  1PAD A;  1KXR A;  2DJF B;  3H8C A;  5CVO B;  3BY4 A;  4OVZ A;  2FT2 A;  4BOP A;  4FJC A;  4YYU A;  4GUA A;  3N4C A;  3OIS A;  1MHW A;  4MI7 A;  2AIM A;  4K7C A;  1YVB A;  1HUC B;  1YK7 A;  1Q6K A;  1POP A;  2XU3 A;  4YYV A;  1CVZ A;  9PAP A;  3BB7 A;  4PP2 E;  4BPV A;  4XUI A;  2ACT A;  5CHT A;  4DMY A;  4XR7 A;  2DC6 A;  1S4V A;  1PXV A;  3IUT A;  1KHQ A;  4X6H A;  3F5V A;  1ICF A;  4YV8 A;  2GHU A;  2HXZ A;  1ME4 A;  1TLO A;  3KKU A;  3LXS A;  2YJ2 A;  2H7J A;  3PRM A;  3IMA A;  1AU2 A;  4PT5 A;  3LFY A;  8PCH A;  1PPN A;  2VHF A;  1KHP A;  4WA6 A;  2DOS A;  4I04 A;  2G6D A;  4QBB A;  1GMY A;  3H6S A;  3CH3 X;  5CVN B;  2DCC A;  4IUM A;  2PNS A;  5EGW A;  3HHA A;  3I3T A;  4A5U A;  1ME3 A;  1CS8 A;  3P5W A;  2NQD B;  3WXE A;  1BGO A;  2E03 A;  1EWL A;  2JQG R;  2R9O A;  3BC3 A;  3PHU A;  2DZZ A;  3B79 A;  5CHV A;  1Y4H A;  3O65 A;  2DC7 A;  2DCB A;  2YJC A;  2AYN A;  4CDC B;  1PIP A;  2ATO A;  2FTD A;  4I05 A;  2NQG A;  3BWK A;  1X9Y A;  2BDL A;  3N3K A;  3QSD A;  2BU3 A;  1THE A;  3E9S A;  1UKF A;  2J7Q C;  2YJ8 A;  4R3D A;  4YYR A;  3HD3 A;  1NB3 A;  7PCK A;  2BTW B;  2OP3 A;  3C9E A;  2J7Q A;  1A6R A;  1EWP A;  4RF1 A;  1BP4 A;  3RNV A;  3TNX A;  1STF E;  2FQ9 A;  1NQC A;  3TMP A;  4I07 A;  5EF4 A;  1NPZ A;  2P7U A;  4BS6 A;  4RNA A;  1AEC A;  4Q8H A;  2XU1 A;  3K8U A;  4CDE B;  1CPJ A;  3MTV A;  2P0R A;  4YYS A;  3KSE A;  1GLO A;  3M99 A;  4D8B A;  2P86 A;  1YT7 A;  1QMY A;  1CQD A;  6PAD A;  2G7Y A;  1PCI A;  3KFQ A;  3QT4 A;  3BCN A;  1U5I A;  3GCB A;  3I06 A;  1KFX L;  3W30 A;  3PHW A;  4P6E A;  3RVV A;  4OEL A;  3OF9 A;  4BS5 A;  1DEU A;  1IWD A;  4RY2 A;  2NQA A;  4M0W A;  2AGA A;  4X6J A;  3IEJ A;  2AVW A;  3PBH A;  2R9N A;  4YYQ A;  4P16 A;  3BBA A;  5J94 A;  2JRI A;  1KFU L;  3OQC A;  5FPW A;  3IFU A;  4CDD B;  3O0U A;  4RKX A;  3K24 A;  1BQI A;  3RVX A;  2FRA A;  4N4Z A;  3MHS A;  3IV2 A;  2UZJ A;  4QRG A;  3ZUA A;  3S3R A;  2OUL A;  4W4U A;  4D8E A;  1F2B A;  2Y6E A;  3RVW A;  1GEC E;  1K3B B;  5EZQ A;  3WXG A;  4G54 A;  1DF0 A;  4W5C A;  4QRX A;  2WBF X;  1PPD A;  3TRK A;  2FE8 A;  1MS6 A;  3HHI A;  1MEM A;  2FYE A;  4RF0 A;  1DKI A;  4ZUX U;  3E1Z B;  2BTW A;  3CBK A;  4BOU A;  2HH5 A;  3OF8 A;  2E02 A;  3AI8 A;  2R9M A;  1AYV A;  1FH0 A;  4HWY A;  2E00 A;  3P5V A;  2VHS A;  3QJ3 A;  1CTE A;  5JA7 A;  1CB5 A; 
#chains in the Genus database with same CATH homology
 3MTV A;  4BOZ A;  3PRP A;  3BB7 A;  3B21 A;  5EZS A;  4D8B A;  3W30 A;  3PHW A;  4XZX A;  3PRM A;  4PT5 A;  4M0W A;  2AGA A;  2DOS A;  4HXD B;  3W31 A;  4MM3 B;  4ZTB A;  4IUM A;  4P16 A;  3PSE A;  3BBA A;  4IP3 A;  3PHX A;  2JRI A;  3OQC A;  4A5U A;  3PT2 A;  3IFU A;  4RKX A;  4WUR A;  3MJ5 A;  2UZJ A;  5E6J A;  3PHU A;  5JZE A;  3O65 A;  4D8E A;  1PVJ A;  5EZQ A;  5KO3 A;  3MP2 A;  1YZB A;  4REZ A;  2BU3 A;  2HWK A;  2JTC A;  3TRK A;  3E9S A;  1UKF A;  2J7Q C;  2FE8 A;  4R3D A;  4RF0 A;  4OVZ B;  2BTW B;  3BY4 A;  1DKI A;  4OVZ A;  2BTW A;  2J7Q A;  4BOU A;  4BOP A;  4RF1 A;  3RNV A;  4BOQ A;  3TMP A;  3ZNH A;  3C0R A;  4BOS A;  4OW0 A;  4GUA A;  2Z84 A;  4RNA A;  4MI7 A;  4D8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...