3OVXA

Cathepsin s in complex with a covalent inhibitor with an aldehyde warhead
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trifluoromethylphenyl as P2 for ketoamide-based cathepsin S inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin S
total genus 71
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3ovxA00
2YJ2A 1JQPA 9PAPA 1KFUL 2WBFX 2OZ2A 1PXVA 3RVVA 1PIPA 1IWDA 4BSQA 3WXFA 3ZUAA 5FPWA 1ITOA 4QRGA 4YYUA 2FTDA 2FUDA 2YJBA 2NQIA 4G54A 1ME3A 1K3BB 3P5VA 3HHAA 4YYQA 5EGWA 2YJ9A 1DEUA 5F02A 4BQVA 1NB3A 5A24A 2AS8A 3OF8A 2FO5A 3BWKA 1MEMA 3N3KA 3IOQA 2DZYA 3DF0A 1GMYA 4X6IA 2R9NA 1BY8A 2AYNA 3IEJA 3U8EA 4N4ZA 1DF0A 3QSDA 2AVWA 1SNKA 1VSNA 7PCKA 8PCHA 4FIPA 2YJCA 3KW9A 2DJGB 2DC6A 4XUIA 1NLJA 1STFE 1YALA 1HUCB 3OVXA 2DCCA 1VJVA 3D6SA 3B79A 1PCIA 4I07A 1AU2A 1KXRA 4QBBA 4N79A 2XU1A 2DCBA 1QOLA 3RVXA 2R9FA 2AUXA 2DCDA 3MHSA 2FYEA 4FJCA 2VHSA 2FRQA 1ZIVA 2BDLA 4MZSA 1NB5A 1YVBA 4CDDB 1O0EA 1F2AA 3QJ3A 4X6JA 1CQDA 2GFOA 2IBIA 3K8UA 1KHQA 2AIMA 4BS5A 4CDEB 4OELA 2G8EA 2BDZA 2ACTA 4DMXA 3BCNA 4I05A 3O0UA 4CZWA 2G6DA 1PPDA 1GCBA 2CIOA 2P0RA 2Y6EA 1MS6A 3WXGA 2R6NA 3IV2A 3LFYA 3I06A 3E1ZB 1CSBB 5PADA 1BP4A 3KWBX 1NPZA 3CH2X 4W5BA 4Q8GA 1POPA 2FT2A 2ARYA 1GECE 3HWNA 4QRVA 2E01A 1PE6A 1U9VA 1MEGA 2G7YA 2DC8A 3MTNA 4MSXA 4QH6A 3F5VA 1CS8A 3H7DA 2DZZA 2HD5A 4W4UA 1AECA 3CBKA 1CJLA 3CBJA 4ZUXU 2Y5BA 4YYVA 1AU3A 1F2BA 6PADA 1Y08A 2ATOA 3IMAA 3C9EA 1PBHA 3F75A 3KFQA 1AYVA 2GHUA 2R9MA 3BOWA 5EF4A 1A6RA 2XU3A 1CV8A 1EF7A 1EWPA 3H8CA 2AU1A 2YJ8A 3K9MA 1NQCA 4PI3A 3H6SA 2VHFA 1KFXL 1PPOA 3GCBA 1F29A 5JH3A 4YVAA 3H8BA 2F7DA 2B1NA 3CH3X 2AYOA 3BC3A 4X6HA 2XU5A 3P5XA 3IUTA 1ME4A 4WA6A 4PP1A 1THEA 2IPPB 2P86A 2DC9A 2OULA 1ICFA 4YYRA 4P6EA 3KSEA 1KHPA 3KX1A 3OVZA 5CVMA 1AU4A 4HWYA 3ERVA 3USVA 3NHEA 3N4CA 4CDCB 1U5IA 1QMYA 3K24A 1MDWA 1QXPA 2NQGA 1AYWA 1QDQA 1F2CA 2P7UA 1PPPA 3HHIA 2PREA 3I3TA 4YYWA 1CTEA 1MIRA 1YK8A 3HD3A 3O1GA 3V6CA 1CVZA 3TNXA 2PADA 5JA7A 2DC7A 3WXEA 1PADA 4W5CA 1YK7A 1TU6A 4QRXA 2PBHA 3OF9A 4YV8A 1EWOA 1MHWA 2G8JA 4RY2A 3PDFA 1Y4HA 1FH0A 1X9YA 3MHHA 1ATKA 1NL6A 2JQFR 4KLBA 2NQDB 2HH5A 5CHVA 1U9QX 2DCAA 2R9CA 1SP4B 2CB5A 1TL9A 2JQGR 1ZCMA 2O6XA 3KWZA 3PNRA 3BPMA 4P6GA 4BS6A 3M99A 1EWLA 5CVOB 3OISA 1AYUA 4PADA 2C0YA 1XKGA 3AI8A 4AXMA 2PNSA 2B1MA 4YYSA 1AIMA 2E00A 3MORA 2AUZA 4PP2E 2HXZA 2OP3A 1Q6KA 1U9WA 3V6EA 4MZOA 4AXLA 5CVNB 2E03A 5CHTA 1YT7A 1PPNA 3BPFA 1EWMA 3LXSA 1BQIA 1TLOA 2HHNA 3P5UA 3IHPA 3P5WA 1CB5A 1GLOA 3H89A 4Q8HA 3S3QA 2H7JA 4FK5A 1AU0A 2FQ9A 4DMYA 2DJFB 2E02A 4I04A 4XR7A 4N8WA 3QT4A 4BPVA 1BGOA 4K7CA 1CPJA 4OEMA 2XU4A 3KKUA 5J94A 3PW3A 4CDFB 2FRAA 3RVWA 3PBHA 1M6DA 1U9XA 2R9OA 2NQAA 3S3RA 2F1GA 1S4VA 5K16A 3N3GA
chains in the Genus database with same CATH superfamily
2YJ2A 1JQPA 9PAPA 1KFUL 2WBFX 4OVZA 2OZ2A 1PXVA 3RVVA 1PIPA 1IWDA 4BSQA 3W30A 3WXFA 2JTCA 3BY4A 3ZUAA 5FPWA 4WURA 1ITOA 4QRGA 4BOSA 2FTDA 2FUDA 4YYUA 4BOPA 3E9SA 2YJBA 2NQIA 4G54A 1ME3A 1K3BB 3P5VA 3HHAA 2DOSA 4YYQA 5EGWA 2YJ9A 1DEUA 5F02A 4BQVA 1NB3A 5A24A 2AS8A 3OF8A 3OQCA 2FO5A 3BWKA 1MEMA 3N3KA 2UZJA 3IOQA 2DZYA 3DF0A 1GMYA 4REZA 4X6IA 2R9NA 1BY8A 2AYNA 3IEJA 3U8EA 4N4ZA 1DF0A 5EZSA 3QSDA 2AVWA 1SNKA 1VSNA 7PCKA 8PCHA 4FIPA 2YJCA 4MM3B 3KW9A 4D8EA 2DJGB 2DC6A 4XUIA 1NLJA 1STFE 1YALA 1HUCB 3OVXA 2DCCA 1VJVA 3D6SA 3B79A 1PCIA 4I07A 1AU2A 1DKIA 1KXRA 4QBBA 4N79A 2XU1A 2DCBA 1QOLA 3RVXA 2R9FA 2AUXA 2DCDA 3MJ5A 3MHSA 2FYEA 4FJCA 2AGAA 2VHSA 2FRQA 1ZIVA 3B21A 2BDLA 1UKFA 4MZSA 1NB5A 1YVBA 3TRKA 4CDDB 1O0EA 1F2AA 3O65A 3QJ3A 4X6JA 1CQDA 2GFOA 2IBIA 3K8UA 1KHQA 4RF1A 4P16A 2AIMA 4BS5A 4CDEB 4OELA 2G8EA 2BDZA 2HWKA 3PHXA 2FE8A 4M0WA 2ACTA 4DMXA 3BCNA 4I05A 3O0UA 4CZWA 2G6DA 1PPDA 1GCBA 2CIOA 2P0RA 2Y6EA 4RNAA 1YZBA 1MS6A 4IP3A 3ZNHA 3WXGA 2R6NA 3IV2A 3LFYA 3I06A 3E1ZB 2BU3A 4HXDB 3MTVA 1CSBB 5PADA 1BP4A 3KWBX 1NPZA 3CH2X 4W5BA 4Q8GA 1POPA 2FT2A 3PRPA 2ARYA 1GECE 3HWNA 4QRVA 4BOUA 2E01A 1PE6A 1U9VA 1MEGA 2G7YA 2DC8A 3MTNA 4MSXA 4QH6A 3F5VA 1CS8A 3H7DA 2DZZA 2HD5A 4W4UA 1AECA 3CBKA 1CJLA 2JRIA 3CBJA 4ZUXU 2Y5BA 4YYVA 3RNVA 1AU3A 1F2BA 6PADA 1Y08A 2ATOA 3IMAA 3C9EA 4RF0A 1PBHA 3F75A 3KFQA 1AYVA 2GHUA 2R9MA 3BOWA 4RKXA 5EF4A 4BOQA 1A6RA 2XU3A 1CV8A 1EF7A 1EWPA 3H8CA 2AU1A 4R3DA 2YJ8A 3K9MA 1NQCA 4PI3A 3H6SA 2VHFA 1KFXL 1PPOA 3GCBA 1F29A 5JH3A 4YVAA 3H8BA 3W31A 2F7DA 2B1NA 3CH3X 2AYOA 3BC3A 4X6HA 2XU5A 3P5XA 3IUTA 4MI7A 1ME4A 4WA6A 4PP1A 1THEA 2IPPB 2P86A 2DC9A 2OULA 1ICFA 4YYRA 4P6EA 3KSEA 1KHPA 3KX1A 3OVZA 5CVMA 1AU4A 4HWYA 3ERVA 3USVA 3NHEA 3N4CA 2Z84A 4CDCB 1U5IA 1QMYA 3PHUA 3K24A 3IFUA 4D8BA 4ZTBA 2J7QC 1MDWA 1QXPA 2NQGA 1AYWA 1QDQA 1F2CA 2P7UA 1PPPA 3HHIA 2PREA 3I3TA 4YYWA 1CTEA 1MIRA 1YK8A 3HD3A 3O1GA 3V6CA 1CVZA 3TNXA 2PADA 5JA7A 2DC7A 3WXEA 1PADA 4W5CA 1YK7A 1TU6A 4QRXA 5EZQA 2BTWB 2PBHA 3OF9A 4YV8A 1EWOA 1MHWA 4OVZB 3PT2A 2G8JA 4RY2A 3PDFA 1Y4HA 1FH0A 1X9YA 3MHHA 1ATKA 3PHWA 1NL6A 2JQFR 4KLBA 2NQDB 2HH5A 5CHVA 1U9QX 2DCAA 2R9CA 1SP4B 2CB5A 1TL9A 2JQGR 1ZCMA 2O6XA 3KWZA 3PNRA 3BPMA 4P6GA 4BS6A 3M99A 4XZXA 1EWLA 5CVOB 3OISA 1AYUA 3TMPA 1PVJA 4PADA 2C0YA 1XKGA 3AI8A 4AXMA 2PNSA 2B1MA 4YYSA 1AIMA 4IUMA 3C0RA 2E00A 3MORA 2AUZA 4PP2E 4PT5A 2HXZA 5KO3A 2OP3A 1Q6KA 1U9WA 3V6EA 4D8IA 4MZOA 4AXLA 5CVNB 3MP2A 2E03A 5CHTA 1YT7A 4OW0A 1PPNA 3BPFA 1EWMA 3BBAA 3PSEA 3PRMA 3LXSA 1BQIA 1TLOA 2HHNA 3P5UA 3IHPA 3P5WA 1CB5A 1GLOA 3H89A 4Q8HA 3S3QA 4A5UA 2H7JA 4FK5A 1AU0A 2FQ9A 4DMYA 2DJFB 2E02A 4I04A 4XR7A 4N8WA 3QT4A 4BPVA 1BGOA 4K7CA 2J7QA 1CPJA 4OEMA 2XU4A 2BTWA 3KKUA 4GUAA 5J94A 3PW3A 4CDFB 2FRAA 3RVWA 3PBHA 1M6DA 1U9XA 2R9OA 2NQAA 4BOZA 3S3RA 5JZEA 2F1GA 3BB7A 1S4VA 5K16A 3N3GA 5E6JA
chains in the Genus database with same CATH topology
2YJ2A 1JQPA 9PAPA 1KFUL 2WBFX 2OZ2A 1PXVA 3RVVA 1PIPA 1IWDA 4BSQA 3WXFA 3ZUAA 5FPWA 1ITOA 4QRGA 4YYUA 2FTDA 2FUDA 1W6FA 2YJBA 2NQIA 4G54A 1ME3A 1K3BB 3P5VA 4NV7A 3HHAA 4NV8A 4YYQA 2VFCA 5EGWA 2YJ9A 1DEUA 5F02A 4BQVA 1NB3A 5A24A 2AS8A 3OF8A 2FO5A 3BWKA 1MEMA 3N3KA 3IOQA 2DZYA 3DF0A 1GMYA 4X6IA 2R9NA 1BY8A 2AYNA 3IEJA 4C5PA 3U8EA 4N4ZA 1DF0A 3QSDA 2AVWA 1SNKA 1VSNA 7PCKA 8PCHA 4FIPA 2YJCA 3KW9A 2DJGB 2DC6A 4XUIA 1NLJA 1STFE 1YALA 1HUCB 3OVXA 2DCCA 1VJVA 3D6SA 3B79A 1PCIA 4I07A 1AU2A 1KXRA 4QBBA 4N79A 2XU1A 2DCBA 1QOLA 3RVXA 2R9FA 2AUXA 2DCDA 1GX3A 3MHSA 2FYEA 4FJCA 2VHSA 2FRQA 1ZIVA 2BDLA 4MZSA 1NB5A 1YVBA 4CDDB 1O0EA 1F2AA 3QJ3A 4X6JA 1W5RA 1CQDA 2GFOA 2IBIA 3K8UA 2BSZA 1KHQA 2AIMA 4BS5A 4CDEB 4OELA 2G8EA 2BDZA 2ACTA 4DMXA 3BCNA 4I05A 3O0UA 4CZWA 2G6DA 1PPDA 1GCBA 2CIOA 2P0RA 2Y6EA 1MS6A 3WXGA 2R6NA 3IV2A 3LFYA 3I06A 3E1ZB 1CSBB 5PADA 1BP4A 3KWBX 1NPZA 3CH2X 4W5BA 4Q8GA 1POPA 2FT2A 2ARYA 1GECE 3HWNA 4QRVA 2E01A 1PE6A 1U9VA 1MEGA 2G7YA 2DC8A 3MTNA 4MSXA 4QH6A 3F5VA 1CS8A 3H7DA 2DZZA 2HD5A 4W4UA 1AECA 3CBKA 1CJLA 3CBJA 4ZUXU 2Y5BA 4YYVA 1AU3A 3LTWA 1F2BA 6PADA 1Y08A 2ATOA 3IMAA 3C9EA 1PBHA 3F75A 3KFQA 1AYVA 2GHUA 2R9MA 3BOWA 5EF4A 1A6RA 4GUZA 2XU3A 1CV8A 1EF7A 1EWPA 3H8CA 2AU1A 2YJ8A 3K9MA 1NQCA 4PI3A 3H6SA 2VHFA 1KFXL 1PPOA 3GCBA 1F29A 5JH3A 4YVAA 3H8BA 2F7DA 2B1NA 3D9WA 4BGFA 3CH3X 2AYOA 3BC3A 4X6HA 2XU5A 3P5XA 3IUTA 1ME4A 4WA6A 4PP1A 1THEA 2IPPB 2P86A 2DC9A 2OULA 1ICFA 4YYRA 4P6EA 3KSEA 1KHPA 3KX1A 3OVZA 5CVMA 1AU4A 4HWYA 3ERVA 3USVA 3NHEA 3N4CA 4CDCB 1U5IA 1QMYA 3K24A 1MDWA 1QXPA 2NQGA 1AYWA 1QDQA 1F2CA 2P7UA 1PPPA 3HHIA 2PREA 3I3TA 4YYWA 1CTEA 1MIRA 1YK8A 3HD3A 3O1GA 3V6CA 1CVZA 3TNXA 1W4TA 2PADA 5JA7A 2DC7A 3WXEA 1PADA 4W5CA 1YK7A 1TU6A 4QRXA 2PBHA 3OF9A 4YV8A 1EWOA 1MHWA 2G8JA 4RY2A 3PDFA 1Y4HA 1FH0A 1X9YA 1E2TA 3MHHA 1ATKA 1NL6A 2JQFR 4KLBA 2NQDB 2HH5A 5CHVA 1U9QX 2DCAA 2R9CA 1SP4B 2CB5A 1TL9A 2JQGR 1ZCMA 2O6XA 3KWZA 3PNRA 3BPMA 4P6GA 4BS6A 3M99A 1EWLA 5CVOB 3OISA 1AYUA 4PADA 2C0YA 1XKGA 3AI8A 4AXMA 2PNSA 2B1MA 4YYSA 1AIMA 2E00A 3MORA 2AUZA 4PP2E 2HXZA 2OP3A 1Q6KA 1U9WA 3V6EA 4MZOA 4AXLA 5CVNB 2E03A 5CHTA 1YT7A 1PPNA 3BPFA 1EWMA 3LXSA 1BQIA 1TLOA 2HHNA 3P5UA 3IHPA 3P5WA 1CB5A 1GLOA 3H89A 4Q8HA 3S3QA 2H7JA 4FK5A 1AU0A 2FQ9A 4DMYA 2DJFB 2E02A 4B55A 4I04A 4XR7A 4N8WA 3QT4A 4BPVA 1BGOA 4K7CA 1CPJA 4OEMA 2XU4A 3KKUA 5J94A 3PW3A 4CDFB 2FRAA 3RVWA 3PBHA 1M6DA 1U9XA 2R9OA 2NQAA 3S3RA 2F1GA 2VFBA 1S4VA 5K16A 3N3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YJ2 A;  1JQP A;  9PAP A;  1KFU L;  2WBF X;  2OZ2 A;  1PXV A;  3RVV A;  1PIP A;  1IWD A;  4BSQ A;  3WXF A;  3ZUA A;  5FPW A;  1ITO A;  4QRG A;  4YYU A;  2FTD A;  2FUD A;  2YJB A;  2NQI A;  4G54 A;  1ME3 A;  1K3B B;  3P5V A;  3HHA A;  4YYQ A;  5EGW A;  2YJ9 A;  1DEU A;  5F02 A;  4BQV A;  1NB3 A;  5A24 A;  2AS8 A;  3OF8 A;  2FO5 A;  3BWK A;  1MEM A;  3N3K A;  3IOQ A;  2DZY A;  3DF0 A;  1GMY A;  4X6I A;  2R9N A;  1BY8 A;  2AYN A;  3IEJ A;  3U8E A;  4N4Z A;  1DF0 A;  3QSD A;  2AVW A;  1SNK A;  1VSN A;  7PCK A;  8PCH A;  4FIP A;  2YJC A;  3KW9 A;  2DJG B;  2DC6 A;  4XUI A;  1NLJ A;  1STF E;  1YAL A;  1HUC B;  3OVX A;  2DCC A;  1VJV A;  3D6S A;  3B79 A;  1PCI A;  4I07 A;  1AU2 A;  1KXR A;  4QBB A;  4N79 A;  2XU1 A;  2DCB A;  1QOL A;  3RVX A;  2R9F A;  2AUX A;  2DCD A;  3MHS A;  2FYE A;  4FJC A;  2VHS A;  2FRQ A;  1ZIV A;  2BDL A;  4MZS A;  1NB5 A;  1YVB A;  4CDD B;  1O0E A;  1F2A A;  3QJ3 A;  4X6J A;  1CQD A;  2GFO A;  2IBI A;  3K8U A;  1KHQ A;  2AIM A;  4BS5 A;  4CDE B;  4OEL A;  2G8E A;  2BDZ A;  2ACT A;  4DMX A;  3BCN A;  4I05 A;  3O0U A;  4CZW A;  2G6D A;  1PPD A;  1GCB A;  2CIO A;  2P0R A;  2Y6E A;  1MS6 A;  3WXG A;  2R6N A;  3IV2 A;  3LFY A;  3I06 A;  3E1Z B;  1CSB B;  5PAD A;  1BP4 A;  3KWB X;  1NPZ A;  3CH2 X;  4W5B A;  4Q8G A;  1POP A;  2FT2 A;  2ARY A;  1GEC E;  3HWN A;  4QRV A;  2E01 A;  1PE6 A;  1U9V A;  1MEG A;  2G7Y A;  2DC8 A;  3MTN A;  4MSX A;  4QH6 A;  3F5V A;  1CS8 A;  3H7D A;  2DZZ A;  2HD5 A;  4W4U A;  1AEC A;  3CBK A;  1CJL A;  3CBJ A;  4ZUX U;  2Y5B A;  4YYV A;  1AU3 A;  1F2B A;  6PAD A;  1Y08 A;  2ATO A;  3IMA A;  3C9E A;  1PBH A;  3F75 A;  3KFQ A;  1AYV A;  2GHU A;  2R9M A;  3BOW A;  5EF4 A;  1A6R A;  2XU3 A;  1CV8 A;  1EF7 A;  1EWP A;  3H8C A;  2AU1 A;  2YJ8 A;  3K9M A;  1NQC A;  4PI3 A;  3H6S A;  2VHF A;  1KFX L;  1PPO A;  3GCB A;  1F29 A;  5JH3 A;  4YVA A;  3H8B A;  2F7D A;  2B1N A;  3CH3 X;  2AYO A;  3BC3 A;  4X6H A;  2XU5 A;  3P5X A;  3IUT A;  1ME4 A;  4WA6 A;  4PP1 A;  1THE A;  2IPP B;  2P86 A;  2DC9 A;  2OUL A;  1ICF A;  4YYR A;  4P6E A;  3KSE A;  1KHP A;  3KX1 A;  3OVZ A;  5CVM A;  1AU4 A;  4HWY A;  3ERV A;  3USV A;  3NHE A;  3N4C A;  4CDC B;  1U5I A;  1QMY A;  3K24 A;  1MDW A;  1QXP A;  2NQG A;  1AYW A;  1QDQ A;  1F2C A;  2P7U A;  1PPP A;  3HHI A;  2PRE A;  3I3T A;  4YYW A;  1CTE A;  1MIR A;  1YK8 A;  3HD3 A;  3O1G A;  3V6C A;  1CVZ A;  3TNX A;  2PAD A;  5JA7 A;  2DC7 A;  3WXE A;  1PAD A;  4W5C A;  1YK7 A;  1TU6 A;  4QRX A;  2PBH A;  3OF9 A;  4YV8 A;  1EWO A;  1MHW A;  2G8J A;  4RY2 A;  3PDF A;  1Y4H A;  1FH0 A;  1X9Y A;  3MHH A;  1ATK A;  1NL6 A;  2JQF R;  4KLB A;  2NQD B;  2HH5 A;  5CHV A;  1U9Q X;  2DCA A;  2R9C A;  1SP4 B;  2CB5 A;  1TL9 A;  2JQG R;  1ZCM A;  2O6X A;  3KWZ A;  3PNR A;  3BPM A;  4P6G A;  4BS6 A;  3M99 A;  1EWL A;  5CVO B;  3OIS A;  1AYU A;  4PAD A;  2C0Y A;  1XKG A;  3AI8 A;  4AXM A;  2PNS A;  2B1M A;  4YYS A;  1AIM A;  2E00 A;  3MOR A;  2AUZ A;  4PP2 E;  2HXZ A;  2OP3 A;  1Q6K A;  1U9W A;  3V6E A;  4MZO A;  4AXL A;  5CVN B;  2E03 A;  5CHT A;  1YT7 A;  1PPN A;  3BPF A;  1EWM A;  3LXS A;  1BQI A;  1TLO A;  2HHN A;  3P5U A;  3IHP A;  3P5W A;  1CB5 A;  1GLO A;  3H89 A;  4Q8H A;  3S3Q A;  2H7J A;  4FK5 A;  1AU0 A;  2FQ9 A;  4DMY A;  2DJF B;  2E02 A;  4I04 A;  4XR7 A;  4N8W A;  3QT4 A;  4BPV A;  1BGO A;  4K7C A;  1CPJ A;  4OEM A;  2XU4 A;  3KKU A;  5J94 A;  3PW3 A;  4CDF B;  2FRA A;  3RVW A;  3PBH A;  1M6D A;  1U9X A;  2R9O A;  2NQA A;  3S3R A;  2F1G A;  1S4V A;  5K16 A;  3N3G A; 
#chains in the Genus database with same CATH topology
 2YJ2 A;  1JQP A;  9PAP A;  1KFU L;  2WBF X;  4OVZ A;  2OZ2 A;  1PXV A;  3RVV A;  1PIP A;  1IWD A;  4BSQ A;  3W30 A;  3WXF A;  2JTC A;  3BY4 A;  3ZUA A;  5FPW A;  4WUR A;  1ITO A;  4QRG A;  4BOS A;  2FTD A;  2FUD A;  4YYU A;  4BOP A;  3E9S A;  2YJB A;  2NQI A;  4G54 A;  1ME3 A;  1K3B B;  3P5V A;  3HHA A;  2DOS A;  4YYQ A;  5EGW A;  2YJ9 A;  1DEU A;  5F02 A;  4BQV A;  1NB3 A;  5A24 A;  2AS8 A;  3OF8 A;  3OQC A;  2FO5 A;  3BWK A;  1MEM A;  3N3K A;  2UZJ A;  3IOQ A;  2DZY A;  3DF0 A;  1GMY A;  4REZ A;  4X6I A;  2R9N A;  1BY8 A;  2AYN A;  3IEJ A;  3U8E A;  4N4Z A;  1DF0 A;  5EZS A;  3QSD A;  2AVW A;  1SNK A;  1VSN A;  7PCK A;  8PCH A;  4FIP A;  2YJC A;  4MM3 B;  3KW9 A;  4D8E A;  2DJG B;  2DC6 A;  4XUI A;  1NLJ A;  1STF E;  1YAL A;  1HUC B;  3OVX A;  2DCC A;  1VJV A;  3D6S A;  3B79 A;  1PCI A;  4I07 A;  1AU2 A;  1DKI A;  1KXR A;  4QBB A;  4N79 A;  2XU1 A;  2DCB A;  1QOL A;  3RVX A;  2R9F A;  2AUX A;  2DCD A;  3MJ5 A;  3MHS A;  2FYE A;  4FJC A;  2AGA A;  2VHS A;  2FRQ A;  1ZIV A;  3B21 A;  2BDL A;  1UKF A;  4MZS A;  1NB5 A;  1YVB A;  3TRK A;  4CDD B;  1O0E A;  1F2A A;  3O65 A;  3QJ3 A;  4X6J A;  1CQD A;  2GFO A;  2IBI A;  3K8U A;  1KHQ A;  4RF1 A;  4P16 A;  2AIM A;  4BS5 A;  4CDE B;  4OEL A;  2G8E A;  2BDZ A;  2HWK A;  3PHX A;  2FE8 A;  4M0W A;  2ACT A;  4DMX A;  3BCN A;  4I05 A;  3O0U A;  4CZW A;  2G6D A;  1PPD A;  1GCB A;  2CIO A;  2P0R A;  2Y6E A;  4RNA A;  1YZB A;  1MS6 A;  4IP3 A;  3ZNH A;  3WXG A;  2R6N A;  3IV2 A;  3LFY A;  3I06 A;  3E1Z B;  2BU3 A;  4HXD B;  3MTV A;  1CSB B;  5PAD A;  1BP4 A;  3KWB X;  1NPZ A;  3CH2 X;  4W5B A;  4Q8G A;  1POP A;  2FT2 A;  3PRP A;  2ARY A;  1GEC E;  3HWN A;  4QRV A;  4BOU A;  2E01 A;  1PE6 A;  1U9V A;  1MEG A;  2G7Y A;  2DC8 A;  3MTN A;  4MSX A;  4QH6 A;  3F5V A;  1CS8 A;  3H7D A;  2DZZ A;  2HD5 A;  4W4U A;  1AEC A;  3CBK A;  1CJL A;  2JRI A;  3CBJ A;  4ZUX U;  2Y5B A;  4YYV A;  3RNV A;  1AU3 A;  1F2B A;  6PAD A;  1Y08 A;  2ATO A;  3IMA A;  3C9E A;  4RF0 A;  1PBH A;  3F75 A;  3KFQ A;  1AYV A;  2GHU A;  2R9M A;  3BOW A;  4RKX A;  5EF4 A;  4BOQ A;  1A6R A;  2XU3 A;  1CV8 A;  1EF7 A;  1EWP A;  3H8C A;  2AU1 A;  4R3D A;  2YJ8 A;  3K9M A;  1NQC A;  4PI3 A;  3H6S A;  2VHF A;  1KFX L;  1PPO A;  3GCB A;  1F29 A;  5JH3 A;  4YVA A;  3H8B A;  3W31 A;  2F7D A;  2B1N A;  3CH3 X;  2AYO A;  3BC3 A;  4X6H A;  2XU5 A;  3P5X A;  3IUT A;  4MI7 A;  1ME4 A;  4WA6 A;  4PP1 A;  1THE A;  2IPP B;  2P86 A;  2DC9 A;  2OUL A;  1ICF A;  4YYR A;  4P6E A;  3KSE A;  1KHP A;  3KX1 A;  3OVZ A;  5CVM A;  1AU4 A;  4HWY A;  3ERV A;  3USV A;  3NHE A;  3N4C A;  2Z84 A;  4CDC B;  1U5I A;  1QMY A;  3PHU A;  3K24 A;  3IFU A;  4D8B A;  4ZTB A;  2J7Q C;  1MDW A;  1QXP A;  2NQG A;  1AYW A;  1QDQ A;  1F2C A;  2P7U A;  1PPP A;  3HHI A;  2PRE A;  3I3T A;  4YYW A;  1CTE A;  1MIR A;  1YK8 A;  3HD3 A;  3O1G A;  3V6C A;  1CVZ A;  3TNX A;  2PAD A;  5JA7 A;  2DC7 A;  3WXE A;  1PAD A;  4W5C A;  1YK7 A;  1TU6 A;  4QRX A;  5EZQ A;  2BTW B;  2PBH A;  3OF9 A;  4YV8 A;  1EWO A;  1MHW A;  4OVZ B;  3PT2 A;  2G8J A;  4RY2 A;  3PDF A;  1Y4H A;  1FH0 A;  1X9Y A;  3MHH A;  1ATK A;  3PHW A;  1NL6 A;  2JQF R;  4KLB A;  2NQD B;  2HH5 A;  5CHV A;  1U9Q X;  2DCA A;  2R9C A;  1SP4 B;  2CB5 A;  1TL9 A;  2JQG R;  1ZCM A;  2O6X A;  3KWZ A;  3PNR A;  3BPM A;  4P6G A;  4BS6 A;  3M99 A;  4XZX A;  1EWL A;  5CVO B;  3OIS A;  1AYU A;  3TMP A;  1PVJ A;  4PAD A;  2C0Y A;  1XKG A;  3AI8 A;  4AXM A;  2PNS A;  2B1M A;  4YYS A;  1AIM A;  4IUM A;  3C0R A;  2E00 A;  3MOR A;  2AUZ A;  4PP2 E;  4PT5 A;  2HXZ A;  5KO3 A;  2OP3 A;  1Q6K A;  1U9W A;  3V6E A;  4D8I A;  4MZO A;  4AXL A;  5CVN B;  3MP2 A;  2E03 A;  5CHT A;  1YT7 A;  4OW0 A;  1PPN A;  3BPF A;  1EWM A;  3BBA A;  3PSE A;  3PRM A;  3LXS A;  1BQI A;  1TLO A;  2HHN A;  3P5U A;  3IHP A;  3P5W A;  1CB5 A;  1GLO A;  3H89 A;  4Q8H A;  3S3Q A;  4A5U A;  2H7J A;  4FK5 A;  1AU0 A;  2FQ9 A;  4DMY A;  2DJF B;  2E02 A;  4I04 A;  4XR7 A;  4N8W A;  3QT4 A;  4BPV A;  1BGO A;  4K7C A;  2J7Q A;  1CPJ A;  4OEM A;  2XU4 A;  2BTW A;  3KKU A;  4GUA A;  5J94 A;  3PW3 A;  4CDF B;  2FRA A;  3RVW A;  3PBH A;  1M6D A;  1U9X A;  2R9O A;  2NQA A;  4BOZ A;  3S3R A;  5JZE A;  2F1G A;  3BB7 A;  1S4V A;  5K16 A;  3N3G A;  5E6J A; 
#chains in the Genus database with same CATH homology
 2YJ2 A;  1JQP A;  9PAP A;  1KFU L;  2WBF X;  2OZ2 A;  1PXV A;  3RVV A;  1PIP A;  1IWD A;  4BSQ A;  3WXF A;  3ZUA A;  5FPW A;  1ITO A;  4QRG A;  4YYU A;  2FTD A;  2FUD A;  1W6F A;  2YJB A;  2NQI A;  4G54 A;  1ME3 A;  1K3B B;  3P5V A;  4NV7 A;  3HHA A;  4NV8 A;  4YYQ A;  2VFC A;  5EGW A;  2YJ9 A;  1DEU A;  5F02 A;  4BQV A;  1NB3 A;  5A24 A;  2AS8 A;  3OF8 A;  2FO5 A;  3BWK A;  1MEM A;  3N3K A;  3IOQ A;  2DZY A;  3DF0 A;  1GMY A;  4X6I A;  2R9N A;  1BY8 A;  2AYN A;  3IEJ A;  4C5P A;  3U8E A;  4N4Z A;  1DF0 A;  3QSD A;  2AVW A;  1SNK A;  1VSN A;  7PCK A;  8PCH A;  4FIP A;  2YJC A;  3KW9 A;  2DJG B;  2DC6 A;  4XUI A;  1NLJ A;  1STF E;  1YAL A;  1HUC B;  3OVX A;  2DCC A;  1VJV A;  3D6S A;  3B79 A;  1PCI A;  4I07 A;  1AU2 A;  1KXR A;  4QBB A;  4N79 A;  2XU1 A;  2DCB A;  1QOL A;  3RVX A;  2R9F A;  2AUX A;  2DCD A;  1GX3 A;  3MHS A;  2FYE A;  4FJC A;  2VHS A;  2FRQ A;  1ZIV A;  2BDL A;  4MZS A;  1NB5 A;  1YVB A;  4CDD B;  1O0E A;  1F2A A;  3QJ3 A;  4X6J A;  1W5R A;  1CQD A;  2GFO A;  2IBI A;  3K8U A;  2BSZ A;  1KHQ A;  2AIM A;  4BS5 A;  4CDE B;  4OEL A;  2G8E A;  2BDZ A;  2ACT A;  4DMX A;  3BCN A;  4I05 A;  3O0U A;  4CZW A;  2G6D A;  1PPD A;  1GCB A;  2CIO A;  2P0R A;  2Y6E A;  1MS6 A;  3WXG A;  2R6N A;  3IV2 A;  3LFY A;  3I06 A;  3E1Z B;  1CSB B;  5PAD A;  1BP4 A;  3KWB X;  1NPZ A;  3CH2 X;  4W5B A;  4Q8G A;  1POP A;  2FT2 A;  2ARY A;  1GEC E;  3HWN A;  4QRV A;  2E01 A;  1PE6 A;  1U9V A;  1MEG A;  2G7Y A;  2DC8 A;  3MTN A;  4MSX A;  4QH6 A;  3F5V A;  1CS8 A;  3H7D A;  2DZZ A;  2HD5 A;  4W4U A;  1AEC A;  3CBK A;  1CJL A;  3CBJ A;  4ZUX U;  2Y5B A;  4YYV A;  1AU3 A;  3LTW A;  1F2B A;  6PAD A;  1Y08 A;  2ATO A;  3IMA A;  3C9E A;  1PBH A;  3F75 A;  3KFQ A;  1AYV A;  2GHU A;  2R9M A;  3BOW A;  5EF4 A;  1A6R A;  4GUZ A;  2XU3 A;  1CV8 A;  1EF7 A;  1EWP A;  3H8C A;  2AU1 A;  2YJ8 A;  3K9M A;  1NQC A;  4PI3 A;  3H6S A;  2VHF A;  1KFX L;  1PPO A;  3GCB A;  1F29 A;  5JH3 A;  4YVA A;  3H8B A;  2F7D A;  2B1N A;  3D9W A;  4BGF A;  3CH3 X;  2AYO A;  3BC3 A;  4X6H A;  2XU5 A;  3P5X A;  3IUT A;  1ME4 A;  4WA6 A;  4PP1 A;  1THE A;  2IPP B;  2P86 A;  2DC9 A;  2OUL A;  1ICF A;  4YYR A;  4P6E A;  3KSE A;  1KHP A;  3KX1 A;  3OVZ A;  5CVM A;  1AU4 A;  4HWY A;  3ERV A;  3USV A;  3NHE A;  3N4C A;  4CDC B;  1U5I A;  1QMY A;  3K24 A;  1MDW A;  1QXP A;  2NQG A;  1AYW A;  1QDQ A;  1F2C A;  2P7U A;  1PPP A;  3HHI A;  2PRE A;  3I3T A;  4YYW A;  1CTE A;  1MIR A;  1YK8 A;  3HD3 A;  3O1G A;  3V6C A;  1CVZ A;  3TNX A;  1W4T A;  2PAD A;  5JA7 A;  2DC7 A;  3WXE A;  1PAD A;  4W5C A;  1YK7 A;  1TU6 A;  4QRX A;  2PBH A;  3OF9 A;  4YV8 A;  1EWO A;  1MHW A;  2G8J A;  4RY2 A;  3PDF A;  1Y4H A;  1FH0 A;  1X9Y A;  1E2T A;  3MHH A;  1ATK A;  1NL6 A;  2JQF R;  4KLB A;  2NQD B;  2HH5 A;  5CHV A;  1U9Q X;  2DCA A;  2R9C A;  1SP4 B;  2CB5 A;  1TL9 A;  2JQG R;  1ZCM A;  2O6X A;  3KWZ A;  3PNR A;  3BPM A;  4P6G A;  4BS6 A;  3M99 A;  1EWL A;  5CVO B;  3OIS A;  1AYU A;  4PAD A;  2C0Y A;  1XKG A;  3AI8 A;  4AXM A;  2PNS A;  2B1M A;  4YYS A;  1AIM A;  2E00 A;  3MOR A;  2AUZ A;  4PP2 E;  2HXZ A;  2OP3 A;  1Q6K A;  1U9W A;  3V6E A;  4MZO A;  4AXL A;  5CVN B;  2E03 A;  5CHT A;  1YT7 A;  1PPN A;  3BPF A;  1EWM A;  3LXS A;  1BQI A;  1TLO A;  2HHN A;  3P5U A;  3IHP A;  3P5W A;  1CB5 A;  1GLO A;  3H89 A;  4Q8H A;  3S3Q A;  2H7J A;  4FK5 A;  1AU0 A;  2FQ9 A;  4DMY A;  2DJF B;  2E02 A;  4B55 A;  4I04 A;  4XR7 A;  4N8W A;  3QT4 A;  4BPV A;  1BGO A;  4K7C A;  1CPJ A;  4OEM A;  2XU4 A;  3KKU A;  5J94 A;  3PW3 A;  4CDF B;  2FRA A;  3RVW A;  3PBH A;  1M6D A;  1U9X A;  2R9O A;  2NQA A;  3S3R A;  2F1G A;  2VFB A;  1S4V A;  5K16 A;  3N3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...