1VSNA

Crystal structure of a potent small molecule inhibitor bound to cathepsin k
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
215
Chain Sequence
APDSIDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKATGALLNLAPQNLVDCVSENDGCGGGYMTNAFQYVQRNRGIDSEDAYPYVGQDESCMYNPTGKAAKCRGYREIPEGNEAALKRAVAAVGPVSVAIDASLTSFQFYSAGVYYDENCSSDALNHAVLAVGYGIQAGNKHWIIKNSWGESWGNAGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin K
publication title Identification of a potent and selective non-basic cathepsin K inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 62
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1vsnA00
4P6GA 1AYUA 3WXGA 3MHHA 2PREA 3BC3A 4N79A 1CVZA 2ACTA 1TLOA 4HWYA 3USVA 1THEA 1QXPA 4I07A 5F02A 4YYVA 2FYEA 2FO5A 3I06A 2AIMA 4Q8HA 4QH6A 2VHFA 2ARYA 3OF8A 2OP3A 4FK5A 1ICFA 1PPOA 2XU1A 3HHAA 2OZ2A 3CH2X 3IEJA 3M99A 3C9EA 3OISA 3K9MA 3CBKA 4QRGA 3DF0A 4CDDB 2DJFB 1GCBA 3RVVA 4BQVA 2XU3A 2WBFX 3IUTA 2B1NA 1DF0A 5PADA 2IPPB 2Y6EA 2R9CA 2G8JA 3N3GA 2G6DA 1SP4B 4X6JA 1ME3A 1NL6A 2BDLA 2O6XA 1XKGA 1KHPA 2NQDB 3HHIA 1EWMA 2PBHA 4G54A 1NB5A 2YJ2A 4I04A 2FRAA 4FIPA 1CV8A 2P7UA 2HHNA 4P6EA 3B79A 9PAPA 3NHEA 1A6RA 1KFUL 2FT2A 2PNSA 1QDQA 4BS6A 4PP1A 2P0RA 4ZUXU 1YALA 4DMYA 1CPJA 4MZOA 2E02A 3N3KA 2B1MA 3H89A 1PE6A 1MDWA 1BGOA 1CTEA 3E1ZB 2R9OA 3V6CA 5CHTA 1TL9A 2G8EA 2AU1A 1YK8A 4PADA 2YJCA 2YJBA 1CSBB 4FJCA 5K16A 3D6SA 1AU0A 2E00A 2NQIA 2HH5A 7PCKA 1ZIVA 1F2CA 3LFYA 4N4ZA 4X6IA 1PCIA 4WA6A 2DCAA 3WXFA 1GECE 3H8BA 4CZWA 4KLBA 1PXVA 1ITOA 1CS8A 1BY8A 3MORA 1CB5A 1BQIA 3P5UA 1CJLA 4YV8A 1PPNA 4MSXA 3IMAA 5JH3A 1S4VA 3PNRA 3IOQA 4XUIA 3HWNA 1NLJA 1FH0A 1PBHA 2DC8A 1MHWA 3CBJA 1ZCMA 1AYVA 1U5IA 4W5CA 2XU4A 3F75A 3IV2A 5EGWA 1STFE 3ZUAA 8PCHA 4YYWA 3PDFA 1AYWA 1EWLA 2VHSA 4AXLA 3BWKA 1O0EA 1ATKA 1EWPA 3MHSA 2XU5A 3F5VA 3MTNA 1PPDA 4W5BA 2H7JA 6PADA 4RY2A 1YK7A 4DMXA 2JQGR 3OVXA 3H6SA 3HD3A 5CHVA 1AECA 2AUZA 5J94A 4AXMA 3KSEA 3OVZA 4CDCB 1Y4HA 1VSNA 1PADA 4QRVA 3PBHA 2ATOA 4XR7A 3P5VA 1BP4A 2DCDA 2AYOA 2FQ9A 2FUDA 2E03A 3KW9A 4Q8GA 1TU6A 2AVWA 1JQPA 3V6EA 2F7DA 4PP2E 4PI3A 4CDEB 2YJ9A 3U8EA 3ERVA 2JQFR 1F2BA 2F1GA 3S3RA 3K24A 3LXSA 3S3QA 2CB5A 3QJ3A 4QBBA 1CQDA 1MIRA 1M6DA 4YYQA 1PIPA 1MS6A 1YVBA 2NQAA 1F29A 4BPVA 5JA7A 1KXRA 3QT4A 4OEMA 2HD5A 2FRQA 2DCBA 2C0YA 1DEUA 3BOWA 1YT7A 3RVXA 1NB3A 3IHPA 1VJVA 1MEMA 2DC9A 3OF9A 1AU3A 2AS8A 2NQGA 1SNKA 2DC7A 1IWDA 2HXZA 2GHUA 3GCBA 1MEGA 2IBIA 3K8UA 3KKUA 3RVWA 2PADA 1AU4A 4K7CA 3BPFA 3BCNA 2R9NA 1AIMA 5A24A 5FPWA 1U9XA 2DC6A 1AU2A 2DZZA 3P5WA 1X9YA 1EWOA 4CDFB 4BSQA 2R9MA 5EF4A 3O0UA 1Q6KA 3O1GA 1GMYA 2DJGB 2DZYA 4MZSA 5CVMA 3P5XA 1POPA 2BDZA 3QSDA 1Y08A 4W4UA 1PPPA 2GFOA 3KFQA 2G7YA 5CVNB 3H7DA 1NPZA 2YJ8A 3AI8A 4I05A 1U9WA 2FTDA 1EF7A 1F2AA 4X6HA 3KWZA 3TNXA 5CVOB 1ME4A 3I3TA 1U9QX 1NQCA 2AYNA 3PW3A 4YYRA 1QOLA 3WXEA 4QRXA 2R9FA 2AUXA 4YVAA 3BPMA 3KX1A 3KWBX 2DCCA 4OELA 2CIOA 2E01A 1KFXL 4YYSA 1GLOA 4N8WA 2OULA 1U9VA 2P86A 3CH3X 3N4CA 1KHQA 1K3BB 2R6NA 4BS5A 1QMYA 2Y5BA 4YYUA 1HUCB 3H8CA
chains in the Genus database with same CATH superfamily
4P6GA 1AYUA 3WXGA 2AGAA 3MHHA 4R3DA 3BBAA 2PREA 4MI7A 3BC3A 4N79A 1CVZA 2ACTA 1TLOA 4HWYA 3USVA 1THEA 1QXPA 4XZXA 4I07A 3C0RA 5F02A 4YYVA 2FYEA 2FO5A 5KO3A 3I06A 2AIMA 4Q8HA 4QH6A 2VHFA 3PHUA 2ARYA 3OF8A 2OP3A 4FK5A 1ICFA 1PPOA 2XU1A 3HHAA 2OZ2A 3CH2X 3IEJA 3M99A 3C9EA 3MTVA 3OISA 3K9MA 3CBKA 4QRGA 3DF0A 4CDDB 4D8EA 2DJFB 1GCBA 3RVVA 4BQVA 2XU3A 2WBFX 3IUTA 2B1NA 1DF0A 5PADA 2IPPB 2Y6EA 2R9CA 3MJ5A 2G8JA 3N3GA 2G6DA 1SP4B 2FE8A 3PHWA 4X6JA 1ME3A 1NL6A 2BDLA 2O6XA 1XKGA 1KHPA 2UZJA 2NQDB 3HHIA 2BTWA 1EWMA 2PBHA 4G54A 1NB5A 2YJ2A 4I04A 2FRAA 4FIPA 1CV8A 3MP2A 2P7UA 2HHNA 3TMPA 4P6EA 3B79A 9PAPA 3NHEA 1A6RA 1KFUL 2FT2A 2PNSA 1QDQA 4BS6A 4PP1A 2P0RA 4ZUXU 1YALA 4DMYA 1CPJA 4M0WA 4MZOA 2E02A 3N3KA 2B1MA 3H89A 4BOUA 1PE6A 4BOQA 1MDWA 1BGOA 2BU3A 1CTEA 3E1ZB 2R9OA 3V6CA 5CHTA 1TL9A 2G8EA 2AU1A 1YK8A 4BOZA 4PADA 2YJCA 4ZTBA 2YJBA 1CSBB 3PRMA 3O65A 4FJCA 5K16A 3D6SA 1AU0A 2E00A 2NQIA 2HH5A 4MM3B 7PCKA 1ZIVA 1F2CA 3LFYA 4N4ZA 3PSEA 4X6IA 5E6JA 1PCIA 4WA6A 2DCAA 5EZQA 3WXFA 1GECE 3H8BA 4CZWA 4PT5A 4KLBA 1PXVA 1ITOA 1CS8A 1BY8A 3MORA 1CB5A 1BQIA 3P5UA 1CJLA 4YV8A 1PPNA 4MSXA 3IMAA 4RKXA 1S4VA 3PNRA 3B21A 5JH3A 3IOQA 4XUIA 3HWNA 1NLJA 4GUAA 1FH0A 1PBHA 2DC8A 1MHWA 3CBJA 1ZCMA 1AYVA 1U5IA 4W5CA 2XU4A 3F75A 3IV2A 5EGWA 4D8BA 1STFE 3ZUAA 8PCHA 4YYWA 3PDFA 1AYWA 1EWLA 2VHSA 4AXLA 3BWKA 4REZA 1O0EA 1ATKA 1EWPA 4OVZA 3MHSA 2XU5A 3F5VA 3MTNA 1PPDA 4W5BA 2H7JA 6PADA 1PVJA 4RY2A 1YK7A 4DMXA 2JQGR 3OVXA 3H6SA 3HD3A 5CHVA 1AECA 2AUZA 1UKFA 5J94A 3ZNHA 3W31A 4AXMA 3KSEA 3OVZA 4CDCB 1Y4HA 1VSNA 4RF1A 4OVZB 1PADA 4QRVA 3PBHA 3IFUA 2ATOA 4XR7A 3P5VA 1BP4A 2DCDA 2AYOA 2FQ9A 2FUDA 2E03A 3KW9A 4Q8GA 1TU6A 2AVWA 1JQPA 3V6EA 2F7DA 4PP2E 2BTWB 4PI3A 4CDEB 2YJ9A 3E9SA 3U8EA 3ERVA 2JQFR 1F2BA 5EZSA 2F1GA 3S3RA 3K24A 3LXSA 3S3QA 3OQCA 2CB5A 2J7QC 3QJ3A 4QBBA 1CQDA 1MIRA 1M6DA 4YYQA 4IP3A 1PIPA 1MS6A 4IUMA 1YVBA 2NQAA 1F29A 4BPVA 5JA7A 3PT2A 1KXRA 3QT4A 4OEMA 2HD5A 3BY4A 2FRQA 2DCBA 2C0YA 1DEUA 2J7QA 3BOWA 1YT7A 3RVXA 1NB3A 4P16A 3IHPA 1VJVA 1MEMA 2DC9A 3OF9A 1AU3A 2AS8A 1YZBA 2NQGA 1SNKA 2DC7A 1IWDA 2HXZA 2GHUA 3GCBA 1MEGA 2IBIA 3K8UA 3KKUA 3RVWA 2PADA 1AU4A 4K7CA 3BPFA 3BCNA 2R9NA 1AIMA 5A24A 5FPWA 1U9XA 2DC6A 1AU2A 5JZEA 2DZZA 3P5WA 1X9YA 1EWOA 2JRIA 4CDFB 4BSQA 2R9MA 5EF4A 3O0UA 3RNVA 2HWKA 1Q6KA 3O1GA 2Z84A 1GMYA 2DJGB 2DZYA 4MZSA 5CVMA 3P5XA 1POPA 2BDZA 1DKIA 2DOSA 3QSDA 1Y08A 4W4UA 1PPPA 4A5UA 4BOPA 2GFOA 3KFQA 2G7YA 5CVNB 3H7DA 1NPZA 2YJ8A 3AI8A 4HXDB 4I05A 1U9WA 2FTDA 1EF7A 1F2AA 4X6HA 3TRKA 3KWZA 3TNXA 5CVOB 1ME4A 3I3TA 1U9QX 4BOSA 1NQCA 2AYNA 3PW3A 3BB7A 4YYRA 4WURA 1QOLA 4D8IA 3WXEA 4QRXA 2R9FA 2AUXA 4YVAA 3BPMA 3PRPA 3W30A 3KX1A 3KWBX 2DCCA 2JTCA 4OELA 2CIOA 2E01A 1KFXL 4YYSA 1GLOA 4N8WA 2OULA 1U9VA 2P86A 4RNAA 4OW0A 3CH3X 3N4CA 1KHQA 4RF0A 1K3BB 2R6NA 4BS5A 1QMYA 3PHXA 2Y5BA 4YYUA 1HUCB 3H8CA
chains in the Genus database with same CATH topology
4P6GA 1AYUA 3WXGA 2VFBA 3MHHA 2PREA 3BC3A 4N79A 1CVZA 2ACTA 1TLOA 4HWYA 3USVA 1THEA 1QXPA 4I07A 5F02A 4YYVA 2FYEA 2FO5A 3I06A 2AIMA 4Q8HA 4QH6A 2VHFA 2ARYA 3OF8A 2OP3A 4FK5A 1ICFA 1PPOA 2XU1A 3HHAA 2OZ2A 3CH2X 3IEJA 3M99A 3C9EA 3OISA 3K9MA 3CBKA 4QRGA 3DF0A 4CDDB 2DJFB 1GCBA 3RVVA 4BQVA 2XU3A 2WBFX 3IUTA 2B1NA 1DF0A 5PADA 2IPPB 2Y6EA 2R9CA 2G8JA 3N3GA 2G6DA 1E2TA 1SP4B 4X6JA 1ME3A 1NL6A 2BDLA 2O6XA 1XKGA 1KHPA 4B55A 2NQDB 3HHIA 1EWMA 2PBHA 4G54A 1NB5A 2YJ2A 4I04A 2FRAA 4FIPA 1CV8A 2P7UA 2HHNA 4P6EA 3B79A 9PAPA 3NHEA 1A6RA 1KFUL 2FT2A 2PNSA 1QDQA 4BS6A 4PP1A 2P0RA 4ZUXU 1YALA 4DMYA 1CPJA 1W4TA 4MZOA 2E02A 3N3KA 2B1MA 3H89A 1PE6A 1MDWA 1BGOA 1CTEA 3E1ZB 2R9OA 3V6CA 5CHTA 1TL9A 2G8EA 2AU1A 1YK8A 4PADA 2YJCA 2YJBA 1CSBB 4FJCA 5K16A 3D6SA 1AU0A 2E00A 2NQIA 2HH5A 7PCKA 1ZIVA 1F2CA 3LFYA 4N4ZA 4X6IA 1PCIA 4WA6A 2DCAA 3WXFA 1GECE 3H8BA 4CZWA 4KLBA 1PXVA 1ITOA 1CS8A 1BY8A 3MORA 1CB5A 1BQIA 3P5UA 1CJLA 4YV8A 1PPNA 4MSXA 3IMAA 5JH3A 3PNRA 1S4VA 3IOQA 4XUIA 3HWNA 1NLJA 1FH0A 1PBHA 2DC8A 1MHWA 3CBJA 1ZCMA 1AYVA 1U5IA 4W5CA 2XU4A 3F75A 3IV2A 5EGWA 1STFE 3ZUAA 8PCHA 4YYWA 4C5PA 3PDFA 1AYWA 1EWLA 2VHSA 4AXLA 3BWKA 1O0EA 1ATKA 1EWPA 3MHSA 2XU5A 3F5VA 3MTNA 1PPDA 4W5BA 2H7JA 6PADA 4RY2A 3D9WA 4NV7A 1YK7A 4DMXA 2JQGR 1W5RA 3OVXA 3H6SA 3HD3A 5CHVA 1AECA 2AUZA 5J94A 4AXMA 3KSEA 3OVZA 4CDCB 1Y4HA 1VSNA 1PADA 4QRVA 3PBHA 2ATOA 4XR7A 3P5VA 1BP4A 2DCDA 2AYOA 2FQ9A 2FUDA 2E03A 3KW9A 4Q8GA 1TU6A 2AVWA 1JQPA 3V6EA 2F7DA 4PP2E 4PI3A 4CDEB 2YJ9A 3U8EA 3ERVA 2JQFR 1F2BA 2F1GA 3S3RA 3K24A 3LXSA 3S3QA 2CB5A 3QJ3A 4QBBA 1CQDA 1MIRA 1M6DA 4YYQA 1PIPA 1MS6A 1YVBA 2NQAA 1F29A 4BPVA 5JA7A 1KXRA 3QT4A 4OEMA 2HD5A 2FRQA 2DCBA 2C0YA 1DEUA 3BOWA 1YT7A 3RVXA 1NB3A 3LTWA 2VFCA 3IHPA 1VJVA 1MEMA 2DC9A 3OF9A 1AU3A 2AS8A 4NV8A 2NQGA 1SNKA 1GX3A 2DC7A 1IWDA 2HXZA 2GHUA 3GCBA 1MEGA 2IBIA 3K8UA 3KKUA 3RVWA 2PADA 1AU4A 4K7CA 3BPFA 3BCNA 2R9NA 1AIMA 5A24A 5FPWA 1U9XA 2DC6A 1AU2A 2DZZA 3P5WA 1X9YA 1EWOA 4CDFB 4BSQA 2R9MA 5EF4A 3O0UA 1Q6KA 3O1GA 1GMYA 2DJGB 2DZYA 4MZSA 5CVMA 3P5XA 1POPA 2BDZA 3QSDA 1Y08A 4W4UA 1PPPA 2GFOA 3KFQA 2G7YA 5CVNB 3H7DA 1NPZA 2YJ8A 3AI8A 4I05A 1U9WA 2FTDA 1EF7A 1F2AA 4GUZA 4X6HA 3KWZA 3TNXA 5CVOB 1ME4A 3I3TA 1U9QX 1NQCA 2AYNA 3PW3A 4YYRA 1QOLA 3WXEA 4QRXA 2R9FA 2AUXA 4YVAA 3BPMA 3KX1A 4BGFA 3KWBX 2DCCA 4OELA 2CIOA 2E01A 1KFXL 4YYSA 2BSZA 1GLOA 4N8WA 2OULA 1U9VA 2P86A 3CH3X 3N4CA 1KHQA 1K3BB 2R6NA 4BS5A 1QMYA 1W6FA 2Y5BA 4YYUA 1HUCB 3H8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P6G A;  1AYU A;  3WXG A;  3MHH A;  2PRE A;  3BC3 A;  4N79 A;  1CVZ A;  2ACT A;  1TLO A;  4HWY A;  3USV A;  1THE A;  1QXP A;  4I07 A;  5F02 A;  4YYV A;  2FYE A;  2FO5 A;  3I06 A;  2AIM A;  4Q8H A;  4QH6 A;  2VHF A;  2ARY A;  3OF8 A;  2OP3 A;  4FK5 A;  1ICF A;  1PPO A;  2XU1 A;  3HHA A;  2OZ2 A;  3CH2 X;  3IEJ A;  3M99 A;  3C9E A;  3OIS A;  3K9M A;  3CBK A;  4QRG A;  3DF0 A;  4CDD B;  2DJF B;  1GCB A;  3RVV A;  4BQV A;  2XU3 A;  2WBF X;  3IUT A;  2B1N A;  1DF0 A;  5PAD A;  2IPP B;  2Y6E A;  2R9C A;  2G8J A;  3N3G A;  2G6D A;  1SP4 B;  4X6J A;  1ME3 A;  1NL6 A;  2BDL A;  2O6X A;  1XKG A;  1KHP A;  2NQD B;  3HHI A;  1EWM A;  2PBH A;  4G54 A;  1NB5 A;  2YJ2 A;  4I04 A;  2FRA A;  4FIP A;  1CV8 A;  2P7U A;  2HHN A;  4P6E A;  3B79 A;  9PAP A;  3NHE A;  1A6R A;  1KFU L;  2FT2 A;  2PNS A;  1QDQ A;  4BS6 A;  4PP1 A;  2P0R A;  4ZUX U;  1YAL A;  4DMY A;  1CPJ A;  4MZO A;  2E02 A;  3N3K A;  2B1M A;  3H89 A;  1PE6 A;  1MDW A;  1BGO A;  1CTE A;  3E1Z B;  2R9O A;  3V6C A;  5CHT A;  1TL9 A;  2G8E A;  2AU1 A;  1YK8 A;  4PAD A;  2YJC A;  2YJB A;  1CSB B;  4FJC A;  5K16 A;  3D6S A;  1AU0 A;  2E00 A;  2NQI A;  2HH5 A;  7PCK A;  1ZIV A;  1F2C A;  3LFY A;  4N4Z A;  4X6I A;  1PCI A;  4WA6 A;  2DCA A;  3WXF A;  1GEC E;  3H8B A;  4CZW A;  4KLB A;  1PXV A;  1ITO A;  1CS8 A;  1BY8 A;  3MOR A;  1CB5 A;  1BQI A;  3P5U A;  1CJL A;  4YV8 A;  1PPN A;  4MSX A;  3IMA A;  5JH3 A;  1S4V A;  3PNR A;  3IOQ A;  4XUI A;  3HWN A;  1NLJ A;  1FH0 A;  1PBH A;  2DC8 A;  1MHW A;  3CBJ A;  1ZCM A;  1AYV A;  1U5I A;  4W5C A;  2XU4 A;  3F75 A;  3IV2 A;  5EGW A;  1STF E;  3ZUA A;  8PCH A;  4YYW A;  3PDF A;  1AYW A;  1EWL A;  2VHS A;  4AXL A;  3BWK A;  1O0E A;  1ATK A;  1EWP A;  3MHS A;  2XU5 A;  3F5V A;  3MTN A;  1PPD A;  4W5B A;  2H7J A;  6PAD A;  4RY2 A;  1YK7 A;  4DMX A;  2JQG R;  3OVX A;  3H6S A;  3HD3 A;  5CHV A;  1AEC A;  2AUZ A;  5J94 A;  4AXM A;  3KSE A;  3OVZ A;  4CDC B;  1Y4H A;  1VSN A;  1PAD A;  4QRV A;  3PBH A;  2ATO A;  4XR7 A;  3P5V A;  1BP4 A;  2DCD A;  2AYO A;  2FQ9 A;  2FUD A;  2E03 A;  3KW9 A;  4Q8G A;  1TU6 A;  2AVW A;  1JQP A;  3V6E A;  2F7D A;  4PP2 E;  4PI3 A;  4CDE B;  2YJ9 A;  3U8E A;  3ERV A;  2JQF R;  1F2B A;  2F1G A;  3S3R A;  3K24 A;  3LXS A;  3S3Q A;  2CB5 A;  3QJ3 A;  4QBB A;  1CQD A;  1MIR A;  1M6D A;  4YYQ A;  1PIP A;  1MS6 A;  1YVB A;  2NQA A;  1F29 A;  4BPV A;  5JA7 A;  1KXR A;  3QT4 A;  4OEM A;  2HD5 A;  2FRQ A;  2DCB A;  2C0Y A;  1DEU A;  3BOW A;  1YT7 A;  3RVX A;  1NB3 A;  3IHP A;  1VJV A;  1MEM A;  2DC9 A;  3OF9 A;  1AU3 A;  2AS8 A;  2NQG A;  1SNK A;  2DC7 A;  1IWD A;  2HXZ A;  2GHU A;  3GCB A;  1MEG A;  2IBI A;  3K8U A;  3KKU A;  3RVW A;  2PAD A;  1AU4 A;  4K7C A;  3BPF A;  3BCN A;  2R9N A;  1AIM A;  5A24 A;  5FPW A;  1U9X A;  2DC6 A;  1AU2 A;  2DZZ A;  3P5W A;  1X9Y A;  1EWO A;  4CDF B;  4BSQ A;  2R9M A;  5EF4 A;  3O0U A;  1Q6K A;  3O1G A;  1GMY A;  2DJG B;  2DZY A;  4MZS A;  5CVM A;  3P5X A;  1POP A;  2BDZ A;  3QSD A;  1Y08 A;  4W4U A;  1PPP A;  2GFO A;  3KFQ A;  2G7Y A;  5CVN B;  3H7D A;  1NPZ A;  2YJ8 A;  3AI8 A;  4I05 A;  1U9W A;  2FTD A;  1EF7 A;  1F2A A;  4X6H A;  3KWZ A;  3TNX A;  5CVO B;  1ME4 A;  3I3T A;  1U9Q X;  1NQC A;  2AYN A;  3PW3 A;  4YYR A;  1QOL A;  3WXE A;  4QRX A;  2R9F A;  2AUX A;  4YVA A;  3BPM A;  3KX1 A;  3KWB X;  2DCC A;  4OEL A;  2CIO A;  2E01 A;  1KFX L;  4YYS A;  1GLO A;  4N8W A;  2OUL A;  1U9V A;  2P86 A;  3CH3 X;  3N4C A;  1KHQ A;  1K3B B;  2R6N A;  4BS5 A;  1QMY A;  2Y5B A;  4YYU A;  1HUC B;  3H8C A; 
#chains in the Genus database with same CATH topology
 4P6G A;  1AYU A;  3WXG A;  2AGA A;  3MHH A;  4R3D A;  3BBA A;  2PRE A;  4MI7 A;  3BC3 A;  4N79 A;  1CVZ A;  2ACT A;  1TLO A;  4HWY A;  3USV A;  1THE A;  1QXP A;  4XZX A;  4I07 A;  3C0R A;  5F02 A;  4YYV A;  2FYE A;  2FO5 A;  5KO3 A;  3I06 A;  2AIM A;  4Q8H A;  4QH6 A;  2VHF A;  3PHU A;  2ARY A;  3OF8 A;  2OP3 A;  4FK5 A;  1ICF A;  1PPO A;  2XU1 A;  3HHA A;  2OZ2 A;  3CH2 X;  3IEJ A;  3M99 A;  3C9E A;  3MTV A;  3OIS A;  3K9M A;  3CBK A;  4QRG A;  3DF0 A;  4CDD B;  4D8E A;  2DJF B;  1GCB A;  3RVV A;  4BQV A;  2XU3 A;  2WBF X;  3IUT A;  2B1N A;  1DF0 A;  5PAD A;  2IPP B;  2Y6E A;  2R9C A;  3MJ5 A;  2G8J A;  3N3G A;  2G6D A;  1SP4 B;  2FE8 A;  3PHW A;  4X6J A;  1ME3 A;  1NL6 A;  2BDL A;  2O6X A;  1XKG A;  1KHP A;  2UZJ A;  2NQD B;  3HHI A;  2BTW A;  1EWM A;  2PBH A;  4G54 A;  1NB5 A;  2YJ2 A;  4I04 A;  2FRA A;  4FIP A;  1CV8 A;  3MP2 A;  2P7U A;  2HHN A;  3TMP A;  4P6E A;  3B79 A;  9PAP A;  3NHE A;  1A6R A;  1KFU L;  2FT2 A;  2PNS A;  1QDQ A;  4BS6 A;  4PP1 A;  2P0R A;  4ZUX U;  1YAL A;  4DMY A;  1CPJ A;  4M0W A;  4MZO A;  2E02 A;  3N3K A;  2B1M A;  3H89 A;  4BOU A;  1PE6 A;  4BOQ A;  1MDW A;  1BGO A;  2BU3 A;  1CTE A;  3E1Z B;  2R9O A;  3V6C A;  5CHT A;  1TL9 A;  2G8E A;  2AU1 A;  1YK8 A;  4BOZ A;  4PAD A;  2YJC A;  4ZTB A;  2YJB A;  1CSB B;  3PRM A;  3O65 A;  4FJC A;  5K16 A;  3D6S A;  1AU0 A;  2E00 A;  2NQI A;  2HH5 A;  4MM3 B;  7PCK A;  1ZIV A;  1F2C A;  3LFY A;  4N4Z A;  3PSE A;  4X6I A;  5E6J A;  1PCI A;  4WA6 A;  2DCA A;  5EZQ A;  3WXF A;  1GEC E;  3H8B A;  4CZW A;  4PT5 A;  4KLB A;  1PXV A;  1ITO A;  1CS8 A;  1BY8 A;  3MOR A;  1CB5 A;  1BQI A;  3P5U A;  1CJL A;  4YV8 A;  1PPN A;  4MSX A;  3IMA A;  4RKX A;  1S4V A;  3PNR A;  3B21 A;  5JH3 A;  3IOQ A;  4XUI A;  3HWN A;  1NLJ A;  4GUA A;  1FH0 A;  1PBH A;  2DC8 A;  1MHW A;  3CBJ A;  1ZCM A;  1AYV A;  1U5I A;  4W5C A;  2XU4 A;  3F75 A;  3IV2 A;  5EGW A;  4D8B A;  1STF E;  3ZUA A;  8PCH A;  4YYW A;  3PDF A;  1AYW A;  1EWL A;  2VHS A;  4AXL A;  3BWK A;  4REZ A;  1O0E A;  1ATK A;  1EWP A;  4OVZ A;  3MHS A;  2XU5 A;  3F5V A;  3MTN A;  1PPD A;  4W5B A;  2H7J A;  6PAD A;  1PVJ A;  4RY2 A;  1YK7 A;  4DMX A;  2JQG R;  3OVX A;  3H6S A;  3HD3 A;  5CHV A;  1AEC A;  2AUZ A;  1UKF A;  5J94 A;  3ZNH A;  3W31 A;  4AXM A;  3KSE A;  3OVZ A;  4CDC B;  1Y4H A;  1VSN A;  4RF1 A;  4OVZ B;  1PAD A;  4QRV A;  3PBH A;  3IFU A;  2ATO A;  4XR7 A;  3P5V A;  1BP4 A;  2DCD A;  2AYO A;  2FQ9 A;  2FUD A;  2E03 A;  3KW9 A;  4Q8G A;  1TU6 A;  2AVW A;  1JQP A;  3V6E A;  2F7D A;  4PP2 E;  2BTW B;  4PI3 A;  4CDE B;  2YJ9 A;  3E9S A;  3U8E A;  3ERV A;  2JQF R;  1F2B A;  5EZS A;  2F1G A;  3S3R A;  3K24 A;  3LXS A;  3S3Q A;  3OQC A;  2CB5 A;  2J7Q C;  3QJ3 A;  4QBB A;  1CQD A;  1MIR A;  1M6D A;  4YYQ A;  4IP3 A;  1PIP A;  1MS6 A;  4IUM A;  1YVB A;  2NQA A;  1F29 A;  4BPV A;  5JA7 A;  3PT2 A;  1KXR A;  3QT4 A;  4OEM A;  2HD5 A;  3BY4 A;  2FRQ A;  2DCB A;  2C0Y A;  1DEU A;  2J7Q A;  3BOW A;  1YT7 A;  3RVX A;  1NB3 A;  4P16 A;  3IHP A;  1VJV A;  1MEM A;  2DC9 A;  3OF9 A;  1AU3 A;  2AS8 A;  1YZB A;  2NQG A;  1SNK A;  2DC7 A;  1IWD A;  2HXZ A;  2GHU A;  3GCB A;  1MEG A;  2IBI A;  3K8U A;  3KKU A;  3RVW A;  2PAD A;  1AU4 A;  4K7C A;  3BPF A;  3BCN A;  2R9N A;  1AIM A;  5A24 A;  5FPW A;  1U9X A;  2DC6 A;  1AU2 A;  5JZE A;  2DZZ A;  3P5W A;  1X9Y A;  1EWO A;  2JRI A;  4CDF B;  4BSQ A;  2R9M A;  5EF4 A;  3O0U A;  3RNV A;  2HWK A;  1Q6K A;  3O1G A;  2Z84 A;  1GMY A;  2DJG B;  2DZY A;  4MZS A;  5CVM A;  3P5X A;  1POP A;  2BDZ A;  1DKI A;  2DOS A;  3QSD A;  1Y08 A;  4W4U A;  1PPP A;  4A5U A;  4BOP A;  2GFO A;  3KFQ A;  2G7Y A;  5CVN B;  3H7D A;  1NPZ A;  2YJ8 A;  3AI8 A;  4HXD B;  4I05 A;  1U9W A;  2FTD A;  1EF7 A;  1F2A A;  4X6H A;  3TRK A;  3KWZ A;  3TNX A;  5CVO B;  1ME4 A;  3I3T A;  1U9Q X;  4BOS A;  1NQC A;  2AYN A;  3PW3 A;  3BB7 A;  4YYR A;  4WUR A;  1QOL A;  4D8I A;  3WXE A;  4QRX A;  2R9F A;  2AUX A;  4YVA A;  3BPM A;  3PRP A;  3W30 A;  3KX1 A;  3KWB X;  2DCC A;  2JTC A;  4OEL A;  2CIO A;  2E01 A;  1KFX L;  4YYS A;  1GLO A;  4N8W A;  2OUL A;  1U9V A;  2P86 A;  4RNA A;  4OW0 A;  3CH3 X;  3N4C A;  1KHQ A;  4RF0 A;  1K3B B;  2R6N A;  4BS5 A;  1QMY A;  3PHX A;  2Y5B A;  4YYU A;  1HUC B;  3H8C A; 
#chains in the Genus database with same CATH homology
 4P6G A;  1AYU A;  3WXG A;  2VFB A;  3MHH A;  2PRE A;  3BC3 A;  4N79 A;  1CVZ A;  2ACT A;  1TLO A;  4HWY A;  3USV A;  1THE A;  1QXP A;  4I07 A;  5F02 A;  4YYV A;  2FYE A;  2FO5 A;  3I06 A;  2AIM A;  4Q8H A;  4QH6 A;  2VHF A;  2ARY A;  3OF8 A;  2OP3 A;  4FK5 A;  1ICF A;  1PPO A;  2XU1 A;  3HHA A;  2OZ2 A;  3CH2 X;  3IEJ A;  3M99 A;  3C9E A;  3OIS A;  3K9M A;  3CBK A;  4QRG A;  3DF0 A;  4CDD B;  2DJF B;  1GCB A;  3RVV A;  4BQV A;  2XU3 A;  2WBF X;  3IUT A;  2B1N A;  1DF0 A;  5PAD A;  2IPP B;  2Y6E A;  2R9C A;  2G8J A;  3N3G A;  2G6D A;  1E2T A;  1SP4 B;  4X6J A;  1ME3 A;  1NL6 A;  2BDL A;  2O6X A;  1XKG A;  1KHP A;  4B55 A;  2NQD B;  3HHI A;  1EWM A;  2PBH A;  4G54 A;  1NB5 A;  2YJ2 A;  4I04 A;  2FRA A;  4FIP A;  1CV8 A;  2P7U A;  2HHN A;  4P6E A;  3B79 A;  9PAP A;  3NHE A;  1A6R A;  1KFU L;  2FT2 A;  2PNS A;  1QDQ A;  4BS6 A;  4PP1 A;  2P0R A;  4ZUX U;  1YAL A;  4DMY A;  1CPJ A;  1W4T A;  4MZO A;  2E02 A;  3N3K A;  2B1M A;  3H89 A;  1PE6 A;  1MDW A;  1BGO A;  1CTE A;  3E1Z B;  2R9O A;  3V6C A;  5CHT A;  1TL9 A;  2G8E A;  2AU1 A;  1YK8 A;  4PAD A;  2YJC A;  2YJB A;  1CSB B;  4FJC A;  5K16 A;  3D6S A;  1AU0 A;  2E00 A;  2NQI A;  2HH5 A;  7PCK A;  1ZIV A;  1F2C A;  3LFY A;  4N4Z A;  4X6I A;  1PCI A;  4WA6 A;  2DCA A;  3WXF A;  1GEC E;  3H8B A;  4CZW A;  4KLB A;  1PXV A;  1ITO A;  1CS8 A;  1BY8 A;  3MOR A;  1CB5 A;  1BQI A;  3P5U A;  1CJL A;  4YV8 A;  1PPN A;  4MSX A;  3IMA A;  5JH3 A;  3PNR A;  1S4V A;  3IOQ A;  4XUI A;  3HWN A;  1NLJ A;  1FH0 A;  1PBH A;  2DC8 A;  1MHW A;  3CBJ A;  1ZCM A;  1AYV A;  1U5I A;  4W5C A;  2XU4 A;  3F75 A;  3IV2 A;  5EGW A;  1STF E;  3ZUA A;  8PCH A;  4YYW A;  4C5P A;  3PDF A;  1AYW A;  1EWL A;  2VHS A;  4AXL A;  3BWK A;  1O0E A;  1ATK A;  1EWP A;  3MHS A;  2XU5 A;  3F5V A;  3MTN A;  1PPD A;  4W5B A;  2H7J A;  6PAD A;  4RY2 A;  3D9W A;  4NV7 A;  1YK7 A;  4DMX A;  2JQG R;  1W5R A;  3OVX A;  3H6S A;  3HD3 A;  5CHV A;  1AEC A;  2AUZ A;  5J94 A;  4AXM A;  3KSE A;  3OVZ A;  4CDC B;  1Y4H A;  1VSN A;  1PAD A;  4QRV A;  3PBH A;  2ATO A;  4XR7 A;  3P5V A;  1BP4 A;  2DCD A;  2AYO A;  2FQ9 A;  2FUD A;  2E03 A;  3KW9 A;  4Q8G A;  1TU6 A;  2AVW A;  1JQP A;  3V6E A;  2F7D A;  4PP2 E;  4PI3 A;  4CDE B;  2YJ9 A;  3U8E A;  3ERV A;  2JQF R;  1F2B A;  2F1G A;  3S3R A;  3K24 A;  3LXS A;  3S3Q A;  2CB5 A;  3QJ3 A;  4QBB A;  1CQD A;  1MIR A;  1M6D A;  4YYQ A;  1PIP A;  1MS6 A;  1YVB A;  2NQA A;  1F29 A;  4BPV A;  5JA7 A;  1KXR A;  3QT4 A;  4OEM A;  2HD5 A;  2FRQ A;  2DCB A;  2C0Y A;  1DEU A;  3BOW A;  1YT7 A;  3RVX A;  1NB3 A;  3LTW A;  2VFC A;  3IHP A;  1VJV A;  1MEM A;  2DC9 A;  3OF9 A;  1AU3 A;  2AS8 A;  4NV8 A;  2NQG A;  1SNK A;  1GX3 A;  2DC7 A;  1IWD A;  2HXZ A;  2GHU A;  3GCB A;  1MEG A;  2IBI A;  3K8U A;  3KKU A;  3RVW A;  2PAD A;  1AU4 A;  4K7C A;  3BPF A;  3BCN A;  2R9N A;  1AIM A;  5A24 A;  5FPW A;  1U9X A;  2DC6 A;  1AU2 A;  2DZZ A;  3P5W A;  1X9Y A;  1EWO A;  4CDF B;  4BSQ A;  2R9M A;  5EF4 A;  3O0U A;  1Q6K A;  3O1G A;  1GMY A;  2DJG B;  2DZY A;  4MZS A;  5CVM A;  3P5X A;  1POP A;  2BDZ A;  3QSD A;  1Y08 A;  4W4U A;  1PPP A;  2GFO A;  3KFQ A;  2G7Y A;  5CVN B;  3H7D A;  1NPZ A;  2YJ8 A;  3AI8 A;  4I05 A;  1U9W A;  2FTD A;  1EF7 A;  1F2A A;  4GUZ A;  4X6H A;  3KWZ A;  3TNX A;  5CVO B;  1ME4 A;  3I3T A;  1U9Q X;  1NQC A;  2AYN A;  3PW3 A;  4YYR A;  1QOL A;  3WXE A;  4QRX A;  2R9F A;  2AUX A;  4YVA A;  3BPM A;  3KX1 A;  4BGF A;  3KWB X;  2DCC A;  4OEL A;  2CIO A;  2E01 A;  1KFX L;  4YYS A;  2BSZ A;  1GLO A;  4N8W A;  2OUL A;  1U9V A;  2P86 A;  3CH3 X;  3N4C A;  1KHQ A;  1K3B B;  2R6N A;  4BS5 A;  1QMY A;  1W6F A;  2Y5B A;  4YYU A;  1HUC B;  3H8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...