1VSNA

Crystal structure of a potent small molecule inhibitor bound to cathepsin k
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
215
Chain Sequence
APDSIDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKATGALLNLAPQNLVDCVSENDGCGGGYMTNAFQYVQRNRGIDSEDAYPYVGQDESCMYNPTGKAAKCRGYREIPEGNEAALKRAVAAVGPVSVAIDASLTSFQFYSAGVYYDENCSSDALNHAVLAVGYGIQAGNKHWIIKNSWGESWGNAGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of a potent and selective non-basic cathepsin K inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin K
total genus 62
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1vsnA00
2FYEA 1TU6A 4XUIA 1IWDA 2XU1A 2B1MA 3S3RA 1MHWA 2YJ2A 1AECA 2G8JA 2ARYA 2DCCA 1NB5A 3WXEA 3KFQA 4YVAA 1VSNA 4CDEB 3B79A 2PADA 4W5BA 5FPWA 2NQDB 3LFYA 2AYOA 4PADA 2R9NA 4BSQA 1PPPA 5A24A 1MS6A 3IEJA 2PNSA 1ICFA 3KSEA 4KLBA 4CZWA 6PADA 3KKUA 1NQCA 3H8BA 3ZUAA 3BWKA 1PPNA 4CDFB 3IV2A 2XU4A 2AS8A 3BOWA 1BP4A 1PPOA 4YYSA 2R9OA 3CBKA 4N8WA 1KHPA 2NQAA 1CPJA 3O0UA 2NQIA 3K24A 2P86A 4BS5A 3USVA 1ZCMA 2BDZA 2FT2A 4BS6A 4K7CA 2DZZA 1AU3A 4QRVA 1EWLA 2IBIA 2R9CA 4CDDB 3F5VA 1EWMA 2DCAA 3P5XA 1DEUA 1AYWA 3OF9A 3KWZA 3MHSA 5CVNB 3H8CA 3PW3A 1FH0A 2DC7A 1TLOA 1YK7A 3HD3A 3TNXA 4YYWA 1QMYA 3E1ZB 2OP3A 1EWPA 1HUCB 1EWOA 4MZOA 3D6SA 1GMYA 1CVZA 1O0EA 4DMYA 5CVMA 2G8EA 2BDLA 1CJLA 2AU1A 4YV8A 1F29A 4YYUA 1ITOA 3KWBX 3V6CA 3KX1A 3MORA 1K3BB 1AU0A 1M6DA 3DF0A 3RVWA 2FTDA 2O6XA 3IHPA 4FK5A 5JH3A 4QRXA 3HHIA 4CDCB 2WBFX 1MEGA 4QBBA 5EF4A 4P6GA 4RY2A 5CVOB 1SNKA 4BQVA 1PE6A 4G54A 3M99A 3H7DA 1Y4HA 3NHEA 4FIPA 2VHFA 1QOLA 4I07A 2PREA 4X6HA 3K8UA 4WA6A 4N79A 5CHVA 4ZUXU 2H7JA 3BPMA 1GECE 2ATOA 4Q8HA 1AYUA 1Q6KA 4X6JA 9PAPA 2IPPB 3H6SA 3MHHA 2Y5BA 2OULA 1EF7A 2E02A 2FQ9A 2PBHA 1NL6A 1PADA 3U8EA 4DMXA 2F7DA 3PDFA 1CQDA 1PXVA 1KXRA 2R9MA 3IOQA 1PCIA 1ZIVA 1XKGA 1TL9A 3RVXA 1CSBB 3PBHA 2DC9A 1BQIA 1PBHA 2C0YA 1PPDA 2CB5A 1YT7A 3WXFA 4BPVA 4PP2E 2G7YA 2DJFB 2FUDA 2DCDA 3S3QA 4MSXA 1ATKA 1MIRA 3IMAA 4P6EA 5CHTA 3AI8A 2YJBA 2AUZA 1U5IA 2AVWA 3CH3X 4QH6A 1THEA 4I05A 3I3TA 1DF0A 2ACTA 1F2BA 3OISA 4I04A 3QSDA 4AXMA 1PIPA 1BGOA 1SP4B 5JA7A 2YJCA 1X9YA 2E00A 3V6EA 1STFE 4W5CA 3N3GA 3P5UA 2GHUA 4MZSA 1YK8A 3PNRA 3QJ3A 2JQFR 3O1GA 2CIOA 2HHNA 8PCHA 5K16A 2HD5A 1QXPA 3OVXA 2YJ9A 3N3KA 2XU3A 2FRAA 3MTNA 3BCNA 1CV8A 2F1GA 1VJVA 3I06A 3OVZA 1CS8A 1KHQA 2R6NA 5EGWA 1GLOA 2OZ2A 2DC6A 1U9XA 1U9QX 4OEMA 1POPA 3BPFA 3HHAA 2Y6EA 2YJ8A 2AUXA 3QT4A 1F2CA 1U9WA 1AYVA 4OELA 2AYNA 1ME4A 2JQGR 1ME3A 3KW9A 2HH5A 3BC3A 2XU5A 1NLJA 2DJGB 1Y08A 3P5VA 4W4UA 3C9EA 4Q8GA 2FRQA 1AU2A 1KFXL 3ERVA 4PP1A 4PI3A 1F2AA 4X6IA 2R9FA 3OF8A 1MDWA 4QRGA 1KFUL 4FJCA 2B1NA 1A6RA 3F75A 1GCBA 3HWNA 4YYQA 2AIMA 2HXZA 3WXGA 3CBJA 2P0RA 3LXSA 2FO5A 2DCBA 4YYVA 1CTEA 2DC8A 3H89A 1NB3A 1BY8A 5PADA 2VHSA 4YYRA 4AXLA 1YVBA 1AIMA 3CH2X 4HWYA 3K9MA 1U9VA 5J94A 2DZYA 3RVVA 1CB5A 4XR7A 2E01A 1YALA 3IUTA 2P7UA 4N4ZA 2GFOA 3N4CA 7PCKA 2NQGA 2G6DA 5F02A 1NPZA 1MEMA 2E03A 3GCBA 3P5WA 1AU4A 1JQPA 1S4VA 1QDQA
chains in the Genus database with same CATH superfamily
2FYEA 1TU6A 4XUIA 1IWDA 2UZJA 2XU1A 2B1MA 3S3RA 1MHWA 2YJ2A 1AECA 2G8JA 2ARYA 2DCCA 1NB5A 5JZEA 3WXEA 3KFQA 4YVAA 1VSNA 4CDEB 5EZQA 3B79A 2PADA 4W5BA 5FPWA 2NQDB 3LFYA 2AYOA 4PADA 2R9NA 4BOZA 4BSQA 1PPPA 5A24A 1MS6A 3IEJA 2PNSA 1ICFA 3KSEA 4KLBA 4CZWA 6PADA 3KKUA 4XZXA 1NQCA 3H8BA 3IFUA 2JTCA 3ZUAA 3BWKA 3MTVA 4RF1A 2Z84A 1PPNA 4CDFB 3IV2A 2XU4A 2AS8A 3BOWA 5KO3A 1BP4A 1PPOA 4YYSA 2R9OA 3CBKA 4N8WA 4D8EA 1KHPA 3TRKA 2NQAA 1CPJA 3O0UA 2NQIA 3K24A 2P86A 4BS5A 5E6JA 1ZCMA 3USVA 2BDZA 2FT2A 4BS6A 2BTWA 4K7CA 2DZZA 1AU3A 4QRVA 1EWLA 2IBIA 2R9CA 4CDDB 1UKFA 3F5VA 1EWMA 2DCAA 3PHXA 1DEUA 3P5XA 4ZTBA 4GUAA 3MP2A 1AYWA 3OF9A 3KWZA 3MHSA 5CVNB 3H8CA 2J7QC 1FH0A 3PW3A 4RKXA 2DC7A 1TLOA 2BTWB 1YK7A 4D8IA 3HD3A 3TNXA 4YYWA 1QMYA 3E1ZB 3E9SA 4OVZB 2OP3A 1EWPA 1HUCB 4BOPA 1EWOA 4A5UA 4MZOA 3D6SA 1GMYA 1CVZA 1O0EA 1DKIA 4DMYA 5CVMA 2G8EA 4OW0A 3C0RA 2BDLA 1CJLA 2AU1A 4YV8A 1F29A 4YYUA 1ITOA 3KWBX 3V6CA 3KX1A 3MORA 1K3BB 1AU0A 1M6DA 3DF0A 3RVWA 3PSEA 3TMPA 2FTDA 2O6XA 3IHPA 3W30A 4FK5A 5JH3A 4QRXA 3HHIA 4CDCB 3B21A 2WBFX 1MEGA 4QBBA 5EF4A 4P6GA 4RY2A 4BOUA 5CVOB 1SNKA 4BQVA 1PE6A 4G54A 3M99A 3H7DA 1Y4HA 3NHEA 4FIPA 2VHFA 1QOLA 4I07A 2PREA 4X6HA 3K8UA 4WA6A 4N79A 5CHVA 4ZUXU 2H7JA 1JQPA 3BPMA 1GECE 2ATOA 4Q8HA 4BOSA 1AYUA 3PRMA 1Q6KA 3PRPA 4REZA 4X6JA 9PAPA 4IUMA 2IPPB 3H6SA 3MHHA 2Y5BA 2OULA 1EF7A 2E02A 2FQ9A 2PBHA 1NL6A 1PADA 3U8EA 3BB7A 4DMXA 2F7DA 3BY4A 3PDFA 1CQDA 1PXVA 1KXRA 2R9MA 3IOQA 1PCIA 1ZIVA 1XKGA 1TL9A 3RVXA 1CSBB 3PBHA 2DC9A 4RNAA 1BQIA 1PBHA 2C0YA 1PPDA 2CB5A 1YT7A 3WXFA 4BPVA 4PP2E 5EZSA 2G7YA 2DJFB 2FUDA 2DCDA 3S3QA 4MSXA 1ATKA 1MIRA 3IMAA 3MJ5A 3O65A 4BOQA 4P6EA 3PHUA 5CHTA 3AI8A 2YJBA 2AUZA 1U5IA 2AVWA 3CH3X 4QH6A 1THEA 4I05A 3I3TA 4WURA 1DF0A 2ACTA 1F2BA 3OISA 4I04A 3ZNHA 4RF0A 3QSDA 4AXMA 1PIPA 1BGOA 1SP4B 5JA7A 2YJCA 1X9YA 3RNVA 2E00A 3V6EA 1STFE 4W5CA 1PVJA 3N3GA 3P5UA 4OVZA 2GHUA 4MZSA 1YK8A 3PNRA 3QJ3A 2JQFR 3O1GA 2CIOA 2HHNA 8PCHA 5K16A 2HD5A 1QXPA 3OVXA 2YJ9A 3N3KA 2XU3A 2FRAA 3MTNA 3BCNA 1CV8A 2F1GA 1VJVA 3I06A 3BBAA 3OVZA 3PHWA 2J7QA 1CS8A 1KHQA 2R6NA 5EGWA 1GLOA 2OZ2A 3OQCA 2DC6A 1U9XA 4MM3B 1U9QX 4OEMA 1POPA 3BPFA 3HHAA 2Y6EA 2YJ8A 2AUXA 3QT4A 1F2CA 1U9WA 1AYVA 4OELA 4M0WA 2AYNA 1ME4A 2JQGR 1ME3A 3KW9A 3PT2A 2JRIA 2HH5A 3BC3A 2XU5A 1NLJA 2DJGB 1Y08A 3P5VA 4W4UA 3C9EA 4Q8GA 2FRQA 1AU2A 1KFXL 3ERVA 4PP1A 4PI3A 1F2AA 4IP3A 4MI7A 4R3DA 4X6IA 2R9FA 2BU3A 3OF8A 1MDWA 4QRGA 1KFUL 4FJCA 2B1NA 1A6RA 3F75A 1GCBA 2HWKA 3HWNA 4YYQA 2AIMA 2HXZA 3WXGA 3CBJA 2P0RA 3LXSA 2FO5A 2AGAA 4P16A 2DCBA 4YYVA 4D8BA 1CTEA 2DC8A 3H89A 1NB3A 1BY8A 5PADA 2VHSA 4YYRA 4AXLA 2DOSA 1YVBA 1AIMA 3CH2X 4HWYA 3K9MA 2FE8A 1U9VA 5J94A 2DZYA 3RVVA 1CB5A 4XR7A 2E01A 1YALA 1YZBA 3IUTA 3W31A 2P7UA 4PT5A 4N4ZA 2GFOA 3N4CA 7PCKA 2NQGA 2G6DA 5F02A 1NPZA 1MEMA 2E03A 3GCBA 3P5WA 1AU4A 4HXDB 1S4VA 1QDQA
chains in the Genus database with same CATH topology
2FYEA 1TU6A 4XUIA 1IWDA 2XU1A 2B1MA 3S3RA 1MHWA 2YJ2A 1AECA 2G8JA 2ARYA 2DCCA 1NB5A 3WXEA 3KFQA 4YVAA 1VSNA 4CDEB 3B79A 2PADA 4W5BA 5FPWA 2NQDB 3LFYA 2AYOA 4PADA 2R9NA 4BSQA 1PPPA 5A24A 1MS6A 3IEJA 2PNSA 1ICFA 2VFBA 3KSEA 4KLBA 4CZWA 6PADA 3KKUA 1NQCA 3H8BA 3ZUAA 3BWKA 1PPNA 4CDFB 3IV2A 2XU4A 2AS8A 3BOWA 1BP4A 1PPOA 4YYSA 2R9OA 3CBKA 4N8WA 1KHPA 2NQAA 1CPJA 3O0UA 2NQIA 3K24A 2P86A 4BS5A 3USVA 1ZCMA 1W5RA 2BDZA 2FT2A 4BS6A 4K7CA 2DZZA 1AU3A 4QRVA 1EWLA 2IBIA 2R9CA 4CDDB 3F5VA 1EWMA 2DCAA 3P5XA 1DEUA 1AYWA 3OF9A 3KWZA 3MHSA 5CVNB 3H8CA 1W6FA 3PW3A 1FH0A 2DC7A 1TLOA 1YK7A 3HD3A 3TNXA 4YYWA 1QMYA 3E1ZB 3D9WA 2OP3A 1EWPA 1HUCB 1EWOA 4MZOA 3D6SA 1GMYA 1CVZA 1O0EA 4BGFA 4DMYA 5CVMA 2G8EA 2BDLA 1CJLA 2AU1A 4YV8A 1F29A 4YYUA 1ITOA 3KWBX 3V6CA 3KX1A 1W4TA 3MORA 1K3BB 1AU0A 1M6DA 3DF0A 3RVWA 2FTDA 2O6XA 3IHPA 4B55A 4FK5A 5JH3A 4QRXA 3HHIA 4CDCB 2WBFX 1MEGA 4QBBA 5EF4A 4P6GA 4RY2A 5CVOB 1SNKA 4BQVA 1PE6A 4G54A 3M99A 3H7DA 1Y4HA 3NHEA 4FIPA 2VHFA 1QOLA 4I07A 2PREA 4X6HA 3K8UA 4WA6A 4N79A 5CHVA 4ZUXU 2H7JA 3BPMA 1GECE 2ATOA 4Q8HA 1AYUA 1Q6KA 4X6JA 9PAPA 2IPPB 3H6SA 3MHHA 2Y5BA 2OULA 1EF7A 2E02A 2FQ9A 2PBHA 1NL6A 1PADA 3U8EA 4C5PA 4DMXA 2F7DA 3PDFA 1CQDA 1PXVA 1KXRA 2R9MA 3IOQA 1PCIA 1ZIVA 1XKGA 1TL9A 3RVXA 1CSBB 3PBHA 2DC9A 1BQIA 1PBHA 2C0YA 1PPDA 2CB5A 1YT7A 3WXFA 4BPVA 4PP2E 2G7YA 2DJFB 2FUDA 2DCDA 3S3QA 4MSXA 1ATKA 1MIRA 3IMAA 4P6EA 5CHTA 3AI8A 2YJBA 2AUZA 1U5IA 2AVWA 3CH3X 4QH6A 1THEA 4I05A 3I3TA 1DF0A 2ACTA 1F2BA 3OISA 4I04A 3QSDA 4AXMA 1PIPA 1BGOA 1SP4B 5JA7A 2YJCA 1X9YA 2E00A 3V6EA 1STFE 4W5CA 3N3GA 3P5UA 2GHUA 4MZSA 1YK8A 3PNRA 4NV8A 3QJ3A 2JQFR 3O1GA 2CIOA 2HHNA 8PCHA 5K16A 2HD5A 1QXPA 3OVXA 2YJ9A 3N3KA 2XU3A 2FRAA 3MTNA 3BCNA 1CV8A 2F1GA 1VJVA 3I06A 3OVZA 1CS8A 1KHQA 2R6NA 5EGWA 1GLOA 2OZ2A 2DC6A 1U9XA 1U9QX 4OEMA 1POPA 3BPFA 3HHAA 2Y6EA 2YJ8A 2AUXA 3QT4A 2BSZA 1F2CA 1U9WA 1AYVA 4OELA 2AYNA 1ME4A 2JQGR 1ME3A 3KW9A 2HH5A 3BC3A 2XU5A 1NLJA 2DJGB 1Y08A 3P5VA 4W4UA 3C9EA 4Q8GA 2FRQA 1AU2A 1KFXL 3ERVA 4PP1A 4PI3A 1F2AA 4X6IA 4NV7A 2R9FA 3OF8A 1MDWA 4QRGA 1KFUL 4FJCA 2B1NA 1A6RA 3F75A 1GCBA 1E2TA 3HWNA 4YYQA 2AIMA 2HXZA 3WXGA 3CBJA 2P0RA 3LXSA 3LTWA 2FO5A 2DCBA 4YYVA 1GX3A 1CTEA 2DC8A 3H89A 1NB3A 1BY8A 5PADA 2VHSA 4GUZA 4YYRA 2VFCA 4AXLA 1YVBA 1AIMA 3CH2X 4HWYA 3K9MA 1U9VA 5J94A 2DZYA 3RVVA 1CB5A 4XR7A 2E01A 1YALA 3IUTA 2P7UA 4N4ZA 2GFOA 3N4CA 7PCKA 2NQGA 2G6DA 5F02A 1NPZA 1MEMA 2E03A 3GCBA 3P5WA 1AU4A 1JQPA 1S4VA 1QDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYE A;  1TU6 A;  4XUI A;  1IWD A;  2XU1 A;  2B1M A;  3S3R A;  1MHW A;  2YJ2 A;  1AEC A;  2G8J A;  2ARY A;  2DCC A;  1NB5 A;  3WXE A;  3KFQ A;  4YVA A;  1VSN A;  4CDE B;  3B79 A;  2PAD A;  4W5B A;  5FPW A;  2NQD B;  3LFY A;  2AYO A;  4PAD A;  2R9N A;  4BSQ A;  1PPP A;  5A24 A;  1MS6 A;  3IEJ A;  2PNS A;  1ICF A;  3KSE A;  4KLB A;  4CZW A;  6PAD A;  3KKU A;  1NQC A;  3H8B A;  3ZUA A;  3BWK A;  1PPN A;  4CDF B;  3IV2 A;  2XU4 A;  2AS8 A;  3BOW A;  1BP4 A;  1PPO A;  4YYS A;  2R9O A;  3CBK A;  4N8W A;  1KHP A;  2NQA A;  1CPJ A;  3O0U A;  2NQI A;  3K24 A;  2P86 A;  4BS5 A;  3USV A;  1ZCM A;  2BDZ A;  2FT2 A;  4BS6 A;  4K7C A;  2DZZ A;  1AU3 A;  4QRV A;  1EWL A;  2IBI A;  2R9C A;  4CDD B;  3F5V A;  1EWM A;  2DCA A;  3P5X A;  1DEU A;  1AYW A;  3OF9 A;  3KWZ A;  3MHS A;  5CVN B;  3H8C A;  3PW3 A;  1FH0 A;  2DC7 A;  1TLO A;  1YK7 A;  3HD3 A;  3TNX A;  4YYW A;  1QMY A;  3E1Z B;  2OP3 A;  1EWP A;  1HUC B;  1EWO A;  4MZO A;  3D6S A;  1GMY A;  1CVZ A;  1O0E A;  4DMY A;  5CVM A;  2G8E A;  2BDL A;  1CJL A;  2AU1 A;  4YV8 A;  1F29 A;  4YYU A;  1ITO A;  3KWB X;  3V6C A;  3KX1 A;  3MOR A;  1K3B B;  1AU0 A;  1M6D A;  3DF0 A;  3RVW A;  2FTD A;  2O6X A;  3IHP A;  4FK5 A;  5JH3 A;  4QRX A;  3HHI A;  4CDC B;  2WBF X;  1MEG A;  4QBB A;  5EF4 A;  4P6G A;  4RY2 A;  5CVO B;  1SNK A;  4BQV A;  1PE6 A;  4G54 A;  3M99 A;  3H7D A;  1Y4H A;  3NHE A;  4FIP A;  2VHF A;  1QOL A;  4I07 A;  2PRE A;  4X6H A;  3K8U A;  4WA6 A;  4N79 A;  5CHV A;  4ZUX U;  2H7J A;  3BPM A;  1GEC E;  2ATO A;  4Q8H A;  1AYU A;  1Q6K A;  4X6J A;  9PAP A;  2IPP B;  3H6S A;  3MHH A;  2Y5B A;  2OUL A;  1EF7 A;  2E02 A;  2FQ9 A;  2PBH A;  1NL6 A;  1PAD A;  3U8E A;  4DMX A;  2F7D A;  3PDF A;  1CQD A;  1PXV A;  1KXR A;  2R9M A;  3IOQ A;  1PCI A;  1ZIV A;  1XKG A;  1TL9 A;  3RVX A;  1CSB B;  3PBH A;  2DC9 A;  1BQI A;  1PBH A;  2C0Y A;  1PPD A;  2CB5 A;  1YT7 A;  3WXF A;  4BPV A;  4PP2 E;  2G7Y A;  2DJF B;  2FUD A;  2DCD A;  3S3Q A;  4MSX A;  1ATK A;  1MIR A;  3IMA A;  4P6E A;  5CHT A;  3AI8 A;  2YJB A;  2AUZ A;  1U5I A;  2AVW A;  3CH3 X;  4QH6 A;  1THE A;  4I05 A;  3I3T A;  1DF0 A;  2ACT A;  1F2B A;  3OIS A;  4I04 A;  3QSD A;  4AXM A;  1PIP A;  1BGO A;  1SP4 B;  5JA7 A;  2YJC A;  1X9Y A;  2E00 A;  3V6E A;  1STF E;  4W5C A;  3N3G A;  3P5U A;  2GHU A;  4MZS A;  1YK8 A;  3PNR A;  3QJ3 A;  2JQF R;  3O1G A;  2CIO A;  2HHN A;  8PCH A;  5K16 A;  2HD5 A;  1QXP A;  3OVX A;  2YJ9 A;  3N3K A;  2XU3 A;  2FRA A;  3MTN A;  3BCN A;  1CV8 A;  2F1G A;  1VJV A;  3I06 A;  3OVZ A;  1CS8 A;  1KHQ A;  2R6N A;  5EGW A;  1GLO A;  2OZ2 A;  2DC6 A;  1U9X A;  1U9Q X;  4OEM A;  1POP A;  3BPF A;  3HHA A;  2Y6E A;  2YJ8 A;  2AUX A;  3QT4 A;  1F2C A;  1U9W A;  1AYV A;  4OEL A;  2AYN A;  1ME4 A;  2JQG R;  1ME3 A;  3KW9 A;  2HH5 A;  3BC3 A;  2XU5 A;  1NLJ A;  2DJG B;  1Y08 A;  3P5V A;  4W4U A;  3C9E A;  4Q8G A;  2FRQ A;  1AU2 A;  1KFX L;  3ERV A;  4PP1 A;  4PI3 A;  1F2A A;  4X6I A;  2R9F A;  3OF8 A;  1MDW A;  4QRG A;  1KFU L;  4FJC A;  2B1N A;  1A6R A;  3F75 A;  1GCB A;  3HWN A;  4YYQ A;  2AIM A;  2HXZ A;  3WXG A;  3CBJ A;  2P0R A;  3LXS A;  2FO5 A;  2DCB A;  4YYV A;  1CTE A;  2DC8 A;  3H89 A;  1NB3 A;  1BY8 A;  5PAD A;  2VHS A;  4YYR A;  4AXL A;  1YVB A;  1AIM A;  3CH2 X;  4HWY A;  3K9M A;  1U9V A;  5J94 A;  2DZY A;  3RVV A;  1CB5 A;  4XR7 A;  2E01 A;  1YAL A;  3IUT A;  2P7U A;  4N4Z A;  2GFO A;  3N4C A;  7PCK A;  2NQG A;  2G6D A;  5F02 A;  1NPZ A;  1MEM A;  2E03 A;  3GCB A;  3P5W A;  1AU4 A;  1JQP A;  1S4V A;  1QDQ A; 
#chains in the Genus database with same CATH topology
 2FYE A;  1TU6 A;  4XUI A;  1IWD A;  2UZJ A;  2XU1 A;  2B1M A;  3S3R A;  1MHW A;  2YJ2 A;  1AEC A;  2G8J A;  2ARY A;  2DCC A;  1NB5 A;  5JZE A;  3WXE A;  3KFQ A;  4YVA A;  1VSN A;  4CDE B;  5EZQ A;  3B79 A;  2PAD A;  4W5B A;  5FPW A;  2NQD B;  3LFY A;  2AYO A;  4PAD A;  2R9N A;  4BOZ A;  4BSQ A;  1PPP A;  5A24 A;  1MS6 A;  3IEJ A;  2PNS A;  1ICF A;  3KSE A;  4KLB A;  4CZW A;  6PAD A;  3KKU A;  4XZX A;  1NQC A;  3H8B A;  3IFU A;  2JTC A;  3ZUA A;  3BWK A;  3MTV A;  4RF1 A;  2Z84 A;  1PPN A;  4CDF B;  3IV2 A;  2XU4 A;  2AS8 A;  3BOW A;  5KO3 A;  1BP4 A;  1PPO A;  4YYS A;  2R9O A;  3CBK A;  4N8W A;  4D8E A;  1KHP A;  3TRK A;  2NQA A;  1CPJ A;  3O0U A;  2NQI A;  3K24 A;  2P86 A;  4BS5 A;  5E6J A;  1ZCM A;  3USV A;  2BDZ A;  2FT2 A;  4BS6 A;  2BTW A;  4K7C A;  2DZZ A;  1AU3 A;  4QRV A;  1EWL A;  2IBI A;  2R9C A;  4CDD B;  1UKF A;  3F5V A;  1EWM A;  2DCA A;  3PHX A;  1DEU A;  3P5X A;  4ZTB A;  4GUA A;  3MP2 A;  1AYW A;  3OF9 A;  3KWZ A;  3MHS A;  5CVN B;  3H8C A;  2J7Q C;  1FH0 A;  3PW3 A;  4RKX A;  2DC7 A;  1TLO A;  2BTW B;  1YK7 A;  4D8I A;  3HD3 A;  3TNX A;  4YYW A;  1QMY A;  3E1Z B;  3E9S A;  4OVZ B;  2OP3 A;  1EWP A;  1HUC B;  4BOP A;  1EWO A;  4A5U A;  4MZO A;  3D6S A;  1GMY A;  1CVZ A;  1O0E A;  1DKI A;  4DMY A;  5CVM A;  2G8E A;  4OW0 A;  3C0R A;  2BDL A;  1CJL A;  2AU1 A;  4YV8 A;  1F29 A;  4YYU A;  1ITO A;  3KWB X;  3V6C A;  3KX1 A;  3MOR A;  1K3B B;  1AU0 A;  1M6D A;  3DF0 A;  3RVW A;  3PSE A;  3TMP A;  2FTD A;  2O6X A;  3IHP A;  3W30 A;  4FK5 A;  5JH3 A;  4QRX A;  3HHI A;  4CDC B;  3B21 A;  2WBF X;  1MEG A;  4QBB A;  5EF4 A;  4P6G A;  4RY2 A;  4BOU A;  5CVO B;  1SNK A;  4BQV A;  1PE6 A;  4G54 A;  3M99 A;  3H7D A;  1Y4H A;  3NHE A;  4FIP A;  2VHF A;  1QOL A;  4I07 A;  2PRE A;  4X6H A;  3K8U A;  4WA6 A;  4N79 A;  5CHV A;  4ZUX U;  2H7J A;  1JQP A;  3BPM A;  1GEC E;  2ATO A;  4Q8H A;  4BOS A;  1AYU A;  3PRM A;  1Q6K A;  3PRP A;  4REZ A;  4X6J A;  9PAP A;  4IUM A;  2IPP B;  3H6S A;  3MHH A;  2Y5B A;  2OUL A;  1EF7 A;  2E02 A;  2FQ9 A;  2PBH A;  1NL6 A;  1PAD A;  3U8E A;  3BB7 A;  4DMX A;  2F7D A;  3BY4 A;  3PDF A;  1CQD A;  1PXV A;  1KXR A;  2R9M A;  3IOQ A;  1PCI A;  1ZIV A;  1XKG A;  1TL9 A;  3RVX A;  1CSB B;  3PBH A;  2DC9 A;  4RNA A;  1BQI A;  1PBH A;  2C0Y A;  1PPD A;  2CB5 A;  1YT7 A;  3WXF A;  4BPV A;  4PP2 E;  5EZS A;  2G7Y A;  2DJF B;  2FUD A;  2DCD A;  3S3Q A;  4MSX A;  1ATK A;  1MIR A;  3IMA A;  3MJ5 A;  3O65 A;  4BOQ A;  4P6E A;  3PHU A;  5CHT A;  3AI8 A;  2YJB A;  2AUZ A;  1U5I A;  2AVW A;  3CH3 X;  4QH6 A;  1THE A;  4I05 A;  3I3T A;  4WUR A;  1DF0 A;  2ACT A;  1F2B A;  3OIS A;  4I04 A;  3ZNH A;  4RF0 A;  3QSD A;  4AXM A;  1PIP A;  1BGO A;  1SP4 B;  5JA7 A;  2YJC A;  1X9Y A;  3RNV A;  2E00 A;  3V6E A;  1STF E;  4W5C A;  1PVJ A;  3N3G A;  3P5U A;  4OVZ A;  2GHU A;  4MZS A;  1YK8 A;  3PNR A;  3QJ3 A;  2JQF R;  3O1G A;  2CIO A;  2HHN A;  8PCH A;  5K16 A;  2HD5 A;  1QXP A;  3OVX A;  2YJ9 A;  3N3K A;  2XU3 A;  2FRA A;  3MTN A;  3BCN A;  1CV8 A;  2F1G A;  1VJV A;  3I06 A;  3BBA A;  3OVZ A;  3PHW A;  2J7Q A;  1CS8 A;  1KHQ A;  2R6N A;  5EGW A;  1GLO A;  2OZ2 A;  3OQC A;  2DC6 A;  1U9X A;  4MM3 B;  1U9Q X;  4OEM A;  1POP A;  3BPF A;  3HHA A;  2Y6E A;  2YJ8 A;  2AUX A;  3QT4 A;  1F2C A;  1U9W A;  1AYV A;  4OEL A;  4M0W A;  2AYN A;  1ME4 A;  2JQG R;  1ME3 A;  3KW9 A;  3PT2 A;  2JRI A;  2HH5 A;  3BC3 A;  2XU5 A;  1NLJ A;  2DJG B;  1Y08 A;  3P5V A;  4W4U A;  3C9E A;  4Q8G A;  2FRQ A;  1AU2 A;  1KFX L;  3ERV A;  4PP1 A;  4PI3 A;  1F2A A;  4IP3 A;  4MI7 A;  4R3D A;  4X6I A;  2R9F A;  2BU3 A;  3OF8 A;  1MDW A;  4QRG A;  1KFU L;  4FJC A;  2B1N A;  1A6R A;  3F75 A;  1GCB A;  2HWK A;  3HWN A;  4YYQ A;  2AIM A;  2HXZ A;  3WXG A;  3CBJ A;  2P0R A;  3LXS A;  2FO5 A;  2AGA A;  4P16 A;  2DCB A;  4YYV A;  4D8B A;  1CTE A;  2DC8 A;  3H89 A;  1NB3 A;  1BY8 A;  5PAD A;  2VHS A;  4YYR A;  4AXL A;  2DOS A;  1YVB A;  1AIM A;  3CH2 X;  4HWY A;  3K9M A;  2FE8 A;  1U9V A;  5J94 A;  2DZY A;  3RVV A;  1CB5 A;  4XR7 A;  2E01 A;  1YAL A;  1YZB A;  3IUT A;  3W31 A;  2P7U A;  4PT5 A;  4N4Z A;  2GFO A;  3N4C A;  7PCK A;  2NQG A;  2G6D A;  5F02 A;  1NPZ A;  1MEM A;  2E03 A;  3GCB A;  3P5W A;  1AU4 A;  4HXD B;  1S4V A;  1QDQ A; 
#chains in the Genus database with same CATH homology
 2FYE A;  1TU6 A;  4XUI A;  1IWD A;  2XU1 A;  2B1M A;  3S3R A;  1MHW A;  2YJ2 A;  1AEC A;  2G8J A;  2ARY A;  2DCC A;  1NB5 A;  3WXE A;  3KFQ A;  4YVA A;  1VSN A;  4CDE B;  3B79 A;  2PAD A;  4W5B A;  5FPW A;  2NQD B;  3LFY A;  2AYO A;  4PAD A;  2R9N A;  4BSQ A;  1PPP A;  5A24 A;  1MS6 A;  3IEJ A;  2PNS A;  1ICF A;  2VFB A;  3KSE A;  4KLB A;  4CZW A;  6PAD A;  3KKU A;  1NQC A;  3H8B A;  3ZUA A;  3BWK A;  1PPN A;  4CDF B;  3IV2 A;  2XU4 A;  2AS8 A;  3BOW A;  1BP4 A;  1PPO A;  4YYS A;  2R9O A;  3CBK A;  4N8W A;  1KHP A;  2NQA A;  1CPJ A;  3O0U A;  2NQI A;  3K24 A;  2P86 A;  4BS5 A;  3USV A;  1ZCM A;  1W5R A;  2BDZ A;  2FT2 A;  4BS6 A;  4K7C A;  2DZZ A;  1AU3 A;  4QRV A;  1EWL A;  2IBI A;  2R9C A;  4CDD B;  3F5V A;  1EWM A;  2DCA A;  3P5X A;  1DEU A;  1AYW A;  3OF9 A;  3KWZ A;  3MHS A;  5CVN B;  3H8C A;  1W6F A;  3PW3 A;  1FH0 A;  2DC7 A;  1TLO A;  1YK7 A;  3HD3 A;  3TNX A;  4YYW A;  1QMY A;  3E1Z B;  3D9W A;  2OP3 A;  1EWP A;  1HUC B;  1EWO A;  4MZO A;  3D6S A;  1GMY A;  1CVZ A;  1O0E A;  4BGF A;  4DMY A;  5CVM A;  2G8E A;  2BDL A;  1CJL A;  2AU1 A;  4YV8 A;  1F29 A;  4YYU A;  1ITO A;  3KWB X;  3V6C A;  3KX1 A;  1W4T A;  3MOR A;  1K3B B;  1AU0 A;  1M6D A;  3DF0 A;  3RVW A;  2FTD A;  2O6X A;  3IHP A;  4B55 A;  4FK5 A;  5JH3 A;  4QRX A;  3HHI A;  4CDC B;  2WBF X;  1MEG A;  4QBB A;  5EF4 A;  4P6G A;  4RY2 A;  5CVO B;  1SNK A;  4BQV A;  1PE6 A;  4G54 A;  3M99 A;  3H7D A;  1Y4H A;  3NHE A;  4FIP A;  2VHF A;  1QOL A;  4I07 A;  2PRE A;  4X6H A;  3K8U A;  4WA6 A;  4N79 A;  5CHV A;  4ZUX U;  2H7J A;  3BPM A;  1GEC E;  2ATO A;  4Q8H A;  1AYU A;  1Q6K A;  4X6J A;  9PAP A;  2IPP B;  3H6S A;  3MHH A;  2Y5B A;  2OUL A;  1EF7 A;  2E02 A;  2FQ9 A;  2PBH A;  1NL6 A;  1PAD A;  3U8E A;  4C5P A;  4DMX A;  2F7D A;  3PDF A;  1CQD A;  1PXV A;  1KXR A;  2R9M A;  3IOQ A;  1PCI A;  1ZIV A;  1XKG A;  1TL9 A;  3RVX A;  1CSB B;  3PBH A;  2DC9 A;  1BQI A;  1PBH A;  2C0Y A;  1PPD A;  2CB5 A;  1YT7 A;  3WXF A;  4BPV A;  4PP2 E;  2G7Y A;  2DJF B;  2FUD A;  2DCD A;  3S3Q A;  4MSX A;  1ATK A;  1MIR A;  3IMA A;  4P6E A;  5CHT A;  3AI8 A;  2YJB A;  2AUZ A;  1U5I A;  2AVW A;  3CH3 X;  4QH6 A;  1THE A;  4I05 A;  3I3T A;  1DF0 A;  2ACT A;  1F2B A;  3OIS A;  4I04 A;  3QSD A;  4AXM A;  1PIP A;  1BGO A;  1SP4 B;  5JA7 A;  2YJC A;  1X9Y A;  2E00 A;  3V6E A;  1STF E;  4W5C A;  3N3G A;  3P5U A;  2GHU A;  4MZS A;  1YK8 A;  3PNR A;  4NV8 A;  3QJ3 A;  2JQF R;  3O1G A;  2CIO A;  2HHN A;  8PCH A;  5K16 A;  2HD5 A;  1QXP A;  3OVX A;  2YJ9 A;  3N3K A;  2XU3 A;  2FRA A;  3MTN A;  3BCN A;  1CV8 A;  2F1G A;  1VJV A;  3I06 A;  3OVZ A;  1CS8 A;  1KHQ A;  2R6N A;  5EGW A;  1GLO A;  2OZ2 A;  2DC6 A;  1U9X A;  1U9Q X;  4OEM A;  1POP A;  3BPF A;  3HHA A;  2Y6E A;  2YJ8 A;  2AUX A;  3QT4 A;  2BSZ A;  1F2C A;  1U9W A;  1AYV A;  4OEL A;  2AYN A;  1ME4 A;  2JQG R;  1ME3 A;  3KW9 A;  2HH5 A;  3BC3 A;  2XU5 A;  1NLJ A;  2DJG B;  1Y08 A;  3P5V A;  4W4U A;  3C9E A;  4Q8G A;  2FRQ A;  1AU2 A;  1KFX L;  3ERV A;  4PP1 A;  4PI3 A;  1F2A A;  4X6I A;  4NV7 A;  2R9F A;  3OF8 A;  1MDW A;  4QRG A;  1KFU L;  4FJC A;  2B1N A;  1A6R A;  3F75 A;  1GCB A;  1E2T A;  3HWN A;  4YYQ A;  2AIM A;  2HXZ A;  3WXG A;  3CBJ A;  2P0R A;  3LXS A;  3LTW A;  2FO5 A;  2DCB A;  4YYV A;  1GX3 A;  1CTE A;  2DC8 A;  3H89 A;  1NB3 A;  1BY8 A;  5PAD A;  2VHS A;  4GUZ A;  4YYR A;  2VFC A;  4AXL A;  1YVB A;  1AIM A;  3CH2 X;  4HWY A;  3K9M A;  1U9V A;  5J94 A;  2DZY A;  3RVV A;  1CB5 A;  4XR7 A;  2E01 A;  1YAL A;  3IUT A;  2P7U A;  4N4Z A;  2GFO A;  3N4C A;  7PCK A;  2NQG A;  2G6D A;  5F02 A;  1NPZ A;  1MEM A;  2E03 A;  3GCB A;  3P5W A;  1AU4 A;  1JQP A;  1S4V A;  1QDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...