4BOZA

Structure of otud2 otu domain in complex with k11-linked di ubiquitin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
158
Chain Sequence
PVLTRTVVPADNSALFTSVYYVVEGGVLNPACAPEMRRLIAQIVASDPDFYSEAILGKTNQEYCDWIKRDDTWGGAIEISILSKFYQCEICVVDTQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRNFTPPLTIFSSNDDIVLVQALELADEARRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN THIOESTERASE OTU1
publication title Otu Deubiquitinases Reveal Mechanisms of Linkage Specificity and Enable Ubiquitin Chain Restriction Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 50
structure length 158
sequence length 162
chains with identical sequence D
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4bozA00
5JZEA 3ZNHA 4BOSA 3PHUA 3BY4A 3C0RA 4BOQA 3PHXA 3PHWA 4BOPA 3PSEA 3TMPA 3PT2A 3PRPA 4BOUA 3PRMA 4BOZA 4HXDB
chains in the Genus database with same CATH superfamily
1EWLA 3BY4A 4BS6A 3CH3X 4I05A 1M6DA 3PDFA 3B21A 2GHUA 1MIRA 4QBBA 2OULA 2AUXA 2NQAA 3C9EA 1AU0A 1YK7A 4QRVA 1X9YA 2FTDA 2P0RA 2DCDA 3USVA 4PT5A 5EZQA 1TLOA 4N4ZA 1O0EA 2HXZA 1PPOA 3OVXA 1PADA 1NQCA 2DC9A 1CVZA 1U9WA 2VHSA 3M99A 1FH0A 3W30A 1AU4A 2HHNA 3IMAA 3AI8A 1PCIA 1NPZA 3O1GA 1DF0A 4KLBA 5J94A 3QJ3A 1AU3A 1A6RA 1AYUA 4P6GA 1JQPA 4BOPA 1GCBA 1Y4HA 2AYNA 3PNRA 2CIOA 2YJ8A 1F2CA 4PP2E 4P16A 4AXLA 3MJ5A 2FRAA 1STFE 1AECA 1CTEA 1Q6KA 2DZZA 1SP4B 4BPVA 5JA7A 4YYUA 4MZSA 3QT4A 1XKGA 1Y08A 1F2BA 4R3DA 2G8JA 4K7CA 3KFQA 2OP3A 2JQGR 3CBKA 5JZEA 4BQVA 5CVNB 2R6NA 2NQIA 1DEUA 2BTWB 3ZNHA 3S3QA 1F29A 1POPA 4RF1A 1UKFA 2DCCA 3K24A 1BP4A 4OELA 3LFYA 4X6JA 3D6SA 3DF0A 4RY2A 5A24A 4MI7A 4X6IA 1QXPA 2FO5A 2DCAA 3NHEA 2AGAA 3KWBX 3N4CA 1AYWA 2BU3A 1S4VA 3PHWA 1MEGA 2YJCA 3PRMA 4PP1A 5F02A 4Q8GA 2FYEA 3PBHA 3OF9A 2R9NA 2IBIA 4Q8HA 3KX1A 2AIMA 4HXDB 3HD3A 1YVBA 3B79A 4FIPA 2HH5A 4DMYA 4W4UA 2B1NA 2DC6A 2FUDA 3HHIA 2H7JA 4D8IA 4IP3A 1THEA 4CDEB 2JQFR 2VHFA 4CDFB 3GCBA 3N3KA 4IUMA 4D8EA 5EF4A 4FJCA 5JH3A 1U5IA 4CDCB 2PNSA 4YV8A 3K8UA 4P6EA 3MHHA 4DMXA 2G7YA 4OEMA 3P5VA 4HWYA 3TNXA 4I07A 3BBAA 4BOUA 3LXSA 3K9MA 1ATKA 2Z84A 3OF8A 4G54A 5CHTA 3WXFA 4ZUXU 1IWDA 3PHUA 2F1GA 1EWOA 1BQIA 1TU6A 7PCKA 1U9VA 2FT2A 2JTCA 3O65A 3N3GA 1PE6A 4BS5A 4YVAA 2R9FA 2G8EA 4RNAA 2YJBA 2DC8A 3F5VA 2XU4A 1TL9A 2Y5BA 4CZWA 5CVMA 1YK8A 1ZIVA 4XZXA 3BPMA 2FE8A 3KWZA 1ITOA 1VJVA 3IHPA 4X6HA 3C0RA 2ACTA 2DJGB 2OZ2A 3KKUA 3BC3A 3IFUA 1HUCB 3RVVA 4PI3A 1QOLA 1PPPA 3WXGA 3BCNA 3MTVA 4REZA 5PADA 2XU5A 2NQDB 1PVJA 1MS6A 1CSBB 5EGWA 1DKIA 4OVZA 1CS8A 3ERVA 3H7DA 3MORA 2E00A 4GUAA 1F2AA 2DJFB 2JRIA 2J7QC 6PADA 1KHPA 1ME3A 2R9MA 1NB3A 3PHXA 3H8BA 3MP2A 2AU1A 3RVXA 1GECE 5CHVA 2UZJA 2AVWA 3P5UA 5KO3A 5E6JA 3BB7A 1KFUL 1K3BB 3HHAA 4BOSA 1PPNA 3P5XA 3H8CA 1GLOA 4RKXA 4YYWA 3MTNA 1EF7A 4MZOA 3V6EA 4D8BA 2F7DA 4M0WA 4YYQA 1YZBA 1ME4A 4WURA 3IUTA 1YT7A 1MDWA 2XU3A 3P5WA 1PIPA 2R9CA 4YYRA 3E9SA 3BOWA 3I06A 2PADA 3QSDA 2FRQA 4A5UA 4AXMA 3E1ZB 1PXVA 3U8EA 2FQ9A 2PBHA 1PBHA 5EZSA 4BOQA 4MSXA 1KFXL 2CB5A 3OISA 2C0YA 1U9QX 3RVWA 3H6SA 1EWPA 3HWNA 1CJLA 4FK5A 5FPWA 4BOZA 2E02A 2BDZA 4XR7A 2XU1A 2ATOA 2E03A 4QH6A 8PCHA 4N8WA 1CPJA 2WBFX 3IOQA 1U9XA 3IEJA 1MHWA 4XUIA 3TMPA 1YALA 3V6CA 2HD5A 1ZCMA 4W5CA 3BWKA 1KXRA 2IPPB 1ICFA 3CH2X 2DZYA 1CV8A 2YJ9A 2HWKA 3O0UA 2G6DA 4BSQA 3PSEA 3WXEA 4I04A 5CVOB 3OVZA 2DOSA 4QRXA 3PRPA 1BY8A 2B1MA 4ZTBA 3F75A 1NB5A 2BTWA 2E01A 4YYVA 4OW0A 2AYOA 5K16A 2AS8A 1NL6A 3W31A 3BPFA 4YYSA 4N79A 1AU2A 2AUZA 2O6XA 3S3RA 1BGOA 4MM3B 1CB5A 3KW9A 3MHSA 4QRGA 3ZUAA 3TRKA 4OVZB 1KHQA 1CQDA 2P7UA 2P86A 2ARYA 1GMYA 3OQCA 4CDDB 3KSEA 4WA6A 2R9OA 3I3TA 9PAPA 2PREA 4PADA 3PW3A 1VSNA 1PPDA 2Y6EA 2GFOA 3H89A 3RNVA 1AIMA 1QMYA 2J7QA 3IV2A 1EWMA 1NLJA 2YJ2A 1AYVA 2DC7A 1SNKA 3PT2A 1QDQA 2DCBA 4W5BA 2NQGA 1MEMA 3CBJA 2BDLA 4RF0A
chains in the Genus database with same CATH topology
4XZXA 3BY4A 2FE8A 2AGAA 4BOZA 3B21A 3C0RA 2BU3A 3IFUA 3PHWA 3TMPA 3PRMA 3MTVA 4REZA 1PVJA 4PT5A 5EZQA 1DKIA 4OVZA 4HXDB 2HWKA 4GUAA 3PSEA 4D8IA 2JRIA 2J7QC 3W30A 4IP3A 3PHXA 2DOSA 3PRPA 3MP2A 4IUMA 4D8EA 4ZTBA 2BTWA 4OW0A 2UZJA 3W31A 4BOPA 5KO3A 5E6JA 3BB7A 4MM3B 4P16A 3BBAA 3MJ5A 4BOUA 3TRKA 4BOSA 4OVZB 2Z84A 4RKXA 3PHUA 3OQCA 4R3DA 4D8BA 4M0WA 2JTCA 1YZBA 4WURA 5JZEA 3O65A 3RNVA 3E9SA 2BTWB 2J7QA 3ZNHA 4RNAA 4A5UA 3PT2A 4RF1A 1UKFA 5EZSA 4BOQA 4MI7A 4RF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JZE A;  3ZNH A;  4BOS A;  3PHU A;  3BY4 A;  3C0R A;  4BOQ A;  3PHX A;  3PHW A;  4BOP A;  3PSE A;  3TMP A;  3PT2 A;  3PRP A;  4BOU A;  3PRM A;  4BOZ A;  4HXD B; 
#chains in the Genus database with same CATH topology
 1EWL A;  3BY4 A;  4BS6 A;  3CH3 X;  4I05 A;  1M6D A;  3PDF A;  3B21 A;  2GHU A;  1MIR A;  4QBB A;  2OUL A;  2AUX A;  2NQA A;  3C9E A;  1AU0 A;  1YK7 A;  4QRV A;  1X9Y A;  2FTD A;  2P0R A;  2DCD A;  3USV A;  4PT5 A;  5EZQ A;  1TLO A;  4N4Z A;  1O0E A;  2HXZ A;  1PPO A;  3OVX A;  1PAD A;  1NQC A;  2DC9 A;  1CVZ A;  1U9W A;  2VHS A;  3M99 A;  1FH0 A;  3W30 A;  1AU4 A;  2HHN A;  3IMA A;  3AI8 A;  1PCI A;  1NPZ A;  3O1G A;  1DF0 A;  4KLB A;  5J94 A;  3QJ3 A;  1AU3 A;  1A6R A;  1AYU A;  4P6G A;  1JQP A;  4BOP A;  1GCB A;  1Y4H A;  2AYN A;  3PNR A;  2CIO A;  2YJ8 A;  1F2C A;  4PP2 E;  4P16 A;  4AXL A;  3MJ5 A;  2FRA A;  1STF E;  1AEC A;  1CTE A;  1Q6K A;  2DZZ A;  1SP4 B;  4BPV A;  5JA7 A;  4YYU A;  4MZS A;  3QT4 A;  1XKG A;  1Y08 A;  1F2B A;  4R3D A;  2G8J A;  4K7C A;  3KFQ A;  2OP3 A;  2JQG R;  3CBK A;  5JZE A;  4BQV A;  5CVN B;  2R6N A;  2NQI A;  1DEU A;  2BTW B;  3ZNH A;  3S3Q A;  1F29 A;  1POP A;  4RF1 A;  1UKF A;  2DCC A;  3K24 A;  1BP4 A;  4OEL A;  3LFY A;  4X6J A;  3D6S A;  3DF0 A;  4RY2 A;  5A24 A;  4MI7 A;  4X6I A;  1QXP A;  2FO5 A;  2DCA A;  3NHE A;  2AGA A;  3KWB X;  3N4C A;  1AYW A;  2BU3 A;  1S4V A;  3PHW A;  1MEG A;  2YJC A;  3PRM A;  4PP1 A;  5F02 A;  4Q8G A;  2FYE A;  3PBH A;  3OF9 A;  2R9N A;  2IBI A;  4Q8H A;  3KX1 A;  2AIM A;  4HXD B;  3HD3 A;  1YVB A;  3B79 A;  4FIP A;  2HH5 A;  4DMY A;  4W4U A;  2B1N A;  2DC6 A;  2FUD A;  3HHI A;  2H7J A;  4D8I A;  4IP3 A;  1THE A;  4CDE B;  2JQF R;  2VHF A;  4CDF B;  3GCB A;  3N3K A;  4IUM A;  4D8E A;  5EF4 A;  4FJC A;  5JH3 A;  1U5I A;  4CDC B;  2PNS A;  4YV8 A;  3K8U A;  4P6E A;  3MHH A;  4DMX A;  2G7Y A;  4OEM A;  3P5V A;  4HWY A;  3TNX A;  4I07 A;  3BBA A;  4BOU A;  3LXS A;  3K9M A;  1ATK A;  2Z84 A;  3OF8 A;  4G54 A;  5CHT A;  3WXF A;  4ZUX U;  1IWD A;  3PHU A;  2F1G A;  1EWO A;  1BQI A;  1TU6 A;  7PCK A;  1U9V A;  2FT2 A;  2JTC A;  3O65 A;  3N3G A;  1PE6 A;  4BS5 A;  4YVA A;  2R9F A;  2G8E A;  4RNA A;  2YJB A;  2DC8 A;  3F5V A;  2XU4 A;  1TL9 A;  2Y5B A;  4CZW A;  5CVM A;  1YK8 A;  1ZIV A;  4XZX A;  3BPM A;  2FE8 A;  3KWZ A;  1ITO A;  1VJV A;  3IHP A;  4X6H A;  3C0R A;  2ACT A;  2DJG B;  2OZ2 A;  3KKU A;  3BC3 A;  3IFU A;  1HUC B;  3RVV A;  4PI3 A;  1QOL A;  1PPP A;  3WXG A;  3BCN A;  3MTV A;  4REZ A;  5PAD A;  2XU5 A;  2NQD B;  1PVJ A;  1MS6 A;  1CSB B;  5EGW A;  1DKI A;  4OVZ A;  1CS8 A;  3ERV A;  3H7D A;  3MOR A;  2E00 A;  4GUA A;  1F2A A;  2DJF B;  2JRI A;  2J7Q C;  6PAD A;  1KHP A;  1ME3 A;  2R9M A;  1NB3 A;  3PHX A;  3H8B A;  3MP2 A;  2AU1 A;  3RVX A;  1GEC E;  5CHV A;  2UZJ A;  2AVW A;  3P5U A;  5KO3 A;  5E6J A;  3BB7 A;  1KFU L;  1K3B B;  3HHA A;  4BOS A;  1PPN A;  3P5X A;  3H8C A;  1GLO A;  4RKX A;  4YYW A;  3MTN A;  1EF7 A;  4MZO A;  3V6E A;  4D8B A;  2F7D A;  4M0W A;  4YYQ A;  1YZB A;  1ME4 A;  4WUR A;  3IUT A;  1YT7 A;  1MDW A;  2XU3 A;  3P5W A;  1PIP A;  2R9C A;  4YYR A;  3E9S A;  3BOW A;  3I06 A;  2PAD A;  3QSD A;  2FRQ A;  4A5U A;  4AXM A;  3E1Z B;  1PXV A;  3U8E A;  2FQ9 A;  2PBH A;  1PBH A;  5EZS A;  4BOQ A;  4MSX A;  1KFX L;  2CB5 A;  3OIS A;  2C0Y A;  1U9Q X;  3RVW A;  3H6S A;  1EWP A;  3HWN A;  1CJL A;  4FK5 A;  5FPW A;  4BOZ A;  2E02 A;  2BDZ A;  4XR7 A;  2XU1 A;  2ATO A;  2E03 A;  4QH6 A;  8PCH A;  4N8W A;  1CPJ A;  2WBF X;  3IOQ A;  1U9X A;  3IEJ A;  1MHW A;  4XUI A;  3TMP A;  1YAL A;  3V6C A;  2HD5 A;  1ZCM A;  4W5C A;  3BWK A;  1KXR A;  2IPP B;  1ICF A;  3CH2 X;  2DZY A;  1CV8 A;  2YJ9 A;  2HWK A;  3O0U A;  2G6D A;  4BSQ A;  3PSE A;  3WXE A;  4I04 A;  5CVO B;  3OVZ A;  2DOS A;  4QRX A;  3PRP A;  1BY8 A;  2B1M A;  4ZTB A;  3F75 A;  1NB5 A;  2BTW A;  2E01 A;  4YYV A;  4OW0 A;  2AYO A;  5K16 A;  2AS8 A;  1NL6 A;  3W31 A;  3BPF A;  4YYS A;  4N79 A;  1AU2 A;  2AUZ A;  2O6X A;  3S3R A;  1BGO A;  4MM3 B;  1CB5 A;  3KW9 A;  3MHS A;  4QRG A;  3ZUA A;  3TRK A;  4OVZ B;  1KHQ A;  1CQD A;  2P7U A;  2P86 A;  2ARY A;  1GMY A;  3OQC A;  4CDD B;  3KSE A;  4WA6 A;  2R9O A;  3I3T A;  9PAP A;  2PRE A;  4PAD A;  3PW3 A;  1VSN A;  1PPD A;  2Y6E A;  2GFO A;  3H89 A;  3RNV A;  1AIM A;  1QMY A;  2J7Q A;  3IV2 A;  1EWM A;  1NLJ A;  2YJ2 A;  1AYV A;  2DC7 A;  1SNK A;  3PT2 A;  1QDQ A;  2DCB A;  4W5B A;  2NQG A;  1MEM A;  3CBJ A;  2BDL A;  4RF0 A; 
#chains in the Genus database with same CATH homology
 4XZX A;  3BY4 A;  2FE8 A;  2AGA A;  4BOZ A;  3B21 A;  3C0R A;  2BU3 A;  3IFU A;  3PHW A;  3TMP A;  3PRM A;  3MTV A;  4REZ A;  1PVJ A;  4PT5 A;  5EZQ A;  1DKI A;  4OVZ A;  4HXD B;  2HWK A;  4GUA A;  3PSE A;  4D8I A;  2JRI A;  2J7Q C;  3W30 A;  4IP3 A;  3PHX A;  2DOS A;  3PRP A;  3MP2 A;  4IUM A;  4D8E A;  4ZTB A;  2BTW A;  4OW0 A;  2UZJ A;  3W31 A;  4BOP A;  5KO3 A;  5E6J A;  3BB7 A;  4MM3 B;  4P16 A;  3BBA A;  3MJ5 A;  4BOU A;  3TRK A;  4BOS A;  4OVZ B;  2Z84 A;  4RKX A;  3PHU A;  3OQC A;  4R3D A;  4D8B A;  4M0W A;  2JTC A;  1YZB A;  4WUR A;  5JZE A;  3O65 A;  3RNV A;  3E9S A;  2BTW B;  2J7Q A;  3ZNH A;  4RNA A;  4A5U A;  3PT2 A;  4RF1 A;  1UKF A;  5EZS A;  4BOQ A;  4MI7 A;  4RF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...