3OVXA

Cathepsin s in complex with a covalent inhibitor with an aldehyde warhead
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trifluoromethylphenyl as P2 for ketoamide-based cathepsin S inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin S
total genus 71
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3ovxA00
1HUCB 2DJGB 1EWMA 2FYEA 4AXLA 2PADA 1F2BA 2DZZA 3N3KA 1YVBA 1IWDA 4N8WA 2PBHA 2CIOA 1GMYA 2DJFB 1S4VA 2DCDA 3LXSA 3P5WA 4QBBA 5PADA 2R9CA 3DF0A 5K16A 2GHUA 1CVZA 1NB5A 3OF8A 1ATKA 4X6HA 1ME3A 1NPZA 4YYRA 3K8UA 1BGOA 3QT4A 1NQCA 4YYSA 1CQDA 1ITOA 2ATOA 3MORA 1PPNA 1KXRA 2YJ9A 3D6SA 3CH3X 4MZOA 3KKUA 1AU2A 4I05A 4YYVA 2YJCA 1KHPA 1M6DA 5CVMA 3F5VA 1POPA 3RVXA 3RVWA 1VSNA 1GCBA 2AVWA 4I04A 2YJ8A 4CDCB 3LFYA 4YYWA 1MHWA 3MHSA 3RVVA 2B1MA 1A6RA 4G54A 3USVA 3AI8A 5FPWA 4QRXA 4BSQA 2G8EA 3O1GA 3H7DA 2G6DA 4BS6A 5CHTA 1CPJA 1EWPA 1F2CA 1PCIA 2AUZA 3WXEA 4ZUXU 4YYQA 4XUIA 3N3GA 2FRQA 2JQGR 2AU1A 1TU6A 2DCCA 2AS8A 1CTEA 2R9NA 1AYVA 2AYNA 2PNSA 1BY8A 1KFUL 7PCKA 2BDZA 1DF0A 4BQVA 3P5XA 2HHNA 4OELA 2WBFX 3WXFA 1PPPA 5CVNB 2Y5BA 3U8EA 3I06A 4PP1A 1EWLA 5EF4A 4AXMA 2VHSA 2P0RA 4FIPA 1U5IA 2FRAA 1PPOA 1EF7A 3WXGA 3KFQA 1ZCMA 1CV8A 2F7DA 3F75A 4FK5A 4DMXA 1DEUA 1PPDA 2XU4A 3V6EA 3KWBX 4HWYA 5JH3A 4RY2A 1MEGA 4N4ZA 3P5UA 1BP4A 4N79A 3V6CA 1PXVA 1MIRA 1U9QX 3H8BA 4W5CA 3IEJA 2BDLA 3CBJA 3BPFA 1TLOA 3N4CA 2IPPB 3C9EA 1AU4A 4P6EA 2DC7A 5EGWA 3KWZA 4FJCA 1NB3A 2R6NA 1TL9A 3CBKA 3QJ3A 3MHHA 3KSEA 5JA7A 3TNXA 3P5VA 2FO5A 1NLJA 3H6SA 1ZIVA 1U9XA 4PI3A 1GLOA 1KHQA 1KFXL 3K24A 2DZYA 3BCNA 2YJBA 2H7JA 3ZUAA 8PCHA 1FH0A 2DC8A 3OVXA 1F2AA 1CS8A 1AECA 5CVOB 1YALA 2ARYA 1QOLA 3CH2X 3NHEA 3HD3A 1AIMA 1QMYA 2O6XA 4PP2E 4X6IA 1JQPA 2NQGA 3MTNA 2G7YA 2OP3A 1MDWA 3IV2A 4MSXA 3GCBA 3I3TA 1THEA 4BPVA 1ICFA 3OVZA 1CJLA 1STFE 2FQ9A 4Q8GA 1GECE 2FTDA 3PBHA 3B79A 1CB5A 1AYWA 3K9MA 5A24A 2R9MA 4I07A 4QRVA 1F29A 2DCAA 9PAPA 1U9WA 3OISA 4P6GA 2G8JA 1MEMA 2CB5A 2HH5A 2E03A 1XKGA 4CDDB 1YT7A 1QXPA 5F02A 4XR7A 1PADA 3QSDA 2OULA 6PADA 4CDEB 2AIMA 2F1GA 4YV8A 3M99A 2XU3A 1CSBB 2IBIA 1BQIA 2AYOA 5J94A 1U9VA 3O0UA 2R9FA 3HHIA 3OF9A 4K7CA 4QH6A 5CHVA 4KLBA 3KX1A 2FUDA 4QRGA 2E00A 2B1NA 2YJ2A 1Y4HA 3BWKA 2NQIA 1MS6A 3HWNA 2AUXA 1PIPA 2P86A 2OZ2A 2R9OA 2E01A 2PREA 3PDFA 4W5BA 1PBHA 3E1ZB 3HHAA 4DMYA 3BPMA 2P7UA 3IUTA 1K3BB 3IOQA 2C0YA 1SP4B 4W4UA 4CZWA 2NQDB 1PE6A 2XU1A 3H8CA 4MZSA 2E02A 4X6JA 1EWOA 4BS5A 2XU5A 1VJVA 2DC6A 3BC3A 1Q6KA 1O0EA 1QDQA 2HXZA 2JQFR 1YK7A 4YVAA 4PADA 1Y08A 3H89A 3KW9A 2ACTA 2FT2A 2DC9A 4Q8HA 1NL6A 1AU0A 4WA6A 1ME4A 1X9YA 2DCBA 2NQAA 3IMAA 3S3QA 3PNRA 1YK8A 3ERVA 2HD5A 2Y6EA 2GFOA 1SNKA 4YYUA 3S3RA 3IHPA 3BOWA 4OEMA 3PW3A 4CDFB 2VHFA 1AYUA 1AU3A
chains in the Genus database with same CATH superfamily
1HUCB 2DJGB 1EWMA 5EZQA 2FYEA 3TMPA 4AXLA 2PADA 1F2BA 2DZZA 3N3KA 1YVBA 1IWDA 3PRMA 4N8WA 2PBHA 2CIOA 1GMYA 2DJFB 1S4VA 2DCDA 3LXSA 3P5WA 4QBBA 5PADA 2R9CA 3DF0A 5K16A 2HWKA 2GHUA 1CVZA 1NB5A 3OF8A 1ATKA 4X6HA 1ME3A 1NPZA 4YYRA 4GUAA 3K8UA 1BGOA 3QT4A 1NQCA 3PHUA 4YYSA 1CQDA 1ITOA 2ATOA 3MORA 1PPNA 1KXRA 2YJ9A 3D6SA 4MM3B 3CH3X 4MZOA 4PT5A 3KKUA 1AU2A 4I05A 4YYVA 2YJCA 1KHPA 1M6DA 5CVMA 2BU3A 3F5VA 3PRPA 1POPA 4REZA 3RVXA 3RVWA 1VSNA 1YZBA 1GCBA 2AVWA 4I04A 2YJ8A 4CDCB 4RF1A 3LFYA 4YYWA 1MHWA 4RF0A 3MHSA 3BY4A 3PHXA 3RVVA 2B1MA 1A6RA 2BTWB 3RNVA 4G54A 3USVA 3AI8A 5FPWA 4QRXA 4BSQA 2G8EA 5EZSA 4BOZA 3O1GA 3H7DA 2G6DA 4BS6A 5CHTA 1CPJA 1EWPA 1F2CA 1PCIA 2AUZA 3WXEA 4ZUXU 4YYQA 4XUIA 3N3GA 2FRQA 2JQGR 2AU1A 1TU6A 2DCCA 4BOPA 2AS8A 3W30A 1CTEA 2R9NA 1AYVA 2AYNA 2PNSA 1BY8A 1KFUL 7PCKA 2BDZA 1DF0A 4BQVA 3P5XA 4D8BA 2HHNA 1UKFA 4OELA 2WBFX 3WXFA 1PPPA 5CVNB 2Y5BA 3U8EA 3I06A 4PP1A 1EWLA 1DKIA 5EF4A 4AXMA 2VHSA 2BTWA 2P0RA 4FIPA 3BB7A 1U5IA 5JZEA 2FRAA 2FE8A 1PPOA 3O65A 1EF7A 3ZNHA 3WXGA 3KFQA 1ZCMA 4HXDB 1CV8A 2F7DA 3F75A 4BOUA 4FK5A 4DMXA 1DEUA 1PPDA 2XU4A 3KWBX 4HWYA 3V6EA 5JH3A 4RY2A 1MEGA 4N4ZA 3P5UA 1BP4A 4N79A 3IFUA 3V6CA 1PXVA 1MIRA 1U9QX 3H8BA 4W5CA 3C0RA 3IEJA 2BDLA 3CBJA 3BPFA 1TLOA 3N4CA 2IPPB 3C9EA 1AU4A 4P6EA 4RKXA 2DC7A 5EGWA 3KWZA 4FJCA 1NB3A 2R6NA 4ZTBA 1TL9A 3CBKA 2Z84A 3QJ3A 3MHHA 3KSEA 5JA7A 3TNXA 3P5VA 2FO5A 1NLJA 3H6SA 1ZIVA 1U9XA 4PI3A 2UZJA 1GLOA 1KHQA 1KFXL 2AGAA 3K24A 2DZYA 3BCNA 4D8EA 2YJBA 2H7JA 2JTCA 2DOSA 3ZUAA 8PCHA 1FH0A 2DC8A 3OVXA 4P16A 1F2AA 1CS8A 2JRIA 1AECA 5CVOB 1YALA 2ARYA 1QOLA 3CH2X 3NHEA 4BOSA 5KO3A 3HD3A 1AIMA 1QMYA 2O6XA 4PP2E 4WURA 4OVZB 4X6IA 1JQPA 2NQGA 3MTNA 2G7YA 2OP3A 3BBAA 1MDWA 3IV2A 4MSXA 3GCBA 3I3TA 1THEA 4BPVA 3OVZA 1ICFA 1CJLA 1STFE 2FQ9A 1GECE 4Q8GA 2FTDA 3PBHA 3B79A 1CB5A 1AYWA 3K9MA 5A24A 2R9MA 4I07A 4QRVA 1F29A 3MJ5A 2DCAA 9PAPA 1PVJA 4MI7A 4A5UA 1U9WA 3OISA 2G8JA 4P6GA 1MEMA 2CB5A 2HH5A 2E03A 1XKGA 4CDDB 1YT7A 1QXPA 5F02A 4XR7A 1PADA 3QSDA 2OULA 4IP3A 6PADA 4CDEB 2AIMA 2F1GA 4YV8A 3M99A 2XU3A 2J7QA 4BOQA 1CSBB 2IBIA 1BQIA 2AYOA 5J94A 1U9VA 3O0UA 2R9FA 3HHIA 3OF9A 4K7CA 4QH6A 5CHVA 4KLBA 3W31A 3KX1A 2FUDA 4QRGA 2E00A 2B1NA 2YJ2A 1Y4HA 3PSEA 3BWKA 2NQIA 1MS6A 3HWNA 2AUXA 1PIPA 2P86A 2OZ2A 2R9OA 2E01A 2PREA 3PDFA 4W5BA 1PBHA 4M0WA 3MP2A 3E1ZB 3HHAA 4DMYA 3BPMA 2P7UA 3IUTA 1K3BB 3IOQA 3OQCA 2C0YA 1SP4B 4IUMA 3TRKA 3PT2A 3PHWA 4W4UA 4CZWA 2NQDB 1PE6A 2XU1A 3H8CA 4MZSA 2E02A 4X6JA 1EWOA 4BS5A 2XU5A 5E6JA 1VJVA 2DC6A 3BC3A 1Q6KA 1O0EA 1QDQA 2HXZA 2JQFR 3E9SA 1YK7A 4YVAA 4PADA 1Y08A 3H89A 3KW9A 2ACTA 2FT2A 4D8IA 2DC9A 2J7QC 4Q8HA 1NL6A 1AU0A 4WA6A 1ME4A 1X9YA 3MTVA 2DCBA 2NQAA 3IMAA 3S3QA 4OW0A 1YK8A 3PNRA 3ERVA 2HD5A 2Y6EA 2GFOA 1SNKA 4YYUA 3S3RA 4R3DA 3IHPA 3B21A 3BOWA 4XZXA 4RNAA 4OEMA 4OVZA 3PW3A 4CDFB 2VHFA 1AYUA 1AU3A
chains in the Genus database with same CATH topology
1HUCB 2DJGB 1EWMA 2FYEA 4AXLA 2PADA 1F2BA 2DZZA 3N3KA 1YVBA 1IWDA 4N8WA 2PBHA 2CIOA 1GMYA 2DJFB 1S4VA 2DCDA 3LXSA 3P5WA 4QBBA 5PADA 2R9CA 3DF0A 5K16A 2GHUA 1CVZA 1NB5A 3OF8A 1ATKA 4X6HA 1ME3A 1NPZA 4YYRA 3K8UA 1BGOA 3QT4A 1NQCA 4YYSA 1CQDA 1ITOA 2ATOA 3MORA 1PPNA 1KXRA 2YJ9A 3D6SA 3CH3X 4MZOA 3KKUA 1AU2A 4I05A 4YYVA 2YJCA 1KHPA 1M6DA 5CVMA 3F5VA 1POPA 3RVXA 3RVWA 1VSNA 1GCBA 2AVWA 4I04A 4NV7A 2YJ8A 4CDCB 3LFYA 4YYWA 1MHWA 2VFCA 3MHSA 3RVVA 2B1MA 1A6RA 4G54A 3USVA 3AI8A 5FPWA 4QRXA 4BSQA 2G8EA 3O1GA 3H7DA 2G6DA 4BS6A 5CHTA 1CPJA 1E2TA 1EWPA 1F2CA 1PCIA 2AUZA 3WXEA 4ZUXU 4YYQA 4XUIA 3N3GA 2FRQA 2JQGR 2AU1A 1TU6A 2DCCA 2AS8A 1CTEA 2R9NA 1AYVA 2AYNA 2PNSA 3LTWA 4NV8A 1BY8A 1KFUL 7PCKA 2BDZA 1DF0A 4BQVA 3P5XA 2HHNA 4OELA 2WBFX 3WXFA 1PPPA 5CVNB 2Y5BA 3U8EA 3I06A 4PP1A 1EWLA 5EF4A 4AXMA 2VHSA 2P0RA 4FIPA 1U5IA 2FRAA 1PPOA 1EF7A 3WXGA 3KFQA 1ZCMA 1CV8A 2F7DA 3F75A 4FK5A 4DMXA 1DEUA 1PPDA 2XU4A 3KWBX 4HWYA 3V6EA 5JH3A 4RY2A 1MEGA 4N4ZA 3P5UA 1BP4A 4N79A 3V6CA 1PXVA 1W4TA 1MIRA 1U9QX 3H8BA 4W5CA 3IEJA 2BDLA 3CBJA 4BGFA 3BPFA 1TLOA 3N4CA 2IPPB 3C9EA 1AU4A 4P6EA 2DC7A 5EGWA 3KWZA 4FJCA 1NB3A 2R6NA 1TL9A 3CBKA 3QJ3A 3MHHA 3KSEA 5JA7A 3TNXA 3P5VA 2FO5A 1NLJA 3H6SA 1ZIVA 1U9XA 4PI3A 1GLOA 1KHQA 1KFXL 3K24A 2DZYA 1W5RA 3BCNA 2YJBA 4B55A 2H7JA 4GUZA 3ZUAA 8PCHA 1FH0A 2DC8A 3OVXA 1F2AA 1CS8A 1AECA 5CVOB 1YALA 2ARYA 1QOLA 3CH2X 3NHEA 3HD3A 1AIMA 1QMYA 2O6XA 4PP2E 4X6IA 1JQPA 2NQGA 3MTNA 2G7YA 2VFBA 2OP3A 1MDWA 3IV2A 4MSXA 3GCBA 3I3TA 1THEA 4BPVA 1ICFA 3OVZA 1CJLA 1STFE 2FQ9A 4Q8GA 1GECE 2FTDA 3PBHA 3B79A 1CB5A 1AYWA 3K9MA 5A24A 2R9MA 4I07A 4QRVA 1F29A 2DCAA 9PAPA 1U9WA 3OISA 4P6GA 2G8JA 1MEMA 2CB5A 2HH5A 2E03A 1XKGA 4CDDB 1YT7A 1QXPA 5F02A 4XR7A 1PADA 3QSDA 2OULA 6PADA 4CDEB 2AIMA 2F1GA 4YV8A 3M99A 2XU3A 1CSBB 2IBIA 1BQIA 2AYOA 5J94A 1U9VA 3O0UA 2R9FA 3HHIA 3OF9A 4K7CA 4QH6A 5CHVA 4KLBA 3KX1A 2FUDA 4QRGA 2E00A 2B1NA 2YJ2A 1Y4HA 3BWKA 2NQIA 1MS6A 3HWNA 2AUXA 1PIPA 2P86A 4C5PA 1W6FA 2OZ2A 2R9OA 2E01A 2PREA 3PDFA 4W5BA 1PBHA 3E1ZB 3HHAA 4DMYA 3BPMA 2P7UA 3IUTA 1K3BB 3IOQA 2C0YA 2BSZA 1SP4B 4W4UA 4CZWA 2NQDB 1PE6A 2XU1A 3H8CA 4MZSA 2E02A 4X6JA 1EWOA 4BS5A 2XU5A 1VJVA 2DC6A 3BC3A 1Q6KA 1O0EA 1QDQA 2HXZA 2JQFR 1YK7A 4YVAA 4PADA 1GX3A 1Y08A 3H89A 3KW9A 2ACTA 3D9WA 2FT2A 2DC9A 4Q8HA 1NL6A 1AU0A 4WA6A 1ME4A 1X9YA 2DCBA 2NQAA 3IMAA 3S3QA 3PNRA 1YK8A 3ERVA 2HD5A 2Y6EA 2GFOA 1SNKA 4YYUA 3S3RA 3IHPA 3BOWA 4OEMA 3PW3A 4CDFB 2VHFA 1AYUA 1AU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HUC B;  2DJG B;  1EWM A;  2FYE A;  4AXL A;  2PAD A;  1F2B A;  2DZZ A;  3N3K A;  1YVB A;  1IWD A;  4N8W A;  2PBH A;  2CIO A;  1GMY A;  2DJF B;  1S4V A;  2DCD A;  3LXS A;  3P5W A;  4QBB A;  5PAD A;  2R9C A;  3DF0 A;  5K16 A;  2GHU A;  1CVZ A;  1NB5 A;  3OF8 A;  1ATK A;  4X6H A;  1ME3 A;  1NPZ A;  4YYR A;  3K8U A;  1BGO A;  3QT4 A;  1NQC A;  4YYS A;  1CQD A;  1ITO A;  2ATO A;  3MOR A;  1PPN A;  1KXR A;  2YJ9 A;  3D6S A;  3CH3 X;  4MZO A;  3KKU A;  1AU2 A;  4I05 A;  4YYV A;  2YJC A;  1KHP A;  1M6D A;  5CVM A;  3F5V A;  1POP A;  3RVX A;  3RVW A;  1VSN A;  1GCB A;  2AVW A;  4I04 A;  2YJ8 A;  4CDC B;  3LFY A;  4YYW A;  1MHW A;  3MHS A;  3RVV A;  2B1M A;  1A6R A;  4G54 A;  3USV A;  3AI8 A;  5FPW A;  4QRX A;  4BSQ A;  2G8E A;  3O1G A;  3H7D A;  2G6D A;  4BS6 A;  5CHT A;  1CPJ A;  1EWP A;  1F2C A;  1PCI A;  2AUZ A;  3WXE A;  4ZUX U;  4YYQ A;  4XUI A;  3N3G A;  2FRQ A;  2JQG R;  2AU1 A;  1TU6 A;  2DCC A;  2AS8 A;  1CTE A;  2R9N A;  1AYV A;  2AYN A;  2PNS A;  1BY8 A;  1KFU L;  7PCK A;  2BDZ A;  1DF0 A;  4BQV A;  3P5X A;  2HHN A;  4OEL A;  2WBF X;  3WXF A;  1PPP A;  5CVN B;  2Y5B A;  3U8E A;  3I06 A;  4PP1 A;  1EWL A;  5EF4 A;  4AXM A;  2VHS A;  2P0R A;  4FIP A;  1U5I A;  2FRA A;  1PPO A;  1EF7 A;  3WXG A;  3KFQ A;  1ZCM A;  1CV8 A;  2F7D A;  3F75 A;  4FK5 A;  4DMX A;  1DEU A;  1PPD A;  2XU4 A;  3V6E A;  3KWB X;  4HWY A;  5JH3 A;  4RY2 A;  1MEG A;  4N4Z A;  3P5U A;  1BP4 A;  4N79 A;  3V6C A;  1PXV A;  1MIR A;  1U9Q X;  3H8B A;  4W5C A;  3IEJ A;  2BDL A;  3CBJ A;  3BPF A;  1TLO A;  3N4C A;  2IPP B;  3C9E A;  1AU4 A;  4P6E A;  2DC7 A;  5EGW A;  3KWZ A;  4FJC A;  1NB3 A;  2R6N A;  1TL9 A;  3CBK A;  3QJ3 A;  3MHH A;  3KSE A;  5JA7 A;  3TNX A;  3P5V A;  2FO5 A;  1NLJ A;  3H6S A;  1ZIV A;  1U9X A;  4PI3 A;  1GLO A;  1KHQ A;  1KFX L;  3K24 A;  2DZY A;  3BCN A;  2YJB A;  2H7J A;  3ZUA A;  8PCH A;  1FH0 A;  2DC8 A;  3OVX A;  1F2A A;  1CS8 A;  1AEC A;  5CVO B;  1YAL A;  2ARY A;  1QOL A;  3CH2 X;  3NHE A;  3HD3 A;  1AIM A;  1QMY A;  2O6X A;  4PP2 E;  4X6I A;  1JQP A;  2NQG A;  3MTN A;  2G7Y A;  2OP3 A;  1MDW A;  3IV2 A;  4MSX A;  3GCB A;  3I3T A;  1THE A;  4BPV A;  1ICF A;  3OVZ A;  1CJL A;  1STF E;  2FQ9 A;  4Q8G A;  1GEC E;  2FTD A;  3PBH A;  3B79 A;  1CB5 A;  1AYW A;  3K9M A;  5A24 A;  2R9M A;  4I07 A;  4QRV A;  1F29 A;  2DCA A;  9PAP A;  1U9W A;  3OIS A;  4P6G A;  2G8J A;  1MEM A;  2CB5 A;  2HH5 A;  2E03 A;  1XKG A;  4CDD B;  1YT7 A;  1QXP A;  5F02 A;  4XR7 A;  1PAD A;  3QSD A;  2OUL A;  6PAD A;  4CDE B;  2AIM A;  2F1G A;  4YV8 A;  3M99 A;  2XU3 A;  1CSB B;  2IBI A;  1BQI A;  2AYO A;  5J94 A;  1U9V A;  3O0U A;  2R9F A;  3HHI A;  3OF9 A;  4K7C A;  4QH6 A;  5CHV A;  4KLB A;  3KX1 A;  2FUD A;  4QRG A;  2E00 A;  2B1N A;  2YJ2 A;  1Y4H A;  3BWK A;  2NQI A;  1MS6 A;  3HWN A;  2AUX A;  1PIP A;  2P86 A;  2OZ2 A;  2R9O A;  2E01 A;  2PRE A;  3PDF A;  4W5B A;  1PBH A;  3E1Z B;  3HHA A;  4DMY A;  3BPM A;  2P7U A;  3IUT A;  1K3B B;  3IOQ A;  2C0Y A;  1SP4 B;  4W4U A;  4CZW A;  2NQD B;  1PE6 A;  2XU1 A;  3H8C A;  4MZS A;  2E02 A;  4X6J A;  1EWO A;  4BS5 A;  2XU5 A;  1VJV A;  2DC6 A;  3BC3 A;  1Q6K A;  1O0E A;  1QDQ A;  2HXZ A;  2JQF R;  1YK7 A;  4YVA A;  4PAD A;  1Y08 A;  3H89 A;  3KW9 A;  2ACT A;  2FT2 A;  2DC9 A;  4Q8H A;  1NL6 A;  1AU0 A;  4WA6 A;  1ME4 A;  1X9Y A;  2DCB A;  2NQA A;  3IMA A;  3S3Q A;  3PNR A;  1YK8 A;  3ERV A;  2HD5 A;  2Y6E A;  2GFO A;  1SNK A;  4YYU A;  3S3R A;  3IHP A;  3BOW A;  4OEM A;  3PW3 A;  4CDF B;  2VHF A;  1AYU A;  1AU3 A; 
#chains in the Genus database with same CATH topology
 1HUC B;  2DJG B;  1EWM A;  5EZQ A;  2FYE A;  3TMP A;  4AXL A;  2PAD A;  1F2B A;  2DZZ A;  3N3K A;  1YVB A;  1IWD A;  3PRM A;  4N8W A;  2PBH A;  2CIO A;  1GMY A;  2DJF B;  1S4V A;  2DCD A;  3LXS A;  3P5W A;  4QBB A;  5PAD A;  2R9C A;  3DF0 A;  5K16 A;  2HWK A;  2GHU A;  1CVZ A;  1NB5 A;  3OF8 A;  1ATK A;  4X6H A;  1ME3 A;  1NPZ A;  4YYR A;  4GUA A;  3K8U A;  1BGO A;  3QT4 A;  1NQC A;  3PHU A;  4YYS A;  1CQD A;  1ITO A;  2ATO A;  3MOR A;  1PPN A;  1KXR A;  2YJ9 A;  3D6S A;  4MM3 B;  3CH3 X;  4MZO A;  4PT5 A;  3KKU A;  1AU2 A;  4I05 A;  4YYV A;  2YJC A;  1KHP A;  1M6D A;  5CVM A;  2BU3 A;  3F5V A;  3PRP A;  1POP A;  4REZ A;  3RVX A;  3RVW A;  1VSN A;  1YZB A;  1GCB A;  2AVW A;  4I04 A;  2YJ8 A;  4CDC B;  4RF1 A;  3LFY A;  4YYW A;  1MHW A;  4RF0 A;  3MHS A;  3BY4 A;  3PHX A;  3RVV A;  2B1M A;  1A6R A;  2BTW B;  3RNV A;  4G54 A;  3USV A;  3AI8 A;  5FPW A;  4QRX A;  4BSQ A;  2G8E A;  5EZS A;  4BOZ A;  3O1G A;  3H7D A;  2G6D A;  4BS6 A;  5CHT A;  1CPJ A;  1EWP A;  1F2C A;  1PCI A;  2AUZ A;  3WXE A;  4ZUX U;  4YYQ A;  4XUI A;  3N3G A;  2FRQ A;  2JQG R;  2AU1 A;  1TU6 A;  2DCC A;  4BOP A;  2AS8 A;  3W30 A;  1CTE A;  2R9N A;  1AYV A;  2AYN A;  2PNS A;  1BY8 A;  1KFU L;  7PCK A;  2BDZ A;  1DF0 A;  4BQV A;  3P5X A;  4D8B A;  2HHN A;  1UKF A;  4OEL A;  2WBF X;  3WXF A;  1PPP A;  5CVN B;  2Y5B A;  3U8E A;  3I06 A;  4PP1 A;  1EWL A;  1DKI A;  5EF4 A;  4AXM A;  2VHS A;  2BTW A;  2P0R A;  4FIP A;  3BB7 A;  1U5I A;  5JZE A;  2FRA A;  2FE8 A;  1PPO A;  3O65 A;  1EF7 A;  3ZNH A;  3WXG A;  3KFQ A;  1ZCM A;  4HXD B;  1CV8 A;  2F7D A;  3F75 A;  4BOU A;  4FK5 A;  4DMX A;  1DEU A;  1PPD A;  2XU4 A;  3KWB X;  4HWY A;  3V6E A;  5JH3 A;  4RY2 A;  1MEG A;  4N4Z A;  3P5U A;  1BP4 A;  4N79 A;  3IFU A;  3V6C A;  1PXV A;  1MIR A;  1U9Q X;  3H8B A;  4W5C A;  3C0R A;  3IEJ A;  2BDL A;  3CBJ A;  3BPF A;  1TLO A;  3N4C A;  2IPP B;  3C9E A;  1AU4 A;  4P6E A;  4RKX A;  2DC7 A;  5EGW A;  3KWZ A;  4FJC A;  1NB3 A;  2R6N A;  4ZTB A;  1TL9 A;  3CBK A;  2Z84 A;  3QJ3 A;  3MHH A;  3KSE A;  5JA7 A;  3TNX A;  3P5V A;  2FO5 A;  1NLJ A;  3H6S A;  1ZIV A;  1U9X A;  4PI3 A;  2UZJ A;  1GLO A;  1KHQ A;  1KFX L;  2AGA A;  3K24 A;  2DZY A;  3BCN A;  4D8E A;  2YJB A;  2H7J A;  2JTC A;  2DOS A;  3ZUA A;  8PCH A;  1FH0 A;  2DC8 A;  3OVX A;  4P16 A;  1F2A A;  1CS8 A;  2JRI A;  1AEC A;  5CVO B;  1YAL A;  2ARY A;  1QOL A;  3CH2 X;  3NHE A;  4BOS A;  5KO3 A;  3HD3 A;  1AIM A;  1QMY A;  2O6X A;  4PP2 E;  4WUR A;  4OVZ B;  4X6I A;  1JQP A;  2NQG A;  3MTN A;  2G7Y A;  2OP3 A;  3BBA A;  1MDW A;  3IV2 A;  4MSX A;  3GCB A;  3I3T A;  1THE A;  4BPV A;  3OVZ A;  1ICF A;  1CJL A;  1STF E;  2FQ9 A;  1GEC E;  4Q8G A;  2FTD A;  3PBH A;  3B79 A;  1CB5 A;  1AYW A;  3K9M A;  5A24 A;  2R9M A;  4I07 A;  4QRV A;  1F29 A;  3MJ5 A;  2DCA A;  9PAP A;  1PVJ A;  4MI7 A;  4A5U A;  1U9W A;  3OIS A;  2G8J A;  4P6G A;  1MEM A;  2CB5 A;  2HH5 A;  2E03 A;  1XKG A;  4CDD B;  1YT7 A;  1QXP A;  5F02 A;  4XR7 A;  1PAD A;  3QSD A;  2OUL A;  4IP3 A;  6PAD A;  4CDE B;  2AIM A;  2F1G A;  4YV8 A;  3M99 A;  2XU3 A;  2J7Q A;  4BOQ A;  1CSB B;  2IBI A;  1BQI A;  2AYO A;  5J94 A;  1U9V A;  3O0U A;  2R9F A;  3HHI A;  3OF9 A;  4K7C A;  4QH6 A;  5CHV A;  4KLB A;  3W31 A;  3KX1 A;  2FUD A;  4QRG A;  2E00 A;  2B1N A;  2YJ2 A;  1Y4H A;  3PSE A;  3BWK A;  2NQI A;  1MS6 A;  3HWN A;  2AUX A;  1PIP A;  2P86 A;  2OZ2 A;  2R9O A;  2E01 A;  2PRE A;  3PDF A;  4W5B A;  1PBH A;  4M0W A;  3MP2 A;  3E1Z B;  3HHA A;  4DMY A;  3BPM A;  2P7U A;  3IUT A;  1K3B B;  3IOQ A;  3OQC A;  2C0Y A;  1SP4 B;  4IUM A;  3TRK A;  3PT2 A;  3PHW A;  4W4U A;  4CZW A;  2NQD B;  1PE6 A;  2XU1 A;  3H8C A;  4MZS A;  2E02 A;  4X6J A;  1EWO A;  4BS5 A;  2XU5 A;  5E6J A;  1VJV A;  2DC6 A;  3BC3 A;  1Q6K A;  1O0E A;  1QDQ A;  2HXZ A;  2JQF R;  3E9S A;  1YK7 A;  4YVA A;  4PAD A;  1Y08 A;  3H89 A;  3KW9 A;  2ACT A;  2FT2 A;  4D8I A;  2DC9 A;  2J7Q C;  4Q8H A;  1NL6 A;  1AU0 A;  4WA6 A;  1ME4 A;  1X9Y A;  3MTV A;  2DCB A;  2NQA A;  3IMA A;  3S3Q A;  4OW0 A;  1YK8 A;  3PNR A;  3ERV A;  2HD5 A;  2Y6E A;  2GFO A;  1SNK A;  4YYU A;  3S3R A;  4R3D A;  3IHP A;  3B21 A;  3BOW A;  4XZX A;  4RNA A;  4OEM A;  4OVZ A;  3PW3 A;  4CDF B;  2VHF A;  1AYU A;  1AU3 A; 
#chains in the Genus database with same CATH homology
 1HUC B;  2DJG B;  1EWM A;  2FYE A;  4AXL A;  2PAD A;  1F2B A;  2DZZ A;  3N3K A;  1YVB A;  1IWD A;  4N8W A;  2PBH A;  2CIO A;  1GMY A;  2DJF B;  1S4V A;  2DCD A;  3LXS A;  3P5W A;  4QBB A;  5PAD A;  2R9C A;  3DF0 A;  5K16 A;  2GHU A;  1CVZ A;  1NB5 A;  3OF8 A;  1ATK A;  4X6H A;  1ME3 A;  1NPZ A;  4YYR A;  3K8U A;  1BGO A;  3QT4 A;  1NQC A;  4YYS A;  1CQD A;  1ITO A;  2ATO A;  3MOR A;  1PPN A;  1KXR A;  2YJ9 A;  3D6S A;  3CH3 X;  4MZO A;  3KKU A;  1AU2 A;  4I05 A;  4YYV A;  2YJC A;  1KHP A;  1M6D A;  5CVM A;  3F5V A;  1POP A;  3RVX A;  3RVW A;  1VSN A;  1GCB A;  2AVW A;  4I04 A;  4NV7 A;  2YJ8 A;  4CDC B;  3LFY A;  4YYW A;  1MHW A;  2VFC A;  3MHS A;  3RVV A;  2B1M A;  1A6R A;  4G54 A;  3USV A;  3AI8 A;  5FPW A;  4QRX A;  4BSQ A;  2G8E A;  3O1G A;  3H7D A;  2G6D A;  4BS6 A;  5CHT A;  1CPJ A;  1E2T A;  1EWP A;  1F2C A;  1PCI A;  2AUZ A;  3WXE A;  4ZUX U;  4YYQ A;  4XUI A;  3N3G A;  2FRQ A;  2JQG R;  2AU1 A;  1TU6 A;  2DCC A;  2AS8 A;  1CTE A;  2R9N A;  1AYV A;  2AYN A;  2PNS A;  3LTW A;  4NV8 A;  1BY8 A;  1KFU L;  7PCK A;  2BDZ A;  1DF0 A;  4BQV A;  3P5X A;  2HHN A;  4OEL A;  2WBF X;  3WXF A;  1PPP A;  5CVN B;  2Y5B A;  3U8E A;  3I06 A;  4PP1 A;  1EWL A;  5EF4 A;  4AXM A;  2VHS A;  2P0R A;  4FIP A;  1U5I A;  2FRA A;  1PPO A;  1EF7 A;  3WXG A;  3KFQ A;  1ZCM A;  1CV8 A;  2F7D A;  3F75 A;  4FK5 A;  4DMX A;  1DEU A;  1PPD A;  2XU4 A;  3KWB X;  4HWY A;  3V6E A;  5JH3 A;  4RY2 A;  1MEG A;  4N4Z A;  3P5U A;  1BP4 A;  4N79 A;  3V6C A;  1PXV A;  1W4T A;  1MIR A;  1U9Q X;  3H8B A;  4W5C A;  3IEJ A;  2BDL A;  3CBJ A;  4BGF A;  3BPF A;  1TLO A;  3N4C A;  2IPP B;  3C9E A;  1AU4 A;  4P6E A;  2DC7 A;  5EGW A;  3KWZ A;  4FJC A;  1NB3 A;  2R6N A;  1TL9 A;  3CBK A;  3QJ3 A;  3MHH A;  3KSE A;  5JA7 A;  3TNX A;  3P5V A;  2FO5 A;  1NLJ A;  3H6S A;  1ZIV A;  1U9X A;  4PI3 A;  1GLO A;  1KHQ A;  1KFX L;  3K24 A;  2DZY A;  1W5R A;  3BCN A;  2YJB A;  4B55 A;  2H7J A;  4GUZ A;  3ZUA A;  8PCH A;  1FH0 A;  2DC8 A;  3OVX A;  1F2A A;  1CS8 A;  1AEC A;  5CVO B;  1YAL A;  2ARY A;  1QOL A;  3CH2 X;  3NHE A;  3HD3 A;  1AIM A;  1QMY A;  2O6X A;  4PP2 E;  4X6I A;  1JQP A;  2NQG A;  3MTN A;  2G7Y A;  2VFB A;  2OP3 A;  1MDW A;  3IV2 A;  4MSX A;  3GCB A;  3I3T A;  1THE A;  4BPV A;  1ICF A;  3OVZ A;  1CJL A;  1STF E;  2FQ9 A;  4Q8G A;  1GEC E;  2FTD A;  3PBH A;  3B79 A;  1CB5 A;  1AYW A;  3K9M A;  5A24 A;  2R9M A;  4I07 A;  4QRV A;  1F29 A;  2DCA A;  9PAP A;  1U9W A;  3OIS A;  4P6G A;  2G8J A;  1MEM A;  2CB5 A;  2HH5 A;  2E03 A;  1XKG A;  4CDD B;  1YT7 A;  1QXP A;  5F02 A;  4XR7 A;  1PAD A;  3QSD A;  2OUL A;  6PAD A;  4CDE B;  2AIM A;  2F1G A;  4YV8 A;  3M99 A;  2XU3 A;  1CSB B;  2IBI A;  1BQI A;  2AYO A;  5J94 A;  1U9V A;  3O0U A;  2R9F A;  3HHI A;  3OF9 A;  4K7C A;  4QH6 A;  5CHV A;  4KLB A;  3KX1 A;  2FUD A;  4QRG A;  2E00 A;  2B1N A;  2YJ2 A;  1Y4H A;  3BWK A;  2NQI A;  1MS6 A;  3HWN A;  2AUX A;  1PIP A;  2P86 A;  4C5P A;  1W6F A;  2OZ2 A;  2R9O A;  2E01 A;  2PRE A;  3PDF A;  4W5B A;  1PBH A;  3E1Z B;  3HHA A;  4DMY A;  3BPM A;  2P7U A;  3IUT A;  1K3B B;  3IOQ A;  2C0Y A;  2BSZ A;  1SP4 B;  4W4U A;  4CZW A;  2NQD B;  1PE6 A;  2XU1 A;  3H8C A;  4MZS A;  2E02 A;  4X6J A;  1EWO A;  4BS5 A;  2XU5 A;  1VJV A;  2DC6 A;  3BC3 A;  1Q6K A;  1O0E A;  1QDQ A;  2HXZ A;  2JQF R;  1YK7 A;  4YVA A;  4PAD A;  1GX3 A;  1Y08 A;  3H89 A;  3KW9 A;  2ACT A;  3D9W A;  2FT2 A;  2DC9 A;  4Q8H A;  1NL6 A;  1AU0 A;  4WA6 A;  1ME4 A;  1X9Y A;  2DCB A;  2NQA A;  3IMA A;  3S3Q A;  3PNR A;  1YK8 A;  3ERV A;  2HD5 A;  2Y6E A;  2GFO A;  1SNK A;  4YYU A;  3S3R A;  3IHP A;  3BOW A;  4OEM A;  3PW3 A;  4CDF B;  2VHF A;  1AYU A;  1AU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...