3OVXA

Cathepsin s in complex with a covalent inhibitor with an aldehyde warhead
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
217
structure length
217
Chain Sequence
b'LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin S
publication title Trifluoromethylphenyl as P2 for ketoamide-based cathepsin S inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 71
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3ovxA00
1U5IA 4KLBA 2R6NA 2PBHA 4X6JA 8PCHA 3BPFA 2FRAA 1GMYA 3P5VA 2NQGA 4PADA 2DCBA 3H7DA 2O6XA 2R9MA 3HHAA 3N4CA 4MZSA 1Q6KA 1BY8A 2AU1A 3KWBX 1JQPA 3MORA 4XR7A 2BDZA 9PAPA 2VHFA 3CH2X 4YVAA 3H89A 3IV2A 3MHHA 2PREA 1NB5A 1YVBA 4YYSA 2B1NA 3IUTA 1SP4B 4WA6A 3K8UA 5CVOB 2CB5A 1U9QX 1QXPA 2E03A 2WBFX 4YYWA 4CZWA 3KW9A 2XU1A 3H8BA 1CQDA 3AI8A 5EGWA 1EWOA 1GLOA 1NQCA 1KFUL 2AS8A 4YYUA 2E00A 2DC6A 1F2AA 3K24A 3MTNA 3BOWA 3OF9A 2FTDA 3KWZA 2DC7A 2DZZA 2HH5A 3WXEA 1CV8A 2XU4A 1GECE 1DEUA 4I05A 1AECA 2FT2A 2AYNA 2NQDB 4AXLA 2DC8A 3KX1A 4BS5A 4QRGA 4YYVA 1SNKA 2HD5A 2P0RA 1QMYA 1EWMA 4Q8HA 5FPWA 3KFQA 2ARYA 2YJ8A 1U9WA 4I07A 3N3KA 2XU3A 2OZ2A 1MDWA 1X9YA 1BP4A 3I3TA 3OVXA 1ME3A 3WXGA 3USVA 2PNSA 1ITOA 4FK5A 3B79A 1KHQA 1U9VA 2Y6EA 3V6EA 3O0UA 3BCNA 2VHSA 1O0EA 2Y5BA 1MS6A 4DMYA 3CH3X 2CIOA 1K3BB 1ICFA 2G8EA 2DJGB 2FYEA 4RY2A 1MEMA 1ME4A 2DC9A 1YT7A 1POPA 4BSQA 4QRVA 1F29A 4DMXA 1AYWA 3HWNA 4PP2E 7PCKA 1YALA 2GHUA 2P86A 1PPOA 2YJ9A 3MHSA 2ATOA 4X6HA 3CBJA 3BPMA 3O1GA 1NLJA 2DCAA 3F5VA 3E1ZB 4CDFB 2R9OA 4N79A 3BWKA 3H8CA 4W4UA 3F75A 5CVMA 3BC3A 1NB3A 1PBHA 4W5BA 1CTEA 4QH6A 1CVZA 4X6IA 4P6EA 1AIMA 1TU6A 1ZIVA 2DCCA 1CB5A 3QSDA 5J94A 2BDLA 2PADA 1EF7A 1PCIA 2NQAA 1QDQA 1DF0A 3S3RA 3I06A 2JQGR 2FQ9A 3NHEA 1MIRA 2IBIA 2G7YA 1AU0A 1IWDA 4CDCB 3V6CA 5EF4A 1AYVA 2R9NA 3QT4A 1Y08A 4YYQA 3OISA 1KHPA 2R9CA 3PBHA 2OULA 3PNRA 5CHVA 2C0YA 5CHTA 4ZUXU 2GFOA 3GCBA 4HWYA 1YK7A 3KSEA 4I04A 1KFXL 4PI3A 4BS6A 1NPZA 1ZCMA 1TLOA 5F02A 3IHPA 4P6GA 4AXMA 3S3QA 2AUXA 3HD3A 4PP1A 2B1MA 4N8WA 4MSXA 4BQVA 1EWLA 6PADA 3LXSA 1BGOA 2G6DA 3RVWA 3IEJA 1VSNA 1PXVA 1F2CA 1GCBA 3OVZA 2YJBA 1PPPA 3N3GA 4OEMA 1CJLA 1NL6A 3K9MA 5K16A 3DF0A 3KKUA 2AIMA 2E02A 2JQFR 2NQIA 4QBBA 1F2BA 1ATKA 1BQIA 3U8EA 5JA7A 2FUDA 1PPDA 3RVVA 4K7CA 1AYUA 3QJ3A 4FJCA 4OELA 4FIPA 2H7JA 4G54A 5PADA 1S4VA 2AUZA 2ACTA 2R9FA 5CVNB 3PDFA 4YV8A 1QOLA 3HHIA 5A24A 2DJFB 4W5CA 1MEGA 2HHNA 3P5UA 3OF8A 5JH3A 1PPNA 4N4ZA 1Y4HA 2HXZA 4CDEB 2FRQA 2F7DA 1AU4A 1STFE 4XUIA 3P5WA 1YK8A 3H6SA 3P5XA 1MHWA 1A6RA 2DCDA 2AVWA 2YJ2A 4Q8GA 3ZUAA 2F1GA 1FH0A 4CDDB 1VJVA 1AU2A 1KXRA 1HUCB 2FO5A 2AYOA 1TL9A 2IPPB 1CPJA 4YYRA 1PADA 2P7UA 1AU3A 1THEA 1U9XA 3PW3A 4QRXA 3CBKA 1XKGA 2OP3A 1PE6A 3C9EA 3M99A 2XU5A 3IOQA 1EWPA 4MZOA 1M6DA 2E01A 3RVXA 3ERVA 2G8JA 3IMAA 1CSBB 4BPVA 2YJCA 3WXFA 2DZYA 1PIPA 3LFYA 3D6SA 1CS8A 3TNXA
chains in the Genus database with same CATH superfamily
1U5IA 4KLBA 2R6NA 2PBHA 4X6JA 8PCHA 3BPFA 2FRAA 1GMYA 3P5VA 2NQGA 4PADA 2DCBA 3H7DA 3W30A 2O6XA 2R9MA 3HHAA 3N4CA 4MZSA 1Q6KA 1BY8A 2AU1A 3KWBX 1JQPA 4PT5A 3MORA 4XR7A 2BDZA 9PAPA 2VHFA 3CH2X 4YVAA 3H89A 3IV2A 3MHHA 2PREA 3BB7A 1NB5A 1YVBA 4YYSA 2B1NA 3IUTA 1SP4B 4WA6A 3K8UA 5CVOB 2CB5A 1U9QX 1QXPA 5JZEA 2E03A 2WBFX 4YYWA 4CZWA 3KW9A 2XU1A 3H8BA 1CQDA 3AI8A 5EGWA 1EWOA 1GLOA 1NQCA 1KFUL 2AS8A 4YYUA 2E00A 3MTVA 2DC6A 1F2AA 3K24A 3MTNA 5KO3A 3BOWA 3OF9A 2FTDA 3KWZA 2DC7A 2DZZA 2HH5A 4D8IA 3WXEA 1CV8A 2XU4A 3PT2A 1GECE 1DEUA 4I05A 1AECA 2FT2A 2JTCA 2AYNA 2NQDB 2BTWB 4AXLA 2DC8A 3KX1A 4BS5A 3C0RA 4QRGA 2JRIA 4YYVA 4MI7A 1SNKA 2HD5A 2P0RA 1QMYA 1EWMA 3O65A 4Q8HA 2J7QC 5FPWA 3KFQA 2ARYA 2YJ8A 3RNVA 1U9WA 4I07A 3N3KA 2XU3A 2OZ2A 1MDWA 1X9YA 1BP4A 3I3TA 3OVXA 1ME3A 4MM3B 3WXGA 3USVA 2PNSA 1ITOA 3MJ5A 3B79A 1KHQA 4FK5A 1U9VA 2Y6EA 3V6EA 3O0UA 3BCNA 2VHSA 1O0EA 2Y5BA 1MS6A 4DMYA 3CH3X 2CIOA 1K3BB 1ICFA 2G8EA 2DJGB 2FYEA 4RY2A 1MEMA 1ME4A 2DC9A 3PHWA 1YT7A 4BOQA 1UKFA 1POPA 4BSQA 4QRVA 2FE8A 4BOZA 1YZBA 1F29A 4DMXA 1AYWA 3HWNA 4PP2E 7PCKA 1YALA 2GHUA 2P86A 1PPOA 4RNAA 2YJ9A 3MHSA 2ATOA 4X6HA 3CBJA 3BPMA 3O1GA 1NLJA 2DCAA 3F5VA 3E1ZB 4CDFB 2R9OA 4N79A 3BWKA 4WURA 3H8CA 4W4UA 3F75A 5E6JA 4ZTBA 5CVMA 3BC3A 1NB3A 1PBHA 4W5BA 1CTEA 4QH6A 1CVZA 3OQCA 4X6IA 1AIMA 4P6EA 1TU6A 1ZIVA 2DCCA 1CB5A 3QSDA 3TMPA 5J94A 2BDLA 2PADA 1EF7A 1PCIA 2NQAA 1QDQA 3E9SA 1DF0A 2BTWA 3S3RA 3I06A 2JQGR 2FQ9A 4D8BA 3NHEA 1MIRA 2IBIA 2G7YA 4RF1A 1AU0A 1IWDA 4CDCB 3V6CA 5EF4A 3MP2A 1AYVA 2R9NA 3QT4A 1Y08A 4YYQA 3OISA 1KHPA 2R9CA 3IFUA 2OULA 3PBHA 3PNRA 5CHVA 2C0YA 5CHTA 4ZUXU 2GFOA 3GCBA 4HWYA 4D8EA 1YK7A 3ZNHA 3KSEA 4I04A 1KFXL 4PI3A 4OW0A 4BS6A 1NPZA 4BOUA 1ZCMA 1TLOA 5F02A 3W31A 3IHPA 4P6GA 3TRKA 4AXMA 4OVZB 3S3QA 2AUXA 4R3DA 3HD3A 2J7QA 4PP1A 2B1MA 4N8WA 4MSXA 4BQVA 4BOSA 1EWLA 4BOPA 6PADA 2Z84A 3LXSA 1BGOA 2G6DA 3RVWA 3IEJA 1VSNA 1PXVA 1F2CA 1GCBA 3OVZA 4GUAA 2UZJA 2YJBA 4RKXA 1PPPA 3N3GA 4OEMA 1CJLA 1NL6A 3K9MA 5K16A 3DF0A 3KKUA 2AIMA 3BY4A 2E02A 2JQFR 3PHXA 2NQIA 4QBBA 1F2BA 1ATKA 1BQIA 3U8EA 1DKIA 5JA7A 2FUDA 1PPDA 3RVVA 4K7CA 1AYUA 3B21A 3QJ3A 4FJCA 4OELA 3PSEA 4FIPA 4RF0A 2H7JA 4G54A 5PADA 1S4VA 2AUZA 2ACTA 2R9FA 5CVNB 2HWKA 3PDFA 4YV8A 1QOLA 3BBAA 3HHIA 5A24A 2DJFB 4W5CA 1MEGA 2HHNA 3P5UA 3OF8A 4XZXA 3PHUA 5JH3A 4REZA 1PPNA 4N4ZA 4IP3A 1Y4HA 5EZQA 2HXZA 4CDEB 2FRQA 2F7DA 1AU4A 1STFE 4XUIA 3PRMA 4IUMA 3P5WA 1YK8A 3H6SA 3P5XA 1MHWA 1A6RA 4HXDB 2AGAA 2DCDA 2AVWA 2YJ2A 4Q8GA 3ZUAA 2F1GA 1FH0A 4CDDB 1VJVA 1AU2A 1KXRA 1HUCB 2FO5A 4OVZA 2AYOA 1TL9A 2IPPB 1CPJA 4YYRA 1PADA 2BU3A 2P7UA 1AU3A 1THEA 1U9XA 3PW3A 3PRPA 4QRXA 1PVJA 3CBKA 4M0WA 1XKGA 2OP3A 5EZSA 1PE6A 3C9EA 3M99A 2XU5A 4P16A 3IOQA 1EWPA 4MZOA 1M6DA 2E01A 3RVXA 3ERVA 3IMAA 2DOSA 1CSBB 2G8JA 4BPVA 2YJCA 3WXFA 2DZYA 1PIPA 3LFYA 3D6SA 4A5UA 1CS8A 3TNXA
chains in the Genus database with same CATH topology
1U5IA 4KLBA 2R6NA 2PBHA 3LTWA 4X6JA 8PCHA 3BPFA 2FRAA 1GMYA 3P5VA 2NQGA 4PADA 2DCBA 3H7DA 2O6XA 2R9MA 3HHAA 3N4CA 4MZSA 1Q6KA 1BY8A 2AU1A 3KWBX 1JQPA 3MORA 4XR7A 2BDZA 9PAPA 3D9WA 2VHFA 3CH2X 4YVAA 3H89A 3IV2A 3MHHA 2PREA 1W4TA 1NB5A 1YVBA 4YYSA 1E2TA 2B1NA 3IUTA 1SP4B 4WA6A 3K8UA 5CVOB 2CB5A 1U9QX 1QXPA 2E03A 2WBFX 4YYWA 4CZWA 3KW9A 2XU1A 3H8BA 1CQDA 3AI8A 5EGWA 1EWOA 1GLOA 1NQCA 1KFUL 2AS8A 4YYUA 2E00A 2DC6A 1F2AA 3K24A 3MTNA 4NV7A 3BOWA 3OF9A 2FTDA 3KWZA 2DC7A 2DZZA 2HH5A 3WXEA 1CV8A 2XU4A 1GECE 1DEUA 4I05A 1AECA 2FT2A 2AYNA 2NQDB 1W6FA 4GUZA 4AXLA 2DC8A 3KX1A 4BS5A 4QRGA 4YYVA 1SNKA 2HD5A 2P0RA 1QMYA 1EWMA 4Q8HA 5FPWA 3KFQA 2ARYA 2YJ8A 1U9WA 4I07A 3N3KA 2XU3A 2OZ2A 1MDWA 1X9YA 1BP4A 3I3TA 3OVXA 1ME3A 3WXGA 3USVA 2PNSA 1ITOA 4FK5A 3B79A 1KHQA 1U9VA 2Y6EA 3V6EA 3O0UA 3BCNA 2VHSA 1O0EA 2Y5BA 1MS6A 4DMYA 3CH3X 2CIOA 1K3BB 1ICFA 2G8EA 2DJGB 2FYEA 4RY2A 1MEMA 1ME4A 2DC9A 1YT7A 1POPA 4BSQA 4QRVA 1F29A 4DMXA 2VFCA 1AYWA 3HWNA 4PP2E 7PCKA 1YALA 2GHUA 2P86A 1PPOA 2YJ9A 3MHSA 2ATOA 4X6HA 3CBJA 3BPMA 3O1GA 1NLJA 2DCAA 3F5VA 3E1ZB 4CDFB 2R9OA 4N79A 3BWKA 3H8CA 4W4UA 3F75A 5CVMA 3BC3A 1NB3A 1PBHA 4W5BA 1CTEA 4QH6A 1CVZA 4X6IA 1AIMA 4P6EA 1TU6A 1ZIVA 2DCCA 1CB5A 3QSDA 5J94A 2BDLA 2PADA 1EF7A 1PCIA 2NQAA 1QDQA 1DF0A 4NV8A 3S3RA 3I06A 2JQGR 2FQ9A 3NHEA 1MIRA 2IBIA 2G7YA 1AU0A 1IWDA 4CDCB 3V6CA 5EF4A 1AYVA 2R9NA 3QT4A 1Y08A 4B55A 2BSZA 4YYQA 3OISA 1KHPA 2R9CA 3PBHA 2OULA 3PNRA 5CHVA 2C0YA 5CHTA 4ZUXU 4BGFA 2GFOA 3GCBA 4HWYA 1YK7A 3KSEA 4I04A 1KFXL 4PI3A 4BS6A 1NPZA 1ZCMA 1TLOA 5F02A 3IHPA 4P6GA 4AXMA 3S3QA 2AUXA 3HD3A 4PP1A 2B1MA 4N8WA 4MSXA 4BQVA 1EWLA 6PADA 3LXSA 1BGOA 2G6DA 3RVWA 3IEJA 1VSNA 1PXVA 1F2CA 1GCBA 3OVZA 2YJBA 1PPPA 3N3GA 4OEMA 1CJLA 1NL6A 3K9MA 5K16A 3DF0A 3KKUA 2AIMA 2E02A 2JQFR 2NQIA 4QBBA 1F2BA 1ATKA 1BQIA 3U8EA 5JA7A 2FUDA 1PPDA 3RVVA 4K7CA 1AYUA 3QJ3A 4FJCA 4OELA 4FIPA 2H7JA 4G54A 1GX3A 5PADA 1S4VA 2AUZA 2ACTA 2R9FA 5CVNB 3PDFA 4YV8A 1QOLA 3HHIA 5A24A 2DJFB 4W5CA 1MEGA 2HHNA 3P5UA 3OF8A 5JH3A 1PPNA 4N4ZA 1Y4HA 2HXZA 4CDEB 2FRQA 2F7DA 1AU4A 1STFE 4XUIA 3P5WA 1YK8A 3H6SA 3P5XA 1MHWA 1A6RA 2DCDA 2AVWA 2YJ2A 4Q8GA 3ZUAA 2F1GA 1FH0A 4CDDB 1VJVA 1AU2A 1KXRA 1HUCB 2FO5A 2AYOA 1TL9A 2IPPB 1CPJA 4YYRA 1PADA 2P7UA 1AU3A 1THEA 1U9XA 3PW3A 4QRXA 1W5RA 3CBKA 1XKGA 2OP3A 1PE6A 3C9EA 3M99A 2XU5A 3IOQA 1EWPA 4MZOA 1M6DA 2E01A 2VFBA 4C5PA 3RVXA 3ERVA 2G8JA 3IMAA 1CSBB 4BPVA 2YJCA 3WXFA 2DZYA 1PIPA 3LFYA 3D6SA 1CS8A 3TNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U5I A;  4KLB A;  2R6N A;  2PBH A;  4X6J A;  8PCH A;  3BPF A;  2FRA A;  1GMY A;  3P5V A;  2NQG A;  4PAD A;  2DCB A;  3H7D A;  2O6X A;  2R9M A;  3HHA A;  3N4C A;  4MZS A;  1Q6K A;  1BY8 A;  2AU1 A;  3KWB X;  1JQP A;  3MOR A;  4XR7 A;  2BDZ A;  9PAP A;  2VHF A;  3CH2 X;  4YVA A;  3H89 A;  3IV2 A;  3MHH A;  2PRE A;  1NB5 A;  1YVB A;  4YYS A;  2B1N A;  3IUT A;  1SP4 B;  4WA6 A;  3K8U A;  5CVO B;  2CB5 A;  1U9Q X;  1QXP A;  2E03 A;  2WBF X;  4YYW A;  4CZW A;  3KW9 A;  2XU1 A;  3H8B A;  1CQD A;  3AI8 A;  5EGW A;  1EWO A;  1GLO A;  1NQC A;  1KFU L;  2AS8 A;  4YYU A;  2E00 A;  2DC6 A;  1F2A A;  3K24 A;  3MTN A;  3BOW A;  3OF9 A;  2FTD A;  3KWZ A;  2DC7 A;  2DZZ A;  2HH5 A;  3WXE A;  1CV8 A;  2XU4 A;  1GEC E;  1DEU A;  4I05 A;  1AEC A;  2FT2 A;  2AYN A;  2NQD B;  4AXL A;  2DC8 A;  3KX1 A;  4BS5 A;  4QRG A;  4YYV A;  1SNK A;  2HD5 A;  2P0R A;  1QMY A;  1EWM A;  4Q8H A;  5FPW A;  3KFQ A;  2ARY A;  2YJ8 A;  1U9W A;  4I07 A;  3N3K A;  2XU3 A;  2OZ2 A;  1MDW A;  1X9Y A;  1BP4 A;  3I3T A;  3OVX A;  1ME3 A;  3WXG A;  3USV A;  2PNS A;  1ITO A;  4FK5 A;  3B79 A;  1KHQ A;  1U9V A;  2Y6E A;  3V6E A;  3O0U A;  3BCN A;  2VHS A;  1O0E A;  2Y5B A;  1MS6 A;  4DMY A;  3CH3 X;  2CIO A;  1K3B B;  1ICF A;  2G8E A;  2DJG B;  2FYE A;  4RY2 A;  1MEM A;  1ME4 A;  2DC9 A;  1YT7 A;  1POP A;  4BSQ A;  4QRV A;  1F29 A;  4DMX A;  1AYW A;  3HWN A;  4PP2 E;  7PCK A;  1YAL A;  2GHU A;  2P86 A;  1PPO A;  2YJ9 A;  3MHS A;  2ATO A;  4X6H A;  3CBJ A;  3BPM A;  3O1G A;  1NLJ A;  2DCA A;  3F5V A;  3E1Z B;  4CDF B;  2R9O A;  4N79 A;  3BWK A;  3H8C A;  4W4U A;  3F75 A;  5CVM A;  3BC3 A;  1NB3 A;  1PBH A;  4W5B A;  1CTE A;  4QH6 A;  1CVZ A;  4X6I A;  4P6E A;  1AIM A;  1TU6 A;  1ZIV A;  2DCC A;  1CB5 A;  3QSD A;  5J94 A;  2BDL A;  2PAD A;  1EF7 A;  1PCI A;  2NQA A;  1QDQ A;  1DF0 A;  3S3R A;  3I06 A;  2JQG R;  2FQ9 A;  3NHE A;  1MIR A;  2IBI A;  2G7Y A;  1AU0 A;  1IWD A;  4CDC B;  3V6C A;  5EF4 A;  1AYV A;  2R9N A;  3QT4 A;  1Y08 A;  4YYQ A;  3OIS A;  1KHP A;  2R9C A;  3PBH A;  2OUL A;  3PNR A;  5CHV A;  2C0Y A;  5CHT A;  4ZUX U;  2GFO A;  3GCB A;  4HWY A;  1YK7 A;  3KSE A;  4I04 A;  1KFX L;  4PI3 A;  4BS6 A;  1NPZ A;  1ZCM A;  1TLO A;  5F02 A;  3IHP A;  4P6G A;  4AXM A;  3S3Q A;  2AUX A;  3HD3 A;  4PP1 A;  2B1M A;  4N8W A;  4MSX A;  4BQV A;  1EWL A;  6PAD A;  3LXS A;  1BGO A;  2G6D A;  3RVW A;  3IEJ A;  1VSN A;  1PXV A;  1F2C A;  1GCB A;  3OVZ A;  2YJB A;  1PPP A;  3N3G A;  4OEM A;  1CJL A;  1NL6 A;  3K9M A;  5K16 A;  3DF0 A;  3KKU A;  2AIM A;  2E02 A;  2JQF R;  2NQI A;  4QBB A;  1F2B A;  1ATK A;  1BQI A;  3U8E A;  5JA7 A;  2FUD A;  1PPD A;  3RVV A;  4K7C A;  1AYU A;  3QJ3 A;  4FJC A;  4OEL A;  4FIP A;  2H7J A;  4G54 A;  5PAD A;  1S4V A;  2AUZ A;  2ACT A;  2R9F A;  5CVN B;  3PDF A;  4YV8 A;  1QOL A;  3HHI A;  5A24 A;  2DJF B;  4W5C A;  1MEG A;  2HHN A;  3P5U A;  3OF8 A;  5JH3 A;  1PPN A;  4N4Z A;  1Y4H A;  2HXZ A;  4CDE B;  2FRQ A;  2F7D A;  1AU4 A;  1STF E;  4XUI A;  3P5W A;  1YK8 A;  3H6S A;  3P5X A;  1MHW A;  1A6R A;  2DCD A;  2AVW A;  2YJ2 A;  4Q8G A;  3ZUA A;  2F1G A;  1FH0 A;  4CDD B;  1VJV A;  1AU2 A;  1KXR A;  1HUC B;  2FO5 A;  2AYO A;  1TL9 A;  2IPP B;  1CPJ A;  4YYR A;  1PAD A;  2P7U A;  1AU3 A;  1THE A;  1U9X A;  3PW3 A;  4QRX A;  3CBK A;  1XKG A;  2OP3 A;  1PE6 A;  3C9E A;  3M99 A;  2XU5 A;  3IOQ A;  1EWP A;  4MZO A;  1M6D A;  2E01 A;  3RVX A;  3ERV A;  2G8J A;  3IMA A;  1CSB B;  4BPV A;  2YJC A;  3WXF A;  2DZY A;  1PIP A;  3LFY A;  3D6S A;  1CS8 A;  3TNX A; 
#chains in the Genus database with same CATH topology
 1U5I A;  4KLB A;  2R6N A;  2PBH A;  4X6J A;  8PCH A;  3BPF A;  2FRA A;  1GMY A;  3P5V A;  2NQG A;  4PAD A;  2DCB A;  3H7D A;  3W30 A;  2O6X A;  2R9M A;  3HHA A;  3N4C A;  4MZS A;  1Q6K A;  1BY8 A;  2AU1 A;  3KWB X;  1JQP A;  4PT5 A;  3MOR A;  4XR7 A;  2BDZ A;  9PAP A;  2VHF A;  3CH2 X;  4YVA A;  3H89 A;  3IV2 A;  3MHH A;  2PRE A;  3BB7 A;  1NB5 A;  1YVB A;  4YYS A;  2B1N A;  3IUT A;  1SP4 B;  4WA6 A;  3K8U A;  5CVO B;  2CB5 A;  1U9Q X;  1QXP A;  5JZE A;  2E03 A;  2WBF X;  4YYW A;  4CZW A;  3KW9 A;  2XU1 A;  3H8B A;  1CQD A;  3AI8 A;  5EGW A;  1EWO A;  1GLO A;  1NQC A;  1KFU L;  2AS8 A;  4YYU A;  2E00 A;  3MTV A;  2DC6 A;  1F2A A;  3K24 A;  3MTN A;  5KO3 A;  3BOW A;  3OF9 A;  2FTD A;  3KWZ A;  2DC7 A;  2DZZ A;  2HH5 A;  4D8I A;  3WXE A;  1CV8 A;  2XU4 A;  3PT2 A;  1GEC E;  1DEU A;  4I05 A;  1AEC A;  2FT2 A;  2JTC A;  2AYN A;  2NQD B;  2BTW B;  4AXL A;  2DC8 A;  3KX1 A;  4BS5 A;  3C0R A;  4QRG A;  2JRI A;  4YYV A;  4MI7 A;  1SNK A;  2HD5 A;  2P0R A;  1QMY A;  1EWM A;  3O65 A;  4Q8H A;  2J7Q C;  5FPW A;  3KFQ A;  2ARY A;  2YJ8 A;  3RNV A;  1U9W A;  4I07 A;  3N3K A;  2XU3 A;  2OZ2 A;  1MDW A;  1X9Y A;  1BP4 A;  3I3T A;  3OVX A;  1ME3 A;  4MM3 B;  3WXG A;  3USV A;  2PNS A;  1ITO A;  3MJ5 A;  3B79 A;  1KHQ A;  4FK5 A;  1U9V A;  2Y6E A;  3V6E A;  3O0U A;  3BCN A;  2VHS A;  1O0E A;  2Y5B A;  1MS6 A;  4DMY A;  3CH3 X;  2CIO A;  1K3B B;  1ICF A;  2G8E A;  2DJG B;  2FYE A;  4RY2 A;  1MEM A;  1ME4 A;  2DC9 A;  3PHW A;  1YT7 A;  4BOQ A;  1UKF A;  1POP A;  4BSQ A;  4QRV A;  2FE8 A;  4BOZ A;  1YZB A;  1F29 A;  4DMX A;  1AYW A;  3HWN A;  4PP2 E;  7PCK A;  1YAL A;  2GHU A;  2P86 A;  1PPO A;  4RNA A;  2YJ9 A;  3MHS A;  2ATO A;  4X6H A;  3CBJ A;  3BPM A;  3O1G A;  1NLJ A;  2DCA A;  3F5V A;  3E1Z B;  4CDF B;  2R9O A;  4N79 A;  3BWK A;  4WUR A;  3H8C A;  4W4U A;  3F75 A;  5E6J A;  4ZTB A;  5CVM A;  3BC3 A;  1NB3 A;  1PBH A;  4W5B A;  1CTE A;  4QH6 A;  1CVZ A;  3OQC A;  4X6I A;  1AIM A;  4P6E A;  1TU6 A;  1ZIV A;  2DCC A;  1CB5 A;  3QSD A;  3TMP A;  5J94 A;  2BDL A;  2PAD A;  1EF7 A;  1PCI A;  2NQA A;  1QDQ A;  3E9S A;  1DF0 A;  2BTW A;  3S3R A;  3I06 A;  2JQG R;  2FQ9 A;  4D8B A;  3NHE A;  1MIR A;  2IBI A;  2G7Y A;  4RF1 A;  1AU0 A;  1IWD A;  4CDC B;  3V6C A;  5EF4 A;  3MP2 A;  1AYV A;  2R9N A;  3QT4 A;  1Y08 A;  4YYQ A;  3OIS A;  1KHP A;  2R9C A;  3IFU A;  2OUL A;  3PBH A;  3PNR A;  5CHV A;  2C0Y A;  5CHT A;  4ZUX U;  2GFO A;  3GCB A;  4HWY A;  4D8E A;  1YK7 A;  3ZNH A;  3KSE A;  4I04 A;  1KFX L;  4PI3 A;  4OW0 A;  4BS6 A;  1NPZ A;  4BOU A;  1ZCM A;  1TLO A;  5F02 A;  3W31 A;  3IHP A;  4P6G A;  3TRK A;  4AXM A;  4OVZ B;  3S3Q A;  2AUX A;  4R3D A;  3HD3 A;  2J7Q A;  4PP1 A;  2B1M A;  4N8W A;  4MSX A;  4BQV A;  4BOS A;  1EWL A;  4BOP A;  6PAD A;  2Z84 A;  3LXS A;  1BGO A;  2G6D A;  3RVW A;  3IEJ A;  1VSN A;  1PXV A;  1F2C A;  1GCB A;  3OVZ A;  4GUA A;  2UZJ A;  2YJB A;  4RKX A;  1PPP A;  3N3G A;  4OEM A;  1CJL A;  1NL6 A;  3K9M A;  5K16 A;  3DF0 A;  3KKU A;  2AIM A;  3BY4 A;  2E02 A;  2JQF R;  3PHX A;  2NQI A;  4QBB A;  1F2B A;  1ATK A;  1BQI A;  3U8E A;  1DKI A;  5JA7 A;  2FUD A;  1PPD A;  3RVV A;  4K7C A;  1AYU A;  3B21 A;  3QJ3 A;  4FJC A;  4OEL A;  3PSE A;  4FIP A;  4RF0 A;  2H7J A;  4G54 A;  5PAD A;  1S4V A;  2AUZ A;  2ACT A;  2R9F A;  5CVN B;  2HWK A;  3PDF A;  4YV8 A;  1QOL A;  3BBA A;  3HHI A;  5A24 A;  2DJF B;  4W5C A;  1MEG A;  2HHN A;  3P5U A;  3OF8 A;  4XZX A;  3PHU A;  5JH3 A;  4REZ A;  1PPN A;  4N4Z A;  4IP3 A;  1Y4H A;  5EZQ A;  2HXZ A;  4CDE B;  2FRQ A;  2F7D A;  1AU4 A;  1STF E;  4XUI A;  3PRM A;  4IUM A;  3P5W A;  1YK8 A;  3H6S A;  3P5X A;  1MHW A;  1A6R A;  4HXD B;  2AGA A;  2DCD A;  2AVW A;  2YJ2 A;  4Q8G A;  3ZUA A;  2F1G A;  1FH0 A;  4CDD B;  1VJV A;  1AU2 A;  1KXR A;  1HUC B;  2FO5 A;  4OVZ A;  2AYO A;  1TL9 A;  2IPP B;  1CPJ A;  4YYR A;  1PAD A;  2BU3 A;  2P7U A;  1AU3 A;  1THE A;  1U9X A;  3PW3 A;  3PRP A;  4QRX A;  1PVJ A;  3CBK A;  4M0W A;  1XKG A;  2OP3 A;  5EZS A;  1PE6 A;  3C9E A;  3M99 A;  2XU5 A;  4P16 A;  3IOQ A;  1EWP A;  4MZO A;  1M6D A;  2E01 A;  3RVX A;  3ERV A;  3IMA A;  2DOS A;  1CSB B;  2G8J A;  4BPV A;  2YJC A;  3WXF A;  2DZY A;  1PIP A;  3LFY A;  3D6S A;  4A5U A;  1CS8 A;  3TNX A; 
#chains in the Genus database with same CATH homology
 1U5I A;  4KLB A;  2R6N A;  2PBH A;  3LTW A;  4X6J A;  8PCH A;  3BPF A;  2FRA A;  1GMY A;  3P5V A;  2NQG A;  4PAD A;  2DCB A;  3H7D A;  2O6X A;  2R9M A;  3HHA A;  3N4C A;  4MZS A;  1Q6K A;  1BY8 A;  2AU1 A;  3KWB X;  1JQP A;  3MOR A;  4XR7 A;  2BDZ A;  9PAP A;  3D9W A;  2VHF A;  3CH2 X;  4YVA A;  3H89 A;  3IV2 A;  3MHH A;  2PRE A;  1W4T A;  1NB5 A;  1YVB A;  4YYS A;  1E2T A;  2B1N A;  3IUT A;  1SP4 B;  4WA6 A;  3K8U A;  5CVO B;  2CB5 A;  1U9Q X;  1QXP A;  2E03 A;  2WBF X;  4YYW A;  4CZW A;  3KW9 A;  2XU1 A;  3H8B A;  1CQD A;  3AI8 A;  5EGW A;  1EWO A;  1GLO A;  1NQC A;  1KFU L;  2AS8 A;  4YYU A;  2E00 A;  2DC6 A;  1F2A A;  3K24 A;  3MTN A;  4NV7 A;  3BOW A;  3OF9 A;  2FTD A;  3KWZ A;  2DC7 A;  2DZZ A;  2HH5 A;  3WXE A;  1CV8 A;  2XU4 A;  1GEC E;  1DEU A;  4I05 A;  1AEC A;  2FT2 A;  2AYN A;  2NQD B;  1W6F A;  4GUZ A;  4AXL A;  2DC8 A;  3KX1 A;  4BS5 A;  4QRG A;  4YYV A;  1SNK A;  2HD5 A;  2P0R A;  1QMY A;  1EWM A;  4Q8H A;  5FPW A;  3KFQ A;  2ARY A;  2YJ8 A;  1U9W A;  4I07 A;  3N3K A;  2XU3 A;  2OZ2 A;  1MDW A;  1X9Y A;  1BP4 A;  3I3T A;  3OVX A;  1ME3 A;  3WXG A;  3USV A;  2PNS A;  1ITO A;  4FK5 A;  3B79 A;  1KHQ A;  1U9V A;  2Y6E A;  3V6E A;  3O0U A;  3BCN A;  2VHS A;  1O0E A;  2Y5B A;  1MS6 A;  4DMY A;  3CH3 X;  2CIO A;  1K3B B;  1ICF A;  2G8E A;  2DJG B;  2FYE A;  4RY2 A;  1MEM A;  1ME4 A;  2DC9 A;  1YT7 A;  1POP A;  4BSQ A;  4QRV A;  1F29 A;  4DMX A;  2VFC A;  1AYW A;  3HWN A;  4PP2 E;  7PCK A;  1YAL A;  2GHU A;  2P86 A;  1PPO A;  2YJ9 A;  3MHS A;  2ATO A;  4X6H A;  3CBJ A;  3BPM A;  3O1G A;  1NLJ A;  2DCA A;  3F5V A;  3E1Z B;  4CDF B;  2R9O A;  4N79 A;  3BWK A;  3H8C A;  4W4U A;  3F75 A;  5CVM A;  3BC3 A;  1NB3 A;  1PBH A;  4W5B A;  1CTE A;  4QH6 A;  1CVZ A;  4X6I A;  1AIM A;  4P6E A;  1TU6 A;  1ZIV A;  2DCC A;  1CB5 A;  3QSD A;  5J94 A;  2BDL A;  2PAD A;  1EF7 A;  1PCI A;  2NQA A;  1QDQ A;  1DF0 A;  4NV8 A;  3S3R A;  3I06 A;  2JQG R;  2FQ9 A;  3NHE A;  1MIR A;  2IBI A;  2G7Y A;  1AU0 A;  1IWD A;  4CDC B;  3V6C A;  5EF4 A;  1AYV A;  2R9N A;  3QT4 A;  1Y08 A;  4B55 A;  2BSZ A;  4YYQ A;  3OIS A;  1KHP A;  2R9C A;  3PBH A;  2OUL A;  3PNR A;  5CHV A;  2C0Y A;  5CHT A;  4ZUX U;  4BGF A;  2GFO A;  3GCB A;  4HWY A;  1YK7 A;  3KSE A;  4I04 A;  1KFX L;  4PI3 A;  4BS6 A;  1NPZ A;  1ZCM A;  1TLO A;  5F02 A;  3IHP A;  4P6G A;  4AXM A;  3S3Q A;  2AUX A;  3HD3 A;  4PP1 A;  2B1M A;  4N8W A;  4MSX A;  4BQV A;  1EWL A;  6PAD A;  3LXS A;  1BGO A;  2G6D A;  3RVW A;  3IEJ A;  1VSN A;  1PXV A;  1F2C A;  1GCB A;  3OVZ A;  2YJB A;  1PPP A;  3N3G A;  4OEM A;  1CJL A;  1NL6 A;  3K9M A;  5K16 A;  3DF0 A;  3KKU A;  2AIM A;  2E02 A;  2JQF R;  2NQI A;  4QBB A;  1F2B A;  1ATK A;  1BQI A;  3U8E A;  5JA7 A;  2FUD A;  1PPD A;  3RVV A;  4K7C A;  1AYU A;  3QJ3 A;  4FJC A;  4OEL A;  4FIP A;  2H7J A;  4G54 A;  1GX3 A;  5PAD A;  1S4V A;  2AUZ A;  2ACT A;  2R9F A;  5CVN B;  3PDF A;  4YV8 A;  1QOL A;  3HHI A;  5A24 A;  2DJF B;  4W5C A;  1MEG A;  2HHN A;  3P5U A;  3OF8 A;  5JH3 A;  1PPN A;  4N4Z A;  1Y4H A;  2HXZ A;  4CDE B;  2FRQ A;  2F7D A;  1AU4 A;  1STF E;  4XUI A;  3P5W A;  1YK8 A;  3H6S A;  3P5X A;  1MHW A;  1A6R A;  2DCD A;  2AVW A;  2YJ2 A;  4Q8G A;  3ZUA A;  2F1G A;  1FH0 A;  4CDD B;  1VJV A;  1AU2 A;  1KXR A;  1HUC B;  2FO5 A;  2AYO A;  1TL9 A;  2IPP B;  1CPJ A;  4YYR A;  1PAD A;  2P7U A;  1AU3 A;  1THE A;  1U9X A;  3PW3 A;  4QRX A;  1W5R A;  3CBK A;  1XKG A;  2OP3 A;  1PE6 A;  3C9E A;  3M99 A;  2XU5 A;  3IOQ A;  1EWP A;  4MZO A;  1M6D A;  2E01 A;  2VFB A;  4C5P A;  3RVX A;  3ERV A;  2G8J A;  3IMA A;  1CSB B;  4BPV A;  2YJC A;  3WXF A;  2DZY A;  1PIP A;  3LFY A;  3D6S A;  1CS8 A;  3TNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...