1PPOA

Determination of the structure of papaya protease omega
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
216
structure length
216
Chain Sequence
LPENVDWRKKGAVTPVRHQGSCGSCWAFSAVATVEGINKIRTGKLVELSEQELVDCERRSHGCKGGYPPYALEYVAKNGIHLRSKYPYKAKQGTCRAKQVGGPIVKTSGVGRVQPNNEGNLLNAIAKQPVSVVVESKGRPFQLYKGGIFEGPCGTKVDHAVTAVGYGKSGGKGYILIKNSWGTAWGEKGYIRIKRAPGNSPGVCGLYKSSYYPTKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(thiol protease)
molecule keywords PROTEASE OMEGA
publication title Determination of the Structure of Papaya Protease Omega
pubmed rcsb
source organism Carica papaya
total genus 62
structure length 216
sequence length 216
ec nomenclature ec 3.4.22.30: Caricain.
pdb deposition date 1991-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1ppoA00
1CTEA 3ERVA 5FPWA 3U8EA 4QBBA 2CIOA 1Y08A 2FRAA 4KLBA 7PCKA 2DC6A 3K8UA 3NHEA 4BS5A 4QRXA 3F5VA 3IEJA 3OF9A 2DCBA 3PNRA 4CZWA 3MORA 1NQCA 2GFOA 3P5WA 3WXGA 4BPVA 1YT7A 1TL9A 2ACTA 2FUDA 3P5XA 4G54A 3WXFA 1EWMA 4HWYA 4BS6A 2O6XA 1EWPA 1CVZA 2G8JA 1BQIA 1FH0A 3O1GA 2AYOA 3V6CA 3KKUA 2ATOA 4YYVA 2YJ2A 3BPMA 1EWOA 2CB5A 4I05A 1F29A 1AECA 4I07A 3M99A 4BQVA 2HH5A 3S3RA 2FRQA 1PPNA 3KWZA 3OVXA 4QRVA 3MTNA 2Y6EA 2DJGB 4PI3A 5A24A 2DC9A 1GECE 3CBJA 3H6SA 1F2BA 4YYQA 3H8BA 1IWDA 3E1ZB 3PW3A 1EF7A 3D6SA 1QMYA 4YYUA 1PXVA 2P86A 2ARYA 3LXSA 2R9OA 4N79A 4YYWA 2NQAA 3IMAA 1GCBA 3USVA 2NQDB 3QJ3A 5CVOB 4I04A 1MHWA 3KFQA 1VSNA 2OZ2A 3BC3A 1K3BB 9PAPA 4W4UA 2E03A 2AUZA 2OP3A 4PADA 4DMXA 3K9MA 2B1NA 1QXPA 2PNSA 2R9CA 3P5VA 2PBHA 4PP1A 4QRGA 2DC8A 1AU4A 4YVAA 2DJFB 3IOQA 1PIPA 4P6GA 4K7CA 1CPJA 2F7DA 2G8EA 3H7DA 3OISA 3TNXA 1Q6KA 3I3TA 1THEA 2AYNA 2YJCA 1ICFA 4YYSA 2DZZA 1ME3A 2G6DA 1PADA 2JQFR 4N8WA 3RVVA 3ZUAA 2P0RA 1Y4HA 2XU3A 1KFXL 1GLOA 4W5CA 4Q8HA 3PDFA 3P5UA 5K16A 3LFYA 2NQGA 2VHFA 4PP2E 3N3KA 1AYUA 3N3GA 2HD5A 1QDQA 2YJ9A 2NQIA 3B79A 1U9VA 2FQ9A 1A6RA 3HHAA 1GMYA 2DCDA 2IPPB 6PADA 1AIMA 1CB5A 4XR7A 2AUXA 2E02A 4FIPA 1EWLA 4DMYA 4YYRA 1CJLA 2AS8A 4X6JA 3S3QA 2OULA 3WXEA 2R9FA 2FT2A 1SP4B 2AU1A 4W5BA 5CHVA 4WA6A 2DC7A 1NPZA 2VHSA 2IBIA 1NB5A 1YALA 1CS8A 1KHQA 3HHIA 2R9MA 1NB3A 1YK7A 3O0UA 1AYWA 1O0EA 3KWBX 1PPOA 1YVBA 4X6IA 4Q8GA 2PREA 1STFE 2YJBA 3QT4A 1ATKA 5F02A 3CH2X 1AU2A 1MIRA 5CVMA 2Y5BA 2JQGR 5EGWA 3CH3X 1PCIA 2BDLA 1NLJA 2R9NA 2E00A 1HUCB 1KXRA 2FO5A 4N4ZA 4CDFB 2DCCA 1SNKA 3BWKA 5PADA 3I06A 3MHSA 1ME4A 3K24A 4RY2A 1ZCMA 3H89A 3DF0A 1PE6A 1TU6A 3CBKA 5CHTA 3N4CA 1BY8A 3QSDA 1QOLA 4YV8A 2R6NA 3GCBA 1CQDA 3RVXA 3BOWA 1MEGA 3IUTA 2P7UA 1YK8A 2G7YA 1MS6A 4CDDB 4MZOA 4X6HA 1U9XA 3IHPA 2XU1A 3KX1A 4BSQA 4FJCA 2PADA 1U9QX 2H7JA 4MZSA 3HD3A 3HWNA 1ZIVA 3RVWA 1AYVA 2DZYA 2HHNA 1CSBB 2AIMA 3PBHA 1PBHA 2XU4A 1BP4A 3V6EA 2DCAA 1F2CA 4AXLA 3AI8A 4XUIA 2F1GA 1JQPA 3F75A 1DF0A 1F2AA 4OEMA 1MDWA 1U5IA 1BGOA 1X9YA 2FYEA 3BCNA 2B1MA 4ZUXU 3KW9A 1KFUL 3IV2A 3BPFA 4P6EA 5CVNB 2WBFX 2XU5A 1M6DA 1S4VA 1POPA 3OF8A 2E01A 3OVZA 1KHPA 5EF4A 1PPDA 4FK5A 1TLOA 2AVWA 1U9WA 2GHUA 1MEMA 8PCHA 4QH6A 1PPPA 4CDCB 4MSXA 2HXZA 2FTDA 5J94A 5JH3A 4CDEB 3KSEA 5JA7A 2YJ8A 3H8CA 2BDZA 2C0YA 1CV8A 1VJVA 1ITOA 3C9EA 1DEUA 1AU0A 4OELA 4AXMA 1AU3A 1NL6A 3MHHA 1XKGA
chains in the Genus database with same CATH superfamily
1CTEA 3ERVA 5FPWA 3U8EA 3PHWA 4QBBA 2CIOA 1Y08A 2FRAA 4KLBA 7PCKA 2DC6A 3K8UA 3NHEA 4BS5A 4QRXA 3F5VA 3IEJA 3OF9A 2JTCA 2DCBA 3PNRA 4CZWA 3MORA 1NQCA 2GFOA 3P5WA 3WXGA 4BPVA 1YT7A 1TL9A 2ACTA 2FUDA 3P5XA 4G54A 3WXFA 1EWMA 4HWYA 5JZEA 4BS6A 2O6XA 1EWPA 1CVZA 2G8JA 1BQIA 1FH0A 3O1GA 2AYOA 5EZQA 3V6CA 3KKUA 4WURA 2ATOA 4YYVA 3ZNHA 2YJ2A 2J7QA 3BPMA 1EWOA 2CB5A 4I05A 1F29A 1AECA 2BTWA 4I07A 3M99A 4BQVA 4OVZB 2HH5A 3S3RA 2FRQA 3PRMA 1PPNA 3KWZA 3OVXA 4R3DA 2HWKA 3MTNA 4QRVA 2Y6EA 2DJGB 4PI3A 5A24A 2DC9A 1GECE 3CBJA 4BOUA 3H6SA 1F2BA 4YYQA 3H8BA 1IWDA 3E1ZB 3PW3A 3RNVA 1EF7A 3D6SA 3IFUA 1QMYA 4YYUA 1PXVA 2DOSA 2P86A 2ARYA 3LXSA 2BU3A 2R9OA 4N79A 4YYWA 2NQAA 3IMAA 3OQCA 1GCBA 3USVA 2NQDB 3QJ3A 4M0WA 5CVOB 4I04A 1MHWA 3KFQA 1VSNA 4RF0A 2OZ2A 3BC3A 1K3BB 9PAPA 4W4UA 2E03A 2AUZA 2OP3A 3PHUA 4PADA 4DMXA 3K9MA 2B1NA 1QXPA 4MM3B 2PNSA 2R9CA 3P5VA 4D8IA 2PBHA 4PP1A 4QRGA 2DC8A 1AU4A 4YVAA 2DJFB 4XZXA 3IOQA 1PIPA 3PT2A 4P6GA 4MI7A 4K7CA 1CPJA 2F7DA 2G8EA 3H7DA 3OISA 3TNXA 1Q6KA 3I3TA 1THEA 2AYNA 2YJCA 1ICFA 4YYSA 3BY4A 2DZZA 1ME3A 2G6DA 4BOZA 1PADA 3E9SA 2JQFR 4N8WA 3RVVA 3ZUAA 2P0RA 1Y4HA 2XU3A 1KFXL 1GLOA 4HXDB 4W5CA 4Q8HA 3PDFA 3W31A 3P5UA 5K16A 3LFYA 2NQGA 2VHFA 4IP3A 4PP2E 3N3KA 1AYUA 3W30A 3O65A 3N3GA 2HD5A 1QDQA 2YJ9A 2NQIA 4PT5A 3B79A 1U9VA 1PVJA 2FQ9A 1A6RA 3HHAA 1GMYA 2DCDA 2IPPB 6PADA 1AIMA 1CB5A 4XR7A 2AUXA 2E02A 4FIPA 1EWLA 4IUMA 4DMYA 4ZTBA 4YYRA 1CJLA 2AS8A 2FE8A 4X6JA 3S3QA 1DKIA 4BOPA 2OULA 3WXEA 2R9FA 2FT2A 1SP4B 2AU1A 4W5BA 5CHVA 4WA6A 2DC7A 1NPZA 2VHSA 2IBIA 1NB5A 3PHXA 1YALA 1CS8A 1KHQA 3BBAA 3HHIA 2R9MA 1NB3A 1YK7A 3O0UA 1AYWA 1O0EA 3KWBX 1PPOA 1YVBA 4X6IA 4Q8GA 2PREA 1STFE 2YJBA 3QT4A 1ATKA 5F02A 3CH2X 1AU2A 4OVZA 1MIRA 5CVMA 2Y5BA 2JQGR 5EGWA 3CH3X 1PCIA 2BDLA 1NLJA 2R9NA 2E00A 1HUCB 1KXRA 2FO5A 4N4ZA 3TRKA 4CDFB 2DCCA 1SNKA 3BWKA 5PADA 3I06A 3MHSA 1ME4A 2UZJA 3K24A 4RY2A 4D8BA 1ZCMA 3H89A 3DF0A 1PE6A 1TU6A 2BTWB 3CBKA 5CHTA 3MP2A 3N4CA 1BY8A 4D8EA 3QSDA 1QOLA 4P16A 4YV8A 2R6NA 4GUAA 3GCBA 1CQDA 4OW0A 3BOWA 1MEGA 3RVXA 3IUTA 2P7UA 1YK8A 2G7YA 1MS6A 4CDDB 4RNAA 4MZOA 4X6HA 4RKXA 1U9XA 3IHPA 2XU1A 3C0RA 1YZBA 3KX1A 4BSQA 4FJCA 3MTVA 3MJ5A 2PADA 1U9QX 3BB7A 2H7JA 4MZSA 3HD3A 5E6JA 3HWNA 1ZIVA 4A5UA 3RVWA 1AYVA 2DZYA 2HHNA 1CSBB 4BOQA 2AIMA 3PBHA 3PSEA 1PBHA 2XU4A 1BP4A 1UKFA 3V6EA 2DCAA 1F2CA 4AXLA 3AI8A 4XUIA 2F1GA 1JQPA 3F75A 1DF0A 1F2AA 4OEMA 1MDWA 5KO3A 1U5IA 1BGOA 2JRIA 1X9YA 2FYEA 4REZA 3BCNA 2B1MA 2J7QC 4ZUXU 3B21A 3KW9A 1KFUL 3IV2A 3BPFA 4P6EA 5CVNB 2WBFX 2XU5A 4RF1A 1M6DA 3PRPA 1S4VA 1POPA 3OF8A 2E01A 3OVZA 1KHPA 5EF4A 1PPDA 4FK5A 1TLOA 2AVWA 3TMPA 2AGAA 1U9WA 2GHUA 1MEMA 8PCHA 4QH6A 1PPPA 4CDCB 4MSXA 2HXZA 2FTDA 4BOSA 5J94A 5JH3A 4CDEB 3KSEA 5JA7A 2YJ8A 3H8CA 2BDZA 2C0YA 1CV8A 1VJVA 5EZSA 1ITOA 3C9EA 2Z84A 1DEUA 1AU0A 4OELA 4AXMA 1AU3A 1NL6A 3MHHA 1XKGA
chains in the Genus database with same CATH topology
1CTEA 4C5PA 3ERVA 5FPWA 3U8EA 4QBBA 2CIOA 1Y08A 2FRAA 4KLBA 7PCKA 2DC6A 3K8UA 3NHEA 4BS5A 4QRXA 3F5VA 3IEJA 3OF9A 2DCBA 3PNRA 4CZWA 3MORA 1NQCA 2GFOA 3P5WA 3WXGA 4GUZA 4BPVA 1YT7A 1TL9A 2ACTA 2FUDA 3P5XA 4G54A 3WXFA 1EWMA 4HWYA 4BS6A 2O6XA 1EWPA 1CVZA 2G8JA 1BQIA 1FH0A 3O1GA 2AYOA 3V6CA 3KKUA 2ATOA 4YYVA 2YJ2A 3BPMA 1EWOA 2CB5A 4I05A 1F29A 1AECA 4I07A 3M99A 4BQVA 2HH5A 3S3RA 2FRQA 1PPNA 3KWZA 3OVXA 4QRVA 3MTNA 2Y6EA 2DJGB 4PI3A 5A24A 2DC9A 1GECE 3CBJA 3H6SA 1F2BA 4YYQA 3H8BA 1IWDA 3E1ZB 3PW3A 1EF7A 3D6SA 1QMYA 4YYUA 1PXVA 2P86A 2ARYA 3LXSA 2R9OA 4N79A 4YYWA 2NQAA 3IMAA 1GCBA 4NV7A 3USVA 2NQDB 3QJ3A 5CVOB 4I04A 1MHWA 3KFQA 1VSNA 2OZ2A 3BC3A 1K3BB 9PAPA 4W4UA 2E03A 2AUZA 2OP3A 4PADA 4DMXA 3K9MA 2B1NA 1QXPA 2PNSA 2R9CA 3P5VA 2PBHA 4PP1A 4QRGA 2DC8A 1AU4A 4YVAA 2DJFB 3IOQA 1PIPA 4P6GA 4K7CA 1CPJA 1W5RA 2F7DA 2G8EA 3H7DA 3OISA 3TNXA 1Q6KA 3I3TA 3LTWA 1THEA 2AYNA 2YJCA 1ICFA 4YYSA 2DZZA 1ME3A 2G6DA 1PADA 2JQFR 4N8WA 3RVVA 3ZUAA 2P0RA 1Y4HA 4BGFA 2XU3A 1KFXL 1GLOA 4W5CA 4Q8HA 3PDFA 3P5UA 5K16A 3LFYA 2NQGA 2VHFA 4PP2E 1W4TA 3N3KA 1AYUA 3N3GA 2HD5A 1QDQA 2YJ9A 2NQIA 3B79A 1U9VA 2FQ9A 1A6RA 2VFCA 3HHAA 1GMYA 2DCDA 2IPPB 6PADA 4NV8A 1AIMA 1CB5A 4XR7A 2AUXA 2E02A 4FIPA 1EWLA 4DMYA 4YYRA 1CJLA 2AS8A 4X6JA 3S3QA 2OULA 3WXEA 2R9FA 2FT2A 1SP4B 2AU1A 4W5BA 5CHVA 4WA6A 1W6FA 2DC7A 1NPZA 2VHSA 2IBIA 1NB5A 1GX3A 1YALA 1CS8A 1KHQA 3HHIA 2R9MA 1NB3A 1YK7A 3O0UA 1AYWA 1O0EA 3KWBX 1PPOA 1YVBA 4X6IA 4Q8GA 2PREA 1STFE 2YJBA 3QT4A 1ATKA 5F02A 3CH2X 1AU2A 1MIRA 5CVMA 2Y5BA 2JQGR 5EGWA 3CH3X 1PCIA 2BDLA 1NLJA 2R9NA 2E00A 2BSZA 1HUCB 1KXRA 2FO5A 4N4ZA 4CDFB 2DCCA 1SNKA 1E2TA 3BWKA 5PADA 3I06A 3MHSA 1ME4A 3K24A 4RY2A 1ZCMA 3H89A 3DF0A 1PE6A 1TU6A 3CBKA 5CHTA 3N4CA 1BY8A 3QSDA 1QOLA 4YV8A 2R6NA 3GCBA 1CQDA 3RVXA 3BOWA 1MEGA 3IUTA 2P7UA 1YK8A 2G7YA 1MS6A 4CDDB 4MZOA 4X6HA 1U9XA 3IHPA 2XU1A 3KX1A 4BSQA 4FJCA 2PADA 1U9QX 2H7JA 4MZSA 3HD3A 3HWNA 1ZIVA 3RVWA 1AYVA 2DZYA 2HHNA 1CSBB 2AIMA 3PBHA 1PBHA 2XU4A 1BP4A 3V6EA 2DCAA 1F2CA 4AXLA 3AI8A 4XUIA 2F1GA 1JQPA 3F75A 1DF0A 1F2AA 4OEMA 1MDWA 1U5IA 1BGOA 1X9YA 2FYEA 3BCNA 2B1MA 4ZUXU 3KW9A 1KFUL 3D9WA 3IV2A 3BPFA 4P6EA 5CVNB 2WBFX 2XU5A 1M6DA 1S4VA 1POPA 3OF8A 2E01A 3OVZA 1KHPA 5EF4A 1PPDA 4FK5A 1TLOA 2AVWA 4B55A 1U9WA 2GHUA 1MEMA 8PCHA 4QH6A 1PPPA 4CDCB 4MSXA 2HXZA 2FTDA 5J94A 5JH3A 4CDEB 3KSEA 5JA7A 2YJ8A 3H8CA 2BDZA 2C0YA 1CV8A 1VJVA 1ITOA 3C9EA 1DEUA 1AU0A 4OELA 4AXMA 2VFBA 1AU3A 1NL6A 3MHHA 1XKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CTE A;  3ERV A;  5FPW A;  3U8E A;  4QBB A;  2CIO A;  1Y08 A;  2FRA A;  4KLB A;  7PCK A;  2DC6 A;  3K8U A;  3NHE A;  4BS5 A;  4QRX A;  3F5V A;  3IEJ A;  3OF9 A;  2DCB A;  3PNR A;  4CZW A;  3MOR A;  1NQC A;  2GFO A;  3P5W A;  3WXG A;  4BPV A;  1YT7 A;  1TL9 A;  2ACT A;  2FUD A;  3P5X A;  4G54 A;  3WXF A;  1EWM A;  4HWY A;  4BS6 A;  2O6X A;  1EWP A;  1CVZ A;  2G8J A;  1BQI A;  1FH0 A;  3O1G A;  2AYO A;  3V6C A;  3KKU A;  2ATO A;  4YYV A;  2YJ2 A;  3BPM A;  1EWO A;  2CB5 A;  4I05 A;  1F29 A;  1AEC A;  4I07 A;  3M99 A;  4BQV A;  2HH5 A;  3S3R A;  2FRQ A;  1PPN A;  3KWZ A;  3OVX A;  4QRV A;  3MTN A;  2Y6E A;  2DJG B;  4PI3 A;  5A24 A;  2DC9 A;  1GEC E;  3CBJ A;  3H6S A;  1F2B A;  4YYQ A;  3H8B A;  1IWD A;  3E1Z B;  3PW3 A;  1EF7 A;  3D6S A;  1QMY A;  4YYU A;  1PXV A;  2P86 A;  2ARY A;  3LXS A;  2R9O A;  4N79 A;  4YYW A;  2NQA A;  3IMA A;  1GCB A;  3USV A;  2NQD B;  3QJ3 A;  5CVO B;  4I04 A;  1MHW A;  3KFQ A;  1VSN A;  2OZ2 A;  3BC3 A;  1K3B B;  9PAP A;  4W4U A;  2E03 A;  2AUZ A;  2OP3 A;  4PAD A;  4DMX A;  3K9M A;  2B1N A;  1QXP A;  2PNS A;  2R9C A;  3P5V A;  2PBH A;  4PP1 A;  4QRG A;  2DC8 A;  1AU4 A;  4YVA A;  2DJF B;  3IOQ A;  1PIP A;  4P6G A;  4K7C A;  1CPJ A;  2F7D A;  2G8E A;  3H7D A;  3OIS A;  3TNX A;  1Q6K A;  3I3T A;  1THE A;  2AYN A;  2YJC A;  1ICF A;  4YYS A;  2DZZ A;  1ME3 A;  2G6D A;  1PAD A;  2JQF R;  4N8W A;  3RVV A;  3ZUA A;  2P0R A;  1Y4H A;  2XU3 A;  1KFX L;  1GLO A;  4W5C A;  4Q8H A;  3PDF A;  3P5U A;  5K16 A;  3LFY A;  2NQG A;  2VHF A;  4PP2 E;  3N3K A;  1AYU A;  3N3G A;  2HD5 A;  1QDQ A;  2YJ9 A;  2NQI A;  3B79 A;  1U9V A;  2FQ9 A;  1A6R A;  3HHA A;  1GMY A;  2DCD A;  2IPP B;  6PAD A;  1AIM A;  1CB5 A;  4XR7 A;  2AUX A;  2E02 A;  4FIP A;  1EWL A;  4DMY A;  4YYR A;  1CJL A;  2AS8 A;  4X6J A;  3S3Q A;  2OUL A;  3WXE A;  2R9F A;  2FT2 A;  1SP4 B;  2AU1 A;  4W5B A;  5CHV A;  4WA6 A;  2DC7 A;  1NPZ A;  2VHS A;  2IBI A;  1NB5 A;  1YAL A;  1CS8 A;  1KHQ A;  3HHI A;  2R9M A;  1NB3 A;  1YK7 A;  3O0U A;  1AYW A;  1O0E A;  3KWB X;  1PPO A;  1YVB A;  4X6I A;  4Q8G A;  2PRE A;  1STF E;  2YJB A;  3QT4 A;  1ATK A;  5F02 A;  3CH2 X;  1AU2 A;  1MIR A;  5CVM A;  2Y5B A;  2JQG R;  5EGW A;  3CH3 X;  1PCI A;  2BDL A;  1NLJ A;  2R9N A;  2E00 A;  1HUC B;  1KXR A;  2FO5 A;  4N4Z A;  4CDF B;  2DCC A;  1SNK A;  3BWK A;  5PAD A;  3I06 A;  3MHS A;  1ME4 A;  3K24 A;  4RY2 A;  1ZCM A;  3H89 A;  3DF0 A;  1PE6 A;  1TU6 A;  3CBK A;  5CHT A;  3N4C A;  1BY8 A;  3QSD A;  1QOL A;  4YV8 A;  2R6N A;  3GCB A;  1CQD A;  3RVX A;  3BOW A;  1MEG A;  3IUT A;  2P7U A;  1YK8 A;  2G7Y A;  1MS6 A;  4CDD B;  4MZO A;  4X6H A;  1U9X A;  3IHP A;  2XU1 A;  3KX1 A;  4BSQ A;  4FJC A;  2PAD A;  1U9Q X;  2H7J A;  4MZS A;  3HD3 A;  3HWN A;  1ZIV A;  3RVW A;  1AYV A;  2DZY A;  2HHN A;  1CSB B;  2AIM A;  3PBH A;  1PBH A;  2XU4 A;  1BP4 A;  3V6E A;  2DCA A;  1F2C A;  4AXL A;  3AI8 A;  4XUI A;  2F1G A;  1JQP A;  3F75 A;  1DF0 A;  1F2A A;  4OEM A;  1MDW A;  1U5I A;  1BGO A;  1X9Y A;  2FYE A;  3BCN A;  2B1M A;  4ZUX U;  3KW9 A;  1KFU L;  3IV2 A;  3BPF A;  4P6E A;  5CVN B;  2WBF X;  2XU5 A;  1M6D A;  1S4V A;  1POP A;  3OF8 A;  2E01 A;  3OVZ A;  1KHP A;  5EF4 A;  1PPD A;  4FK5 A;  1TLO A;  2AVW A;  1U9W A;  2GHU A;  1MEM A;  8PCH A;  4QH6 A;  1PPP A;  4CDC B;  4MSX A;  2HXZ A;  2FTD A;  5J94 A;  5JH3 A;  4CDE B;  3KSE A;  5JA7 A;  2YJ8 A;  3H8C A;  2BDZ A;  2C0Y A;  1CV8 A;  1VJV A;  1ITO A;  3C9E A;  1DEU A;  1AU0 A;  4OEL A;  4AXM A;  1AU3 A;  1NL6 A;  3MHH A;  1XKG A; 
#chains in the Genus database with same CATH topology
 1CTE A;  3ERV A;  5FPW A;  3U8E A;  3PHW A;  4QBB A;  2CIO A;  1Y08 A;  2FRA A;  4KLB A;  7PCK A;  2DC6 A;  3K8U A;  3NHE A;  4BS5 A;  4QRX A;  3F5V A;  3IEJ A;  3OF9 A;  2JTC A;  2DCB A;  3PNR A;  4CZW A;  3MOR A;  1NQC A;  2GFO A;  3P5W A;  3WXG A;  4BPV A;  1YT7 A;  1TL9 A;  2ACT A;  2FUD A;  3P5X A;  4G54 A;  3WXF A;  1EWM A;  4HWY A;  5JZE A;  4BS6 A;  2O6X A;  1EWP A;  1CVZ A;  2G8J A;  1BQI A;  1FH0 A;  3O1G A;  2AYO A;  5EZQ A;  3V6C A;  3KKU A;  4WUR A;  2ATO A;  4YYV A;  3ZNH A;  2YJ2 A;  2J7Q A;  3BPM A;  1EWO A;  2CB5 A;  4I05 A;  1F29 A;  1AEC A;  2BTW A;  4I07 A;  3M99 A;  4BQV A;  4OVZ B;  2HH5 A;  3S3R A;  2FRQ A;  3PRM A;  1PPN A;  3KWZ A;  3OVX A;  4R3D A;  2HWK A;  3MTN A;  4QRV A;  2Y6E A;  2DJG B;  4PI3 A;  5A24 A;  2DC9 A;  1GEC E;  3CBJ A;  4BOU A;  3H6S A;  1F2B A;  4YYQ A;  3H8B A;  1IWD A;  3E1Z B;  3PW3 A;  3RNV A;  1EF7 A;  3D6S A;  3IFU A;  1QMY A;  4YYU A;  1PXV A;  2DOS A;  2P86 A;  2ARY A;  3LXS A;  2BU3 A;  2R9O A;  4N79 A;  4YYW A;  2NQA A;  3IMA A;  3OQC A;  1GCB A;  3USV A;  2NQD B;  3QJ3 A;  4M0W A;  5CVO B;  4I04 A;  1MHW A;  3KFQ A;  1VSN A;  4RF0 A;  2OZ2 A;  3BC3 A;  1K3B B;  9PAP A;  4W4U A;  2E03 A;  2AUZ A;  2OP3 A;  3PHU A;  4PAD A;  4DMX A;  3K9M A;  2B1N A;  1QXP A;  4MM3 B;  2PNS A;  2R9C A;  3P5V A;  4D8I A;  2PBH A;  4PP1 A;  4QRG A;  2DC8 A;  1AU4 A;  4YVA A;  2DJF B;  4XZX A;  3IOQ A;  1PIP A;  3PT2 A;  4P6G A;  4MI7 A;  4K7C A;  1CPJ A;  2F7D A;  2G8E A;  3H7D A;  3OIS A;  3TNX A;  1Q6K A;  3I3T A;  1THE A;  2AYN A;  2YJC A;  1ICF A;  4YYS A;  3BY4 A;  2DZZ A;  1ME3 A;  2G6D A;  4BOZ A;  1PAD A;  3E9S A;  2JQF R;  4N8W A;  3RVV A;  3ZUA A;  2P0R A;  1Y4H A;  2XU3 A;  1KFX L;  1GLO A;  4HXD B;  4W5C A;  4Q8H A;  3PDF A;  3W31 A;  3P5U A;  5K16 A;  3LFY A;  2NQG A;  2VHF A;  4IP3 A;  4PP2 E;  3N3K A;  1AYU A;  3W30 A;  3O65 A;  3N3G A;  2HD5 A;  1QDQ A;  2YJ9 A;  2NQI A;  4PT5 A;  3B79 A;  1U9V A;  1PVJ A;  2FQ9 A;  1A6R A;  3HHA A;  1GMY A;  2DCD A;  2IPP B;  6PAD A;  1AIM A;  1CB5 A;  4XR7 A;  2AUX A;  2E02 A;  4FIP A;  1EWL A;  4IUM A;  4DMY A;  4ZTB A;  4YYR A;  1CJL A;  2AS8 A;  2FE8 A;  4X6J A;  3S3Q A;  1DKI A;  4BOP A;  2OUL A;  3WXE A;  2R9F A;  2FT2 A;  1SP4 B;  2AU1 A;  4W5B A;  5CHV A;  4WA6 A;  2DC7 A;  1NPZ A;  2VHS A;  2IBI A;  1NB5 A;  3PHX A;  1YAL A;  1CS8 A;  1KHQ A;  3BBA A;  3HHI A;  2R9M A;  1NB3 A;  1YK7 A;  3O0U A;  1AYW A;  1O0E A;  3KWB X;  1PPO A;  1YVB A;  4X6I A;  4Q8G A;  2PRE A;  1STF E;  2YJB A;  3QT4 A;  1ATK A;  5F02 A;  3CH2 X;  1AU2 A;  4OVZ A;  1MIR A;  5CVM A;  2Y5B A;  2JQG R;  5EGW A;  3CH3 X;  1PCI A;  2BDL A;  1NLJ A;  2R9N A;  2E00 A;  1HUC B;  1KXR A;  2FO5 A;  4N4Z A;  3TRK A;  4CDF B;  2DCC A;  1SNK A;  3BWK A;  5PAD A;  3I06 A;  3MHS A;  1ME4 A;  2UZJ A;  3K24 A;  4RY2 A;  4D8B A;  1ZCM A;  3H89 A;  3DF0 A;  1PE6 A;  1TU6 A;  2BTW B;  3CBK A;  5CHT A;  3MP2 A;  3N4C A;  1BY8 A;  4D8E A;  3QSD A;  1QOL A;  4P16 A;  4YV8 A;  2R6N A;  4GUA A;  3GCB A;  1CQD A;  4OW0 A;  3BOW A;  1MEG A;  3RVX A;  3IUT A;  2P7U A;  1YK8 A;  2G7Y A;  1MS6 A;  4CDD B;  4RNA A;  4MZO A;  4X6H A;  4RKX A;  1U9X A;  3IHP A;  2XU1 A;  3C0R A;  1YZB A;  3KX1 A;  4BSQ A;  4FJC A;  3MTV A;  3MJ5 A;  2PAD A;  1U9Q X;  3BB7 A;  2H7J A;  4MZS A;  3HD3 A;  5E6J A;  3HWN A;  1ZIV A;  4A5U A;  3RVW A;  1AYV A;  2DZY A;  2HHN A;  1CSB B;  4BOQ A;  2AIM A;  3PBH A;  3PSE A;  1PBH A;  2XU4 A;  1BP4 A;  1UKF A;  3V6E A;  2DCA A;  1F2C A;  4AXL A;  3AI8 A;  4XUI A;  2F1G A;  1JQP A;  3F75 A;  1DF0 A;  1F2A A;  4OEM A;  1MDW A;  5KO3 A;  1U5I A;  1BGO A;  2JRI A;  1X9Y A;  2FYE A;  4REZ A;  3BCN A;  2B1M A;  2J7Q C;  4ZUX U;  3B21 A;  3KW9 A;  1KFU L;  3IV2 A;  3BPF A;  4P6E A;  5CVN B;  2WBF X;  2XU5 A;  4RF1 A;  1M6D A;  3PRP A;  1S4V A;  1POP A;  3OF8 A;  2E01 A;  3OVZ A;  1KHP A;  5EF4 A;  1PPD A;  4FK5 A;  1TLO A;  2AVW A;  3TMP A;  2AGA A;  1U9W A;  2GHU A;  1MEM A;  8PCH A;  4QH6 A;  1PPP A;  4CDC B;  4MSX A;  2HXZ A;  2FTD A;  4BOS A;  5J94 A;  5JH3 A;  4CDE B;  3KSE A;  5JA7 A;  2YJ8 A;  3H8C A;  2BDZ A;  2C0Y A;  1CV8 A;  1VJV A;  5EZS A;  1ITO A;  3C9E A;  2Z84 A;  1DEU A;  1AU0 A;  4OEL A;  4AXM A;  1AU3 A;  1NL6 A;  3MHH A;  1XKG A; 
#chains in the Genus database with same CATH homology
 1CTE A;  4C5P A;  3ERV A;  5FPW A;  3U8E A;  4QBB A;  2CIO A;  1Y08 A;  2FRA A;  4KLB A;  7PCK A;  2DC6 A;  3K8U A;  3NHE A;  4BS5 A;  4QRX A;  3F5V A;  3IEJ A;  3OF9 A;  2DCB A;  3PNR A;  4CZW A;  3MOR A;  1NQC A;  2GFO A;  3P5W A;  3WXG A;  4GUZ A;  4BPV A;  1YT7 A;  1TL9 A;  2ACT A;  2FUD A;  3P5X A;  4G54 A;  3WXF A;  1EWM A;  4HWY A;  4BS6 A;  2O6X A;  1EWP A;  1CVZ A;  2G8J A;  1BQI A;  1FH0 A;  3O1G A;  2AYO A;  3V6C A;  3KKU A;  2ATO A;  4YYV A;  2YJ2 A;  3BPM A;  1EWO A;  2CB5 A;  4I05 A;  1F29 A;  1AEC A;  4I07 A;  3M99 A;  4BQV A;  2HH5 A;  3S3R A;  2FRQ A;  1PPN A;  3KWZ A;  3OVX A;  4QRV A;  3MTN A;  2Y6E A;  2DJG B;  4PI3 A;  5A24 A;  2DC9 A;  1GEC E;  3CBJ A;  3H6S A;  1F2B A;  4YYQ A;  3H8B A;  1IWD A;  3E1Z B;  3PW3 A;  1EF7 A;  3D6S A;  1QMY A;  4YYU A;  1PXV A;  2P86 A;  2ARY A;  3LXS A;  2R9O A;  4N79 A;  4YYW A;  2NQA A;  3IMA A;  1GCB A;  4NV7 A;  3USV A;  2NQD B;  3QJ3 A;  5CVO B;  4I04 A;  1MHW A;  3KFQ A;  1VSN A;  2OZ2 A;  3BC3 A;  1K3B B;  9PAP A;  4W4U A;  2E03 A;  2AUZ A;  2OP3 A;  4PAD A;  4DMX A;  3K9M A;  2B1N A;  1QXP A;  2PNS A;  2R9C A;  3P5V A;  2PBH A;  4PP1 A;  4QRG A;  2DC8 A;  1AU4 A;  4YVA A;  2DJF B;  3IOQ A;  1PIP A;  4P6G A;  4K7C A;  1CPJ A;  1W5R A;  2F7D A;  2G8E A;  3H7D A;  3OIS A;  3TNX A;  1Q6K A;  3I3T A;  3LTW A;  1THE A;  2AYN A;  2YJC A;  1ICF A;  4YYS A;  2DZZ A;  1ME3 A;  2G6D A;  1PAD A;  2JQF R;  4N8W A;  3RVV A;  3ZUA A;  2P0R A;  1Y4H A;  4BGF A;  2XU3 A;  1KFX L;  1GLO A;  4W5C A;  4Q8H A;  3PDF A;  3P5U A;  5K16 A;  3LFY A;  2NQG A;  2VHF A;  4PP2 E;  1W4T A;  3N3K A;  1AYU A;  3N3G A;  2HD5 A;  1QDQ A;  2YJ9 A;  2NQI A;  3B79 A;  1U9V A;  2FQ9 A;  1A6R A;  2VFC A;  3HHA A;  1GMY A;  2DCD A;  2IPP B;  6PAD A;  4NV8 A;  1AIM A;  1CB5 A;  4XR7 A;  2AUX A;  2E02 A;  4FIP A;  1EWL A;  4DMY A;  4YYR A;  1CJL A;  2AS8 A;  4X6J A;  3S3Q A;  2OUL A;  3WXE A;  2R9F A;  2FT2 A;  1SP4 B;  2AU1 A;  4W5B A;  5CHV A;  4WA6 A;  1W6F A;  2DC7 A;  1NPZ A;  2VHS A;  2IBI A;  1NB5 A;  1GX3 A;  1YAL A;  1CS8 A;  1KHQ A;  3HHI A;  2R9M A;  1NB3 A;  1YK7 A;  3O0U A;  1AYW A;  1O0E A;  3KWB X;  1PPO A;  1YVB A;  4X6I A;  4Q8G A;  2PRE A;  1STF E;  2YJB A;  3QT4 A;  1ATK A;  5F02 A;  3CH2 X;  1AU2 A;  1MIR A;  5CVM A;  2Y5B A;  2JQG R;  5EGW A;  3CH3 X;  1PCI A;  2BDL A;  1NLJ A;  2R9N A;  2E00 A;  2BSZ A;  1HUC B;  1KXR A;  2FO5 A;  4N4Z A;  4CDF B;  2DCC A;  1SNK A;  1E2T A;  3BWK A;  5PAD A;  3I06 A;  3MHS A;  1ME4 A;  3K24 A;  4RY2 A;  1ZCM A;  3H89 A;  3DF0 A;  1PE6 A;  1TU6 A;  3CBK A;  5CHT A;  3N4C A;  1BY8 A;  3QSD A;  1QOL A;  4YV8 A;  2R6N A;  3GCB A;  1CQD A;  3RVX A;  3BOW A;  1MEG A;  3IUT A;  2P7U A;  1YK8 A;  2G7Y A;  1MS6 A;  4CDD B;  4MZO A;  4X6H A;  1U9X A;  3IHP A;  2XU1 A;  3KX1 A;  4BSQ A;  4FJC A;  2PAD A;  1U9Q X;  2H7J A;  4MZS A;  3HD3 A;  3HWN A;  1ZIV A;  3RVW A;  1AYV A;  2DZY A;  2HHN A;  1CSB B;  2AIM A;  3PBH A;  1PBH A;  2XU4 A;  1BP4 A;  3V6E A;  2DCA A;  1F2C A;  4AXL A;  3AI8 A;  4XUI A;  2F1G A;  1JQP A;  3F75 A;  1DF0 A;  1F2A A;  4OEM A;  1MDW A;  1U5I A;  1BGO A;  1X9Y A;  2FYE A;  3BCN A;  2B1M A;  4ZUX U;  3KW9 A;  1KFU L;  3D9W A;  3IV2 A;  3BPF A;  4P6E A;  5CVN B;  2WBF X;  2XU5 A;  1M6D A;  1S4V A;  1POP A;  3OF8 A;  2E01 A;  3OVZ A;  1KHP A;  5EF4 A;  1PPD A;  4FK5 A;  1TLO A;  2AVW A;  4B55 A;  1U9W A;  2GHU A;  1MEM A;  8PCH A;  4QH6 A;  1PPP A;  4CDC B;  4MSX A;  2HXZ A;  2FTD A;  5J94 A;  5JH3 A;  4CDE B;  3KSE A;  5JA7 A;  2YJ8 A;  3H8C A;  2BDZ A;  2C0Y A;  1CV8 A;  1VJV A;  1ITO A;  3C9E A;  1DEU A;  1AU0 A;  4OEL A;  4AXM A;  2VFB A;  1AU3 A;  1NL6 A;  3MHH A;  1XKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...