1VSNA

Crystal structure of a potent small molecule inhibitor bound to cathepsin k
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
215
Chain Sequence
APDSIDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKATGALLNLAPQNLVDCVSENDGCGGGYMTNAFQYVQRNRGIDSEDAYPYVGQDESCMYNPTGKAAKCRGYREIPEGNEAALKRAVAAVGPVSVAIDASLTSFQFYSAGVYYDENCSSDALNHAVLAVGYGIQAGNKHWIIKNSWGESWGNAGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of a potent and selective non-basic cathepsin K inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin K
total genus 62
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1vsnA00
1STFE 5EGWA 5EF4A 4MSXA 1PPDA 2DCAA 1POPA 1GCBA 2OULA 4XUIA 1VSNA 3KWBX 3IV2A 4CDCB 5CHTA 4BSQA 1CB5A 4AXLA 2DC9A 1NQCA 3N4CA 2DCDA 1CS8A 2DC8A 2G8JA 1MEGA 1AYWA 3KWZA 2FTDA 1MDWA 2AS8A 1VJVA 1U9VA 1YVBA 3OF9A 1AU3A 4XR7A 3HHAA 2XU3A 3P5WA 1EWMA 1AECA 8PCHA 1MHWA 4QBBA 2FYEA 1AU4A 1HUCB 3F75A 6PADA 1O0EA 3RVWA 3HHIA 3K24A 2NQIA 3PW3A 2JQGR 2H7JA 5CVNB 1GMYA 3I06A 3P5VA 5F02A 1PCIA 2HH5A 1YK8A 2ATOA 4BQVA 1CQDA 4I04A 4CZWA 4YYQA 2JQFR 3QJ3A 5JA7A 2YJBA 1NB5A 1KHQA 2Y6EA 1DEUA 2Y5BA 2DJGB 3BCNA 4YYRA 3CH3X 2IBIA 1ZIVA 2E00A 1ZCMA 1NLJA 3IHPA 3I3TA 1IWDA 1PPPA 1CPJA 1NB3A 2DC7A 1F2AA 2NQAA 1ICFA 1Q6KA 4X6JA 4DMXA 3DF0A 2B1NA 2OP3A 7PCKA 2DCBA 1ME4A 4HWYA 1AYVA 3S3QA 3H8CA 2FUDA 1SNKA 2FRAA 3RVVA 1CSBB 3M99A 3OVZA 1S4VA 3OISA 1FH0A 5CHVA 1F2CA 2NQGA 3WXGA 1Y08A 1CTEA 4RY2A 2DCCA 1TU6A 2C0YA 2R9NA 4BS6A 4CDDB 3P5XA 3N3KA 1YK7A 3IUTA 3PBHA 3H8BA 1THEA 2IPPB 4YYVA 3CH2X 4PADA 2CB5A 2DC6A 2PBHA 4DMYA 1PXVA 3CBJA 4CDFB 2VHFA 2F7DA 1BY8A 3B79A 3LFYA 4P6GA 2AUXA 2AU1A 5CVOB 1KFUL 2XU1A 4X6HA 1DF0A 3BPFA 3USVA 1U5IA 3BOWA 3CBKA 3IOQA 4FK5A 2P7UA 3PNRA 4I07A 5K16A 3U8EA 3O1GA 3WXEA 1K3BB 3MHSA 2DJFB 2DZZA 4X6IA 2FRQA 1QXPA 4FJCA 1PBHA 2GFOA 1PPOA 3P5UA 9PAPA 4WA6A 2R6NA 1BP4A 3H6SA 3KKUA 4PI3A 1MS6A 1KXRA 4N79A 4YVAA 1CVZA 4BS5A 1NL6A 2B1MA 2R9FA 2F1GA 4I05A 2HXZA 3QT4A 1A6RA 4CDEB 1PIPA 1CV8A 1QMYA 2BDZA 3HWNA 3V6EA 4QH6A 2AYOA 2G6DA 1F2BA 3C9EA 1MEMA 4N4ZA 3PDFA 3LXSA 3KFQA 4K7CA 4W4UA 2AVWA 2FQ9A 2HD5A 3BWKA 1GLOA 1AU0A 3H89A 4G54A 2E02A 2CIOA 2R9MA 2YJCA 3ZUAA 3H7DA 4YYWA 2FO5A 2AUZA 4FIPA 2O6XA 1TL9A 1EWLA 1BGOA 2XU5A 2YJ2A 4PP1A 3BC3A 3IMAA 1ATKA 4ZUXU 3KSEA 4N8WA 2NQDB 4AXMA 1U9XA 3MTNA 3RVXA 2R9OA 4W5BA 1AU2A 3OVXA 1GECE 4QRXA 1AYUA 2ARYA 3K8UA 3E1ZB 4YV8A 2WBFX 3MHHA 3GCBA 1PPNA 4Q8HA 2OZ2A 1TLOA 2YJ9A 2E03A 1KFXL 1U9QX 3KX1A 4OELA 2PADA 3K9MA 4BPVA 2VHSA 3N3GA 4YYUA 2G7YA 5A24A 4P6EA 2P86A 5J94A 1PADA 2AIMA 2P0RA 2FT2A 2AYNA 2BDLA 3F5VA 4MZSA 2ACTA 3S3RA 3QSDA 1YT7A 2R9CA 1KHPA 2G8EA 3D6SA 2HHNA 2PREA 3MORA 3IEJA 4KLBA 5PADA 5FPWA 3WXFA 1YALA 3KW9A 4YYSA 1ME3A 5JH3A 3AI8A 4Q8GA 1BQIA 3ERVA 3NHEA 1EF7A 1SP4B 2DZYA 2XU4A 1QDQA 1CJLA 2PNSA 4QRGA 1U9WA 1F29A 2E01A 1PE6A 4W5CA 1ITOA 1X9YA 1M6DA 1NPZA 1JQPA 1AIMA 4QRVA 1XKGA 4MZOA 4PP2E 2YJ8A 1QOLA 1Y4HA 1EWPA 3O0UA 3TNXA 1MIRA 3OF8A 1EWOA 3BPMA 2GHUA 3HD3A 4OEMA 3V6CA 5CVMA
chains in the Genus database with same CATH superfamily
1STFE 5EGWA 5EF4A 4MSXA 3TMPA 1PPDA 2DCAA 1POPA 1GCBA 2OULA 4XUIA 4IUMA 1VSNA 3KWBX 3IV2A 4CDCB 5CHTA 4BSQA 1CB5A 4AXLA 2DC9A 1NQCA 3N4CA 2DCDA 1CS8A 2DC8A 2G8JA 1MEGA 1AYWA 2BU3A 3KWZA 2FTDA 1MDWA 2AS8A 4BOQA 1VJVA 1U9VA 1YVBA 3OF9A 1AU3A 4REZA 4XR7A 3HHAA 2J7QA 2XU3A 5EZQA 3P5WA 1EWMA 1AECA 8PCHA 2DOSA 1MHWA 5JZEA 4QBBA 4MI7A 2FYEA 1AU4A 1HUCB 3F75A 6PADA 1O0EA 3RVWA 3HHIA 3K24A 2NQIA 3PW3A 2JQGR 2H7JA 5CVNB 4RF1A 1GMYA 3I06A 3P5VA 5F02A 1PCIA 2HH5A 1YK8A 2ATOA 4BQVA 1CQDA 4I04A 4CZWA 4YYQA 2BTWB 2JQFR 3QJ3A 5JA7A 4OVZA 2YJBA 1NB5A 1KHQA 2Y6EA 1DEUA 2Y5BA 2DJGB 3BCNA 4YYRA 3CH3X 2IBIA 1ZIVA 2E00A 1ZCMA 3PSEA 4A5UA 1NLJA 3IHPA 3I3TA 1IWDA 1PPPA 3BBAA 1CPJA 4P16A 1NB3A 4RF0A 2DC7A 1F2AA 2NQAA 1ICFA 1Q6KA 4X6JA 4DMXA 3DF0A 5KO3A 4PT5A 2B1NA 2OP3A 7PCKA 2DCBA 1ME4A 4HWYA 1AYVA 3S3QA 3H8CA 4D8BA 2FUDA 1SNKA 2FRAA 3PHUA 3RVVA 1UKFA 1CSBB 3M99A 3OVZA 1S4VA 3OISA 1FH0A 5CHVA 1F2CA 2NQGA 3WXGA 1Y08A 3O65A 1CTEA 4RY2A 2DCCA 1TU6A 2C0YA 2R9NA 4BS6A 4CDDB 3P5XA 3N3KA 4BOPA 1YK7A 3IUTA 3PBHA 3H8BA 1THEA 2IPPB 4M0WA 4YYVA 4OW0A 3CH2X 4PADA 2CB5A 1DKIA 2DC6A 2PBHA 4DMYA 1PXVA 3CBJA 4CDFB 2VHFA 4WURA 2F7DA 1BY8A 3B79A 3LFYA 4P6GA 2AUXA 2AU1A 3TRKA 2Z84A 5CVOB 1KFUL 2XU1A 3BY4A 4X6HA 4BOSA 1DF0A 2HWKA 3BPFA 3USVA 1U5IA 4R3DA 3E9SA 3BOWA 3CBKA 3IOQA 4FK5A 3PRPA 2P7UA 3PNRA 4I07A 5K16A 3U8EA 3O1GA 3WXEA 1K3BB 3MHSA 2DJFB 2DZZA 4X6IA 2FRQA 1QXPA 4FJCA 4BOUA 1PBHA 2GFOA 1PPOA 4D8EA 3P5UA 9PAPA 4WA6A 2R6NA 1BP4A 3H6SA 3KKUA 4PI3A 1MS6A 1KXRA 4N79A 4YVAA 1CVZA 2FE8A 4BS5A 1NL6A 2B1MA 2R9FA 2F1GA 3BB7A 4I05A 3ZNHA 2HXZA 3QT4A 1A6RA 4CDEB 1PIPA 1CV8A 1QMYA 2BDZA 3HWNA 3V6EA 4QH6A 2AYOA 2JRIA 2G6DA 1F2BA 3C9EA 1MEMA 4N4ZA 3RNVA 3PDFA 3LXSA 3KFQA 4K7CA 4W4UA 2JTCA 2AVWA 2FQ9A 2HD5A 3BWKA 1GLOA 1AU0A 3H89A 4G54A 2E02A 2CIOA 2R9MA 2YJCA 3ZUAA 3H7DA 4YYWA 2FO5A 2AUZA 4FIPA 1PVJA 2O6XA 1TL9A 4XZXA 1EWLA 1BGOA 2XU5A 2YJ2A 4PP1A 3BC3A 3IMAA 4RNAA 1ATKA 4ZUXU 3KSEA 4N8WA 2NQDB 4AXMA 4MM3B 1U9XA 3MTNA 5EZSA 2UZJA 3RVXA 2R9OA 4W5BA 1AU2A 3OVXA 1GECE 3PHXA 4QRXA 1AYUA 2ARYA 3K8UA 4IP3A 3E1ZB 3MTVA 4YV8A 2WBFX 3MHHA 3GCBA 1PPNA 4Q8HA 2OZ2A 1TLOA 2YJ9A 2E03A 3PT2A 1KFXL 1U9QX 3KX1A 4OELA 4ZTBA 2AGAA 3MJ5A 4GUAA 2PADA 3K9MA 4BPVA 2VHSA 3N3GA 4YYUA 2G7YA 5A24A 4P6EA 2P86A 5J94A 1PADA 2AIMA 3W30A 2P0RA 3IFUA 2FT2A 2AYNA 3B21A 2BDLA 3F5VA 4D8IA 3C0RA 4MZSA 2ACTA 3S3RA 3QSDA 1YT7A 2R9CA 1KHPA 2G8EA 3W31A 3D6SA 2HHNA 2PREA 3MORA 3MP2A 2BTWA 3IEJA 3PHWA 4KLBA 5PADA 5FPWA 3WXFA 1YALA 3KW9A 4YYSA 1ME3A 5JH3A 3OQCA 3AI8A 4Q8GA 1BQIA 3ERVA 4HXDB 3NHEA 1EF7A 1SP4B 2DZYA 2XU4A 1QDQA 5E6JA 1YZBA 1CJLA 2J7QC 2PNSA 4QRGA 1U9WA 1F29A 2E01A 1PE6A 4W5CA 1ITOA 1X9YA 1M6DA 1NPZA 1JQPA 1AIMA 4QRVA 1XKGA 4MZOA 4PP2E 2YJ8A 4OVZB 3PRMA 4RKXA 1QOLA 1Y4HA 1EWPA 3O0UA 1MIRA 3TNXA 3OF8A 1EWOA 4BOZA 3BPMA 2GHUA 3HD3A 4OEMA 3V6CA 5CVMA
chains in the Genus database with same CATH topology
1STFE 5EGWA 5EF4A 4MSXA 1PPDA 2DCAA 1POPA 1GCBA 2OULA 4XUIA 1VSNA 3KWBX 3IV2A 4CDCB 5CHTA 4BSQA 1CB5A 4AXLA 2DC9A 1NQCA 3N4CA 2DCDA 1CS8A 2DC8A 2G8JA 1MEGA 1AYWA 3KWZA 2FTDA 1MDWA 2AS8A 1VJVA 1U9VA 1YVBA 3OF9A 1AU3A 4XR7A 3HHAA 2XU3A 3P5WA 1EWMA 1AECA 8PCHA 1MHWA 4QBBA 2FYEA 1AU4A 1HUCB 3F75A 6PADA 1O0EA 3RVWA 3HHIA 3K24A 4GUZA 2NQIA 3PW3A 2JQGR 2H7JA 5CVNB 1GMYA 3I06A 3P5VA 5F02A 1PCIA 2HH5A 1YK8A 2ATOA 4BQVA 1CQDA 1E2TA 4I04A 4CZWA 4YYQA 2JQFR 3QJ3A 5JA7A 2YJBA 1NB5A 1KHQA 2Y6EA 1DEUA 2Y5BA 2DJGB 3BCNA 4YYRA 3CH3X 2IBIA 1ZIVA 2E00A 1ZCMA 1NLJA 3IHPA 3I3TA 1IWDA 1PPPA 1CPJA 1NB3A 2DC7A 1F2AA 2NQAA 1ICFA 1Q6KA 4X6JA 4DMXA 3DF0A 2B1NA 2OP3A 7PCKA 2DCBA 1ME4A 4HWYA 1AYVA 3S3QA 3H8CA 2FUDA 1SNKA 2FRAA 3RVVA 1CSBB 3M99A 3OVZA 1S4VA 3OISA 1FH0A 5CHVA 1F2CA 2NQGA 3WXGA 1Y08A 1CTEA 4RY2A 2DCCA 1TU6A 2C0YA 2R9NA 4BS6A 4CDDB 3P5XA 3N3KA 1YK7A 3IUTA 3PBHA 3H8BA 1THEA 2IPPB 4YYVA 3CH2X 4PADA 2BSZA 2CB5A 2DC6A 2PBHA 4DMYA 1PXVA 3CBJA 4CDFB 2VHFA 4NV8A 2F7DA 1BY8A 3B79A 3LFYA 4P6GA 2AUXA 2AU1A 5CVOB 1KFUL 2XU1A 4X6HA 1DF0A 3BPFA 3USVA 1U5IA 3BOWA 3CBKA 3IOQA 4FK5A 2P7UA 3PNRA 4I07A 5K16A 3U8EA 3O1GA 3WXEA 1K3BB 3MHSA 2DJFB 2DZZA 4X6IA 2FRQA 1QXPA 4FJCA 1PBHA 2GFOA 1PPOA 3P5UA 9PAPA 4WA6A 2R6NA 1BP4A 3H6SA 3KKUA 4PI3A 1MS6A 1KXRA 4N79A 4YVAA 1CVZA 4BS5A 1NL6A 2B1MA 2R9FA 2F1GA 4I05A 2HXZA 3QT4A 1GX3A 1A6RA 4CDEB 1PIPA 1CV8A 1QMYA 2BDZA 3HWNA 3V6EA 4QH6A 2AYOA 2G6DA 1F2BA 3C9EA 1MEMA 4N4ZA 3PDFA 3LXSA 3KFQA 4K7CA 4W4UA 1W6FA 4NV7A 2AVWA 2FQ9A 2HD5A 2VFCA 3BWKA 1GLOA 1AU0A 3H89A 4G54A 2E02A 2CIOA 2R9MA 2YJCA 3ZUAA 3H7DA 4YYWA 2FO5A 2AUZA 4FIPA 2O6XA 1TL9A 1W5RA 1EWLA 1BGOA 2XU5A 2YJ2A 4PP1A 4C5PA 3BC3A 3IMAA 1ATKA 4ZUXU 3KSEA 4N8WA 2NQDB 4AXMA 1U9XA 3MTNA 3RVXA 1W4TA 2R9OA 4W5BA 1AU2A 3OVXA 1GECE 4QRXA 1AYUA 2ARYA 3K8UA 3E1ZB 4YV8A 2WBFX 3MHHA 3GCBA 4B55A 1PPNA 4Q8HA 2OZ2A 1TLOA 2YJ9A 2E03A 1KFXL 1U9QX 3KX1A 3LTWA 4OELA 2PADA 3K9MA 4BPVA 2VHSA 3N3GA 4YYUA 2G7YA 5A24A 4P6EA 2P86A 5J94A 1PADA 2AIMA 2P0RA 2FT2A 2AYNA 2BDLA 3F5VA 4MZSA 2ACTA 3S3RA 3QSDA 1YT7A 2R9CA 1KHPA 2G8EA 3D6SA 2HHNA 2PREA 3MORA 3IEJA 4KLBA 5PADA 5FPWA 3WXFA 1YALA 3KW9A 4YYSA 1ME3A 5JH3A 3AI8A 4Q8GA 1BQIA 3ERVA 3NHEA 1EF7A 1SP4B 2DZYA 2XU4A 1QDQA 1CJLA 2PNSA 4QRGA 1U9WA 1F29A 2E01A 1PE6A 4W5CA 1ITOA 1X9YA 2VFBA 1M6DA 4BGFA 1NPZA 1JQPA 1AIMA 4QRVA 1XKGA 4MZOA 4PP2E 2YJ8A 1QOLA 1Y4HA 1EWPA 3O0UA 1MIRA 3TNXA 3OF8A 1EWOA 3BPMA 2GHUA 3HD3A 3D9WA 4OEMA 3V6CA 5CVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STF E;  5EGW A;  5EF4 A;  4MSX A;  1PPD A;  2DCA A;  1POP A;  1GCB A;  2OUL A;  4XUI A;  1VSN A;  3KWB X;  3IV2 A;  4CDC B;  5CHT A;  4BSQ A;  1CB5 A;  4AXL A;  2DC9 A;  1NQC A;  3N4C A;  2DCD A;  1CS8 A;  2DC8 A;  2G8J A;  1MEG A;  1AYW A;  3KWZ A;  2FTD A;  1MDW A;  2AS8 A;  1VJV A;  1U9V A;  1YVB A;  3OF9 A;  1AU3 A;  4XR7 A;  3HHA A;  2XU3 A;  3P5W A;  1EWM A;  1AEC A;  8PCH A;  1MHW A;  4QBB A;  2FYE A;  1AU4 A;  1HUC B;  3F75 A;  6PAD A;  1O0E A;  3RVW A;  3HHI A;  3K24 A;  2NQI A;  3PW3 A;  2JQG R;  2H7J A;  5CVN B;  1GMY A;  3I06 A;  3P5V A;  5F02 A;  1PCI A;  2HH5 A;  1YK8 A;  2ATO A;  4BQV A;  1CQD A;  4I04 A;  4CZW A;  4YYQ A;  2JQF R;  3QJ3 A;  5JA7 A;  2YJB A;  1NB5 A;  1KHQ A;  2Y6E A;  1DEU A;  2Y5B A;  2DJG B;  3BCN A;  4YYR A;  3CH3 X;  2IBI A;  1ZIV A;  2E00 A;  1ZCM A;  1NLJ A;  3IHP A;  3I3T A;  1IWD A;  1PPP A;  1CPJ A;  1NB3 A;  2DC7 A;  1F2A A;  2NQA A;  1ICF A;  1Q6K A;  4X6J A;  4DMX A;  3DF0 A;  2B1N A;  2OP3 A;  7PCK A;  2DCB A;  1ME4 A;  4HWY A;  1AYV A;  3S3Q A;  3H8C A;  2FUD A;  1SNK A;  2FRA A;  3RVV A;  1CSB B;  3M99 A;  3OVZ A;  1S4V A;  3OIS A;  1FH0 A;  5CHV A;  1F2C A;  2NQG A;  3WXG A;  1Y08 A;  1CTE A;  4RY2 A;  2DCC A;  1TU6 A;  2C0Y A;  2R9N A;  4BS6 A;  4CDD B;  3P5X A;  3N3K A;  1YK7 A;  3IUT A;  3PBH A;  3H8B A;  1THE A;  2IPP B;  4YYV A;  3CH2 X;  4PAD A;  2CB5 A;  2DC6 A;  2PBH A;  4DMY A;  1PXV A;  3CBJ A;  4CDF B;  2VHF A;  2F7D A;  1BY8 A;  3B79 A;  3LFY A;  4P6G A;  2AUX A;  2AU1 A;  5CVO B;  1KFU L;  2XU1 A;  4X6H A;  1DF0 A;  3BPF A;  3USV A;  1U5I A;  3BOW A;  3CBK A;  3IOQ A;  4FK5 A;  2P7U A;  3PNR A;  4I07 A;  5K16 A;  3U8E A;  3O1G A;  3WXE A;  1K3B B;  3MHS A;  2DJF B;  2DZZ A;  4X6I A;  2FRQ A;  1QXP A;  4FJC A;  1PBH A;  2GFO A;  1PPO A;  3P5U A;  9PAP A;  4WA6 A;  2R6N A;  1BP4 A;  3H6S A;  3KKU A;  4PI3 A;  1MS6 A;  1KXR A;  4N79 A;  4YVA A;  1CVZ A;  4BS5 A;  1NL6 A;  2B1M A;  2R9F A;  2F1G A;  4I05 A;  2HXZ A;  3QT4 A;  1A6R A;  4CDE B;  1PIP A;  1CV8 A;  1QMY A;  2BDZ A;  3HWN A;  3V6E A;  4QH6 A;  2AYO A;  2G6D A;  1F2B A;  3C9E A;  1MEM A;  4N4Z A;  3PDF A;  3LXS A;  3KFQ A;  4K7C A;  4W4U A;  2AVW A;  2FQ9 A;  2HD5 A;  3BWK A;  1GLO A;  1AU0 A;  3H89 A;  4G54 A;  2E02 A;  2CIO A;  2R9M A;  2YJC A;  3ZUA A;  3H7D A;  4YYW A;  2FO5 A;  2AUZ A;  4FIP A;  2O6X A;  1TL9 A;  1EWL A;  1BGO A;  2XU5 A;  2YJ2 A;  4PP1 A;  3BC3 A;  3IMA A;  1ATK A;  4ZUX U;  3KSE A;  4N8W A;  2NQD B;  4AXM A;  1U9X A;  3MTN A;  3RVX A;  2R9O A;  4W5B A;  1AU2 A;  3OVX A;  1GEC E;  4QRX A;  1AYU A;  2ARY A;  3K8U A;  3E1Z B;  4YV8 A;  2WBF X;  3MHH A;  3GCB A;  1PPN A;  4Q8H A;  2OZ2 A;  1TLO A;  2YJ9 A;  2E03 A;  1KFX L;  1U9Q X;  3KX1 A;  4OEL A;  2PAD A;  3K9M A;  4BPV A;  2VHS A;  3N3G A;  4YYU A;  2G7Y A;  5A24 A;  4P6E A;  2P86 A;  5J94 A;  1PAD A;  2AIM A;  2P0R A;  2FT2 A;  2AYN A;  2BDL A;  3F5V A;  4MZS A;  2ACT A;  3S3R A;  3QSD A;  1YT7 A;  2R9C A;  1KHP A;  2G8E A;  3D6S A;  2HHN A;  2PRE A;  3MOR A;  3IEJ A;  4KLB A;  5PAD A;  5FPW A;  3WXF A;  1YAL A;  3KW9 A;  4YYS A;  1ME3 A;  5JH3 A;  3AI8 A;  4Q8G A;  1BQI A;  3ERV A;  3NHE A;  1EF7 A;  1SP4 B;  2DZY A;  2XU4 A;  1QDQ A;  1CJL A;  2PNS A;  4QRG A;  1U9W A;  1F29 A;  2E01 A;  1PE6 A;  4W5C A;  1ITO A;  1X9Y A;  1M6D A;  1NPZ A;  1JQP A;  1AIM A;  4QRV A;  1XKG A;  4MZO A;  4PP2 E;  2YJ8 A;  1QOL A;  1Y4H A;  1EWP A;  3O0U A;  3TNX A;  1MIR A;  3OF8 A;  1EWO A;  3BPM A;  2GHU A;  3HD3 A;  4OEM A;  3V6C A;  5CVM A; 
#chains in the Genus database with same CATH topology
 1STF E;  5EGW A;  5EF4 A;  4MSX A;  3TMP A;  1PPD A;  2DCA A;  1POP A;  1GCB A;  2OUL A;  4XUI A;  4IUM A;  1VSN A;  3KWB X;  3IV2 A;  4CDC B;  5CHT A;  4BSQ A;  1CB5 A;  4AXL A;  2DC9 A;  1NQC A;  3N4C A;  2DCD A;  1CS8 A;  2DC8 A;  2G8J A;  1MEG A;  1AYW A;  2BU3 A;  3KWZ A;  2FTD A;  1MDW A;  2AS8 A;  4BOQ A;  1VJV A;  1U9V A;  1YVB A;  3OF9 A;  1AU3 A;  4REZ A;  4XR7 A;  3HHA A;  2J7Q A;  2XU3 A;  5EZQ A;  3P5W A;  1EWM A;  1AEC A;  8PCH A;  2DOS A;  1MHW A;  5JZE A;  4QBB A;  4MI7 A;  2FYE A;  1AU4 A;  1HUC B;  3F75 A;  6PAD A;  1O0E A;  3RVW A;  3HHI A;  3K24 A;  2NQI A;  3PW3 A;  2JQG R;  2H7J A;  5CVN B;  4RF1 A;  1GMY A;  3I06 A;  3P5V A;  5F02 A;  1PCI A;  2HH5 A;  1YK8 A;  2ATO A;  4BQV A;  1CQD A;  4I04 A;  4CZW A;  4YYQ A;  2BTW B;  2JQF R;  3QJ3 A;  5JA7 A;  4OVZ A;  2YJB A;  1NB5 A;  1KHQ A;  2Y6E A;  1DEU A;  2Y5B A;  2DJG B;  3BCN A;  4YYR A;  3CH3 X;  2IBI A;  1ZIV A;  2E00 A;  1ZCM A;  3PSE A;  4A5U A;  1NLJ A;  3IHP A;  3I3T A;  1IWD A;  1PPP A;  3BBA A;  1CPJ A;  4P16 A;  1NB3 A;  4RF0 A;  2DC7 A;  1F2A A;  2NQA A;  1ICF A;  1Q6K A;  4X6J A;  4DMX A;  3DF0 A;  5KO3 A;  4PT5 A;  2B1N A;  2OP3 A;  7PCK A;  2DCB A;  1ME4 A;  4HWY A;  1AYV A;  3S3Q A;  3H8C A;  4D8B A;  2FUD A;  1SNK A;  2FRA A;  3PHU A;  3RVV A;  1UKF A;  1CSB B;  3M99 A;  3OVZ A;  1S4V A;  3OIS A;  1FH0 A;  5CHV A;  1F2C A;  2NQG A;  3WXG A;  1Y08 A;  3O65 A;  1CTE A;  4RY2 A;  2DCC A;  1TU6 A;  2C0Y A;  2R9N A;  4BS6 A;  4CDD B;  3P5X A;  3N3K A;  4BOP A;  1YK7 A;  3IUT A;  3PBH A;  3H8B A;  1THE A;  2IPP B;  4M0W A;  4YYV A;  4OW0 A;  3CH2 X;  4PAD A;  2CB5 A;  1DKI A;  2DC6 A;  2PBH A;  4DMY A;  1PXV A;  3CBJ A;  4CDF B;  2VHF A;  4WUR A;  2F7D A;  1BY8 A;  3B79 A;  3LFY A;  4P6G A;  2AUX A;  2AU1 A;  3TRK A;  2Z84 A;  5CVO B;  1KFU L;  2XU1 A;  3BY4 A;  4X6H A;  4BOS A;  1DF0 A;  2HWK A;  3BPF A;  3USV A;  1U5I A;  4R3D A;  3E9S A;  3BOW A;  3CBK A;  3IOQ A;  4FK5 A;  3PRP A;  2P7U A;  3PNR A;  4I07 A;  5K16 A;  3U8E A;  3O1G A;  3WXE A;  1K3B B;  3MHS A;  2DJF B;  2DZZ A;  4X6I A;  2FRQ A;  1QXP A;  4FJC A;  4BOU A;  1PBH A;  2GFO A;  1PPO A;  4D8E A;  3P5U A;  9PAP A;  4WA6 A;  2R6N A;  1BP4 A;  3H6S A;  3KKU A;  4PI3 A;  1MS6 A;  1KXR A;  4N79 A;  4YVA A;  1CVZ A;  2FE8 A;  4BS5 A;  1NL6 A;  2B1M A;  2R9F A;  2F1G A;  3BB7 A;  4I05 A;  3ZNH A;  2HXZ A;  3QT4 A;  1A6R A;  4CDE B;  1PIP A;  1CV8 A;  1QMY A;  2BDZ A;  3HWN A;  3V6E A;  4QH6 A;  2AYO A;  2JRI A;  2G6D A;  1F2B A;  3C9E A;  1MEM A;  4N4Z A;  3RNV A;  3PDF A;  3LXS A;  3KFQ A;  4K7C A;  4W4U A;  2JTC A;  2AVW A;  2FQ9 A;  2HD5 A;  3BWK A;  1GLO A;  1AU0 A;  3H89 A;  4G54 A;  2E02 A;  2CIO A;  2R9M A;  2YJC A;  3ZUA A;  3H7D A;  4YYW A;  2FO5 A;  2AUZ A;  4FIP A;  1PVJ A;  2O6X A;  1TL9 A;  4XZX A;  1EWL A;  1BGO A;  2XU5 A;  2YJ2 A;  4PP1 A;  3BC3 A;  3IMA A;  4RNA A;  1ATK A;  4ZUX U;  3KSE A;  4N8W A;  2NQD B;  4AXM A;  4MM3 B;  1U9X A;  3MTN A;  5EZS A;  2UZJ A;  3RVX A;  2R9O A;  4W5B A;  1AU2 A;  3OVX A;  1GEC E;  3PHX A;  4QRX A;  1AYU A;  2ARY A;  3K8U A;  4IP3 A;  3E1Z B;  3MTV A;  4YV8 A;  2WBF X;  3MHH A;  3GCB A;  1PPN A;  4Q8H A;  2OZ2 A;  1TLO A;  2YJ9 A;  2E03 A;  3PT2 A;  1KFX L;  1U9Q X;  3KX1 A;  4OEL A;  4ZTB A;  2AGA A;  3MJ5 A;  4GUA A;  2PAD A;  3K9M A;  4BPV A;  2VHS A;  3N3G A;  4YYU A;  2G7Y A;  5A24 A;  4P6E A;  2P86 A;  5J94 A;  1PAD A;  2AIM A;  3W30 A;  2P0R A;  3IFU A;  2FT2 A;  2AYN A;  3B21 A;  2BDL A;  3F5V A;  4D8I A;  3C0R A;  4MZS A;  2ACT A;  3S3R A;  3QSD A;  1YT7 A;  2R9C A;  1KHP A;  2G8E A;  3W31 A;  3D6S A;  2HHN A;  2PRE A;  3MOR A;  3MP2 A;  2BTW A;  3IEJ A;  3PHW A;  4KLB A;  5PAD A;  5FPW A;  3WXF A;  1YAL A;  3KW9 A;  4YYS A;  1ME3 A;  5JH3 A;  3OQC A;  3AI8 A;  4Q8G A;  1BQI A;  3ERV A;  4HXD B;  3NHE A;  1EF7 A;  1SP4 B;  2DZY A;  2XU4 A;  1QDQ A;  5E6J A;  1YZB A;  1CJL A;  2J7Q C;  2PNS A;  4QRG A;  1U9W A;  1F29 A;  2E01 A;  1PE6 A;  4W5C A;  1ITO A;  1X9Y A;  1M6D A;  1NPZ A;  1JQP A;  1AIM A;  4QRV A;  1XKG A;  4MZO A;  4PP2 E;  2YJ8 A;  4OVZ B;  3PRM A;  4RKX A;  1QOL A;  1Y4H A;  1EWP A;  3O0U A;  1MIR A;  3TNX A;  3OF8 A;  1EWO A;  4BOZ A;  3BPM A;  2GHU A;  3HD3 A;  4OEM A;  3V6C A;  5CVM A; 
#chains in the Genus database with same CATH homology
 1STF E;  5EGW A;  5EF4 A;  4MSX A;  1PPD A;  2DCA A;  1POP A;  1GCB A;  2OUL A;  4XUI A;  1VSN A;  3KWB X;  3IV2 A;  4CDC B;  5CHT A;  4BSQ A;  1CB5 A;  4AXL A;  2DC9 A;  1NQC A;  3N4C A;  2DCD A;  1CS8 A;  2DC8 A;  2G8J A;  1MEG A;  1AYW A;  3KWZ A;  2FTD A;  1MDW A;  2AS8 A;  1VJV A;  1U9V A;  1YVB A;  3OF9 A;  1AU3 A;  4XR7 A;  3HHA A;  2XU3 A;  3P5W A;  1EWM A;  1AEC A;  8PCH A;  1MHW A;  4QBB A;  2FYE A;  1AU4 A;  1HUC B;  3F75 A;  6PAD A;  1O0E A;  3RVW A;  3HHI A;  3K24 A;  4GUZ A;  2NQI A;  3PW3 A;  2JQG R;  2H7J A;  5CVN B;  1GMY A;  3I06 A;  3P5V A;  5F02 A;  1PCI A;  2HH5 A;  1YK8 A;  2ATO A;  4BQV A;  1CQD A;  1E2T A;  4I04 A;  4CZW A;  4YYQ A;  2JQF R;  3QJ3 A;  5JA7 A;  2YJB A;  1NB5 A;  1KHQ A;  2Y6E A;  1DEU A;  2Y5B A;  2DJG B;  3BCN A;  4YYR A;  3CH3 X;  2IBI A;  1ZIV A;  2E00 A;  1ZCM A;  1NLJ A;  3IHP A;  3I3T A;  1IWD A;  1PPP A;  1CPJ A;  1NB3 A;  2DC7 A;  1F2A A;  2NQA A;  1ICF A;  1Q6K A;  4X6J A;  4DMX A;  3DF0 A;  2B1N A;  2OP3 A;  7PCK A;  2DCB A;  1ME4 A;  4HWY A;  1AYV A;  3S3Q A;  3H8C A;  2FUD A;  1SNK A;  2FRA A;  3RVV A;  1CSB B;  3M99 A;  3OVZ A;  1S4V A;  3OIS A;  1FH0 A;  5CHV A;  1F2C A;  2NQG A;  3WXG A;  1Y08 A;  1CTE A;  4RY2 A;  2DCC A;  1TU6 A;  2C0Y A;  2R9N A;  4BS6 A;  4CDD B;  3P5X A;  3N3K A;  1YK7 A;  3IUT A;  3PBH A;  3H8B A;  1THE A;  2IPP B;  4YYV A;  3CH2 X;  4PAD A;  2BSZ A;  2CB5 A;  2DC6 A;  2PBH A;  4DMY A;  1PXV A;  3CBJ A;  4CDF B;  2VHF A;  4NV8 A;  2F7D A;  1BY8 A;  3B79 A;  3LFY A;  4P6G A;  2AUX A;  2AU1 A;  5CVO B;  1KFU L;  2XU1 A;  4X6H A;  1DF0 A;  3BPF A;  3USV A;  1U5I A;  3BOW A;  3CBK A;  3IOQ A;  4FK5 A;  2P7U A;  3PNR A;  4I07 A;  5K16 A;  3U8E A;  3O1G A;  3WXE A;  1K3B B;  3MHS A;  2DJF B;  2DZZ A;  4X6I A;  2FRQ A;  1QXP A;  4FJC A;  1PBH A;  2GFO A;  1PPO A;  3P5U A;  9PAP A;  4WA6 A;  2R6N A;  1BP4 A;  3H6S A;  3KKU A;  4PI3 A;  1MS6 A;  1KXR A;  4N79 A;  4YVA A;  1CVZ A;  4BS5 A;  1NL6 A;  2B1M A;  2R9F A;  2F1G A;  4I05 A;  2HXZ A;  3QT4 A;  1GX3 A;  1A6R A;  4CDE B;  1PIP A;  1CV8 A;  1QMY A;  2BDZ A;  3HWN A;  3V6E A;  4QH6 A;  2AYO A;  2G6D A;  1F2B A;  3C9E A;  1MEM A;  4N4Z A;  3PDF A;  3LXS A;  3KFQ A;  4K7C A;  4W4U A;  1W6F A;  4NV7 A;  2AVW A;  2FQ9 A;  2HD5 A;  2VFC A;  3BWK A;  1GLO A;  1AU0 A;  3H89 A;  4G54 A;  2E02 A;  2CIO A;  2R9M A;  2YJC A;  3ZUA A;  3H7D A;  4YYW A;  2FO5 A;  2AUZ A;  4FIP A;  2O6X A;  1TL9 A;  1W5R A;  1EWL A;  1BGO A;  2XU5 A;  2YJ2 A;  4PP1 A;  4C5P A;  3BC3 A;  3IMA A;  1ATK A;  4ZUX U;  3KSE A;  4N8W A;  2NQD B;  4AXM A;  1U9X A;  3MTN A;  3RVX A;  1W4T A;  2R9O A;  4W5B A;  1AU2 A;  3OVX A;  1GEC E;  4QRX A;  1AYU A;  2ARY A;  3K8U A;  3E1Z B;  4YV8 A;  2WBF X;  3MHH A;  3GCB A;  4B55 A;  1PPN A;  4Q8H A;  2OZ2 A;  1TLO A;  2YJ9 A;  2E03 A;  1KFX L;  1U9Q X;  3KX1 A;  3LTW A;  4OEL A;  2PAD A;  3K9M A;  4BPV A;  2VHS A;  3N3G A;  4YYU A;  2G7Y A;  5A24 A;  4P6E A;  2P86 A;  5J94 A;  1PAD A;  2AIM A;  2P0R A;  2FT2 A;  2AYN A;  2BDL A;  3F5V A;  4MZS A;  2ACT A;  3S3R A;  3QSD A;  1YT7 A;  2R9C A;  1KHP A;  2G8E A;  3D6S A;  2HHN A;  2PRE A;  3MOR A;  3IEJ A;  4KLB A;  5PAD A;  5FPW A;  3WXF A;  1YAL A;  3KW9 A;  4YYS A;  1ME3 A;  5JH3 A;  3AI8 A;  4Q8G A;  1BQI A;  3ERV A;  3NHE A;  1EF7 A;  1SP4 B;  2DZY A;  2XU4 A;  1QDQ A;  1CJL A;  2PNS A;  4QRG A;  1U9W A;  1F29 A;  2E01 A;  1PE6 A;  4W5C A;  1ITO A;  1X9Y A;  2VFB A;  1M6D A;  4BGF A;  1NPZ A;  1JQP A;  1AIM A;  4QRV A;  1XKG A;  4MZO A;  4PP2 E;  2YJ8 A;  1QOL A;  1Y4H A;  1EWP A;  3O0U A;  1MIR A;  3TNX A;  3OF8 A;  1EWO A;  3BPM A;  2GHU A;  3HD3 A;  3D9W A;  4OEM A;  3V6C A;  5CVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...