1PPOA

Determination of the structure of papaya protease omega
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
216
structure length
216
Chain Sequence
LPENVDWRKKGAVTPVRHQGSCGSCWAFSAVATVEGINKIRTGKLVELSEQELVDCERRSHGCKGGYPPYALEYVAKNGIHLRSKYPYKAKQGTCRAKQVGGPIVKTSGVGRVQPNNEGNLLNAIAKQPVSVVVESKGRPFQLYKGGIFEGPCGTKVDHAVTAVGYGKSGGKGYILIKNSWGTAWGEKGYIRIKRAPGNSPGVCGLYKSSYYPTKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEASE OMEGA
publication title Determination of the Structure of Papaya Protease Omega
pubmed rcsb
source organism Carica papaya
molecule tags Hydrolase(thiol protease)
total genus 62
structure length 216
sequence length 216
ec nomenclature ec 3.4.22.30: Caricain.
pdb deposition date 1991-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1ppoA00
3F5VA 2DZYA 4P6EA 1CVZA 2G8JA 3QJ3A 2OP3A 2E00A 4OEMA 4W5CA 3CH3X 3ERVA 1F2BA 1AU4A 2G7YA 3BWKA 3K24A 4YYQA 1EWOA 1SP4B 3LFYA 4X6JA 1EWLA 1F2AA 4FK5A 2G8EA 1QDQA 1GCBA 1TLOA 1X9YA 2ATOA 4MSXA 4X6HA 4I07A 1Y08A 1YALA 1KFXL 5CHVA 3CBJA 2GFOA 1PPOA 1PPPA 2R9CA 1ME3A 3F75A 3K9MA 3O0UA 4YYWA 4CDDB 2CIOA 5CVMA 4N4ZA 2DC6A 2DZZA 3ZUAA 2FQ9A 2PREA 4AXLA 2R6NA 4X6IA 4P6GA 4YV8A 1KFUL 4QRXA 3OISA 4PADA 3DF0A 2AUXA 2BDZA 2HHNA 4N79A 1EWPA 2DCDA 1MHWA 2F7DA 1QXPA 3H7DA 1PIPA 4QH6A 1Q6KA 1VSNA 2Y5BA 3C9EA 1NQCA 3E1ZB 3N3GA 3MORA 1AECA 3K8UA 1GECE 2FO5A 2YJCA 4WA6A 1ME4A 3BPFA 2HD5A 1K3BB 1U9VA 2PADA 1POPA 1YT7A 2XU5A 1BP4A 2E01A 1NB5A 1YK8A 4FJCA 1NB3A 3H8CA 2ARYA 1AYWA 2YJBA 1VJVA 3IMAA 9PAPA 1PPDA 3OVXA 1U9XA 4K7CA 1ATKA 5FPWA 4AXMA 3AI8A 4CDCB 3B79A 2HH5A 5CVNB 3WXFA 4PI3A 4YYVA 3P5UA 3KFQA 3HHIA 3HWNA 4W5BA 1ZIVA 4I04A 1JQPA 1EF7A 2R9NA 4KLBA 3WXEA 1DF0A 2AYOA 8PCHA 1CB5A 3H89A 1PADA 3I06A 3I3TA 5F02A 2NQAA 1CSBB 2CB5A 3PBHA 4XUIA 2R9OA 2DCAA 1SNKA 3BOWA 1DEUA 3KSEA 2E03A 1GLOA 2DC9A 2VHSA 1NPZA 3O1GA 1HUCB 2Y6EA 3TNXA 1IWDA 4PP2E 5JH3A 2XU4A 2GHUA 4BPVA 3RVXA 1ICFA 4PP1A 3BC3A 4G54A 2AU1A 3IEJA 2FYEA 2WBFX 2AVWA 1NL6A 2DC7A 3H6SA 2PBHA 3IOQA 3HHAA 1PXVA 4MZOA 5CHTA 3NHEA 3QT4A 2R9FA 3USVA 3MTNA 2C0YA 4QRVA 2BDLA 4QRGA 3PDFA 3IUTA 1AYUA 3M99A 2AS8A 1CPJA 1CV8A 7PCKA 1BGOA 3V6CA 4N8WA 2FUDA 3CH2X 2JQFR 4W4UA 2DC8A 3PNRA 1MEMA 5EGWA 3S3QA 6PADA 1Y4HA 2P7UA 3GCBA 4BSQA 2YJ8A 2DCBA 4QBBA 4BQVA 2IPPB 2OZ2A 1ITOA 4YVAA 2AYNA 4Q8GA 1PE6A 1KXRA 2E02A 2PNSA 3MHHA 4XR7A 4BS5A 3WXGA 1GMYA 2IBIA 2DJFB 3BCNA 1AU0A 1FH0A 3KKUA 4DMXA 1AU2A 2NQGA 3N4CA 2YJ9A 3S3RA 3OVZA 1KHPA 3PW3A 1BQIA 3V6EA 2AUZA 3OF9A 1YK7A 3U8EA 2DJGB 4ZUXU 5K16A 1MS6A 2P0RA 2H7JA 2JQGR 5JA7A 3KWBX 1AIMA 1TL9A 4OELA 4YYUA 2OULA 1MIRA 3KWZA 3N3KA 1EWMA 3P5XA 5J94A 2XU3A 1U5IA 1F2CA 2HXZA 3LXSA 1BY8A 1XKGA 4MZSA 3RVWA 3D6SA 3KW9A 3H8BA 2R9MA 1CQDA 3IV2A 4HWYA 2B1NA 2B1MA 1KHQA 3KX1A 2FTDA 4CDEB 5PADA 1A6RA 1U9QX 1F29A 4FIPA 3CBKA 4CZWA 3P5WA 4DMYA 1AYVA 1PPNA 3P5VA 1STFE 2XU1A 2NQIA 3RVVA 4I05A 1MDWA 1YVBA 2DCCA 5CVOB 3MHSA 1CS8A 1CJLA 3IHPA 1QOLA 1PCIA 3BPMA 1MEGA 4CDFB 2VHFA 1QMYA 1PBHA 2P86A 2FRAA 3QSDA 1THEA 2FT2A 4BS6A 5A24A 2O6XA 2F1GA 1ZCMA 2AIMA 2G6DA 4YYSA 1U9WA 1O0EA 4RY2A 2YJ2A 5EF4A 2FRQA 1CTEA 4YYRA 2ACTA 1S4VA 2NQDB 1NLJA 4Q8HA 3OF8A 3HD3A 1M6DA 1AU3A 1TU6A
chains in the Genus database with same CATH superfamily
3F5VA 2DZYA 4P6EA 1CVZA 2G8JA 2UZJA 3QJ3A 2OP3A 3TRKA 2E00A 4OEMA 5KO3A 4OVZA 4W5CA 3RNVA 3CH3X 4BOQA 3W30A 3ERVA 1F2BA 3PHUA 1AU4A 2G7YA 3BWKA 3K24A 4YYQA 1EWOA 1SP4B 3LFYA 4X6JA 1EWLA 1F2AA 4FK5A 2G8EA 1QDQA 2J7QC 1GCBA 1TLOA 1X9YA 2ATOA 4MSXA 4X6HA 3C0RA 4I07A 1Y08A 1YALA 1KFXL 5CHVA 3CBJA 2GFOA 4R3DA 1PPOA 1PPPA 3OQCA 2R9CA 1ME3A 3F75A 3K9MA 3O0UA 4YYWA 4CDDB 2CIOA 5CVMA 4N4ZA 4XZXA 4D8IA 2DC6A 2DZZA 3ZUAA 3BBAA 2BTWB 2FQ9A 2PREA 4P16A 2JRIA 4AXLA 2R6NA 4X6IA 4P6GA 4A5UA 4YV8A 1KFUL 4QRXA 3OISA 4PADA 3DF0A 4D8BA 5JZEA 2AUXA 4D8EA 2BDZA 2HHNA 4N79A 1EWPA 2DCDA 1MHWA 2F7DA 1QXPA 3H7DA 1PIPA 4QH6A 1Q6KA 1VSNA 2Z84A 2Y5BA 3C9EA 4BOSA 5E6JA 1NQCA 2DOSA 3E1ZB 3N3GA 3MORA 1AECA 3K8UA 4IUMA 1GECE 2FO5A 2YJCA 4WA6A 1ME4A 3BPFA 2HD5A 1K3BB 4OVZB 1U9VA 2PADA 1POPA 1YT7A 2XU5A 4RF1A 1BP4A 2E01A 1NB5A 1YK8A 4FJCA 1NB3A 3H8CA 2ARYA 1AYWA 2YJBA 1VJVA 3IMAA 3PHXA 9PAPA 3W31A 1PPDA 3OVXA 1U9XA 4K7CA 1ATKA 5FPWA 4AXMA 3AI8A 4CDCB 4WURA 3B79A 2HH5A 5CVNB 3WXFA 2FE8A 4PI3A 4YYVA 3P5UA 4HXDB 3KFQA 3HHIA 3HWNA 4W5BA 1ZIVA 4I04A 1JQPA 1EF7A 2R9NA 4KLBA 3WXEA 1DF0A 2AYOA 8PCHA 1CB5A 3H89A 1PADA 4BOZA 3I06A 3I3TA 5F02A 2NQAA 1CSBB 3BY4A 2CB5A 3PBHA 4XUIA 2R9OA 4BOPA 2DCAA 1SNKA 3BOWA 3E9SA 1DEUA 3KSEA 2E03A 1GLOA 2DC9A 2VHSA 1NPZA 3O1GA 1HUCB 2Y6EA 3TNXA 1IWDA 4PP2E 4M0WA 5JH3A 2XU4A 1PVJA 2GHUA 4BPVA 3RVXA 3O65A 1ICFA 4PP1A 3BC3A 4G54A 5EZSA 2AU1A 3IEJA 2FYEA 2WBFX 2AVWA 1NL6A 2DC7A 3H6SA 1UKFA 3PHWA 2PBHA 3IOQA 3HHAA 3TMPA 1PXVA 4MZOA 5CHTA 3NHEA 3QT4A 2R9FA 3USVA 3MTNA 2C0YA 4QRVA 2BDLA 4QRGA 2BU3A 3PDFA 3IUTA 1AYUA 3M99A 2AS8A 1CPJA 1CV8A 7PCKA 1BGOA 3V6CA 2HWKA 3PRPA 4N8WA 2FUDA 3CH2X 2JQFR 3PSEA 4W4UA 2DC8A 3PNRA 2BTWA 1MEMA 5EGWA 3S3QA 6PADA 1Y4HA 2P7UA 3GCBA 4BSQA 2YJ8A 2DCBA 4QBBA 4BQVA 2IPPB 2OZ2A 1ITOA 4YVAA 2AYNA 3MP2A 4Q8GA 1PE6A 1KXRA 2E02A 2PNSA 3MHHA 4XR7A 4BS5A 3WXGA 1GMYA 2IBIA 2DJFB 3BCNA 1AU0A 1FH0A 3KKUA 4DMXA 1AU2A 2NQGA 3N4CA 2YJ9A 3S3RA 3OVZA 1KHPA 3PW3A 1BQIA 3V6EA 2AUZA 3OF9A 1YK7A 3MJ5A 3U8EA 2DJGB 4ZUXU 5K16A 4RNAA 1MS6A 2P0RA 4MI7A 4RKXA 2H7JA 2JQGR 2J7QA 5JA7A 3KWBX 1AIMA 1TL9A 4OELA 4YYUA 2OULA 1MIRA 4IP3A 3KWZA 3N3KA 1EWMA 3P5XA 3ZNHA 5J94A 2XU3A 1DKIA 1U5IA 3MTVA 4ZTBA 1F2CA 2HXZA 3LXSA 4REZA 1BY8A 3PRMA 1XKGA 4MZSA 3RVWA 3D6SA 3KW9A 3H8BA 2R9MA 1CQDA 3IV2A 4HWYA 2B1NA 2B1MA 1KHQA 2AGAA 3KX1A 2FTDA 4CDEB 3IFUA 5PADA 1A6RA 1U9QX 1F29A 4FIPA 3CBKA 3B21A 4CZWA 3P5WA 4DMYA 1AYVA 1PPNA 2JTCA 3P5VA 1STFE 2XU1A 2NQIA 3RVVA 4I05A 1MDWA 3BB7A 1YVBA 2DCCA 5CVOB 3MHSA 1CS8A 1CJLA 3IHPA 5EZQA 1QOLA 1PCIA 3BPMA 1YZBA 1MEGA 4CDFB 2VHFA 4OW0A 1QMYA 1PBHA 2P86A 2FRAA 3QSDA 1THEA 2FT2A 4BOUA 4BS6A 5A24A 2O6XA 4MM3B 3PT2A 2F1GA 1ZCMA 2AIMA 2G6DA 4YYSA 4RF0A 1U9WA 1O0EA 4RY2A 2YJ2A 5EF4A 2FRQA 4PT5A 1CTEA 4YYRA 2ACTA 1S4VA 2NQDB 1NLJA 4Q8HA 4GUAA 3OF8A 3HD3A 1M6DA 1AU3A 1TU6A
chains in the Genus database with same CATH topology
3F5VA 2DZYA 4P6EA 1CVZA 2G8JA 3QJ3A 2OP3A 2E00A 4OEMA 4W5CA 3CH3X 3ERVA 1F2BA 1AU4A 2G7YA 3BWKA 3K24A 4YYQA 1EWOA 1SP4B 3LFYA 4X6JA 1EWLA 1W6FA 1F2AA 1E2TA 4FK5A 2G8EA 1QDQA 1GX3A 1GCBA 1TLOA 1X9YA 2ATOA 4MSXA 4X6HA 4I07A 1Y08A 1YALA 1KFXL 5CHVA 3CBJA 2GFOA 1PPOA 1PPPA 2R9CA 1ME3A 3F75A 3K9MA 3O0UA 4YYWA 4CDDB 2CIOA 5CVMA 4N4ZA 2DC6A 2DZZA 3ZUAA 2FQ9A 2PREA 4AXLA 2R6NA 4X6IA 4P6GA 4YV8A 1KFUL 4QRXA 3OISA 4PADA 3DF0A 2AUXA 2BDZA 2HHNA 4N79A 1EWPA 2DCDA 1MHWA 2F7DA 1QXPA 3H7DA 1PIPA 4QH6A 1Q6KA 1VSNA 2Y5BA 3C9EA 1NQCA 3E1ZB 3N3GA 3MORA 1AECA 4NV8A 3K8UA 1GECE 2FO5A 2YJCA 4WA6A 1ME4A 3BPFA 2HD5A 1K3BB 1U9VA 2PADA 1POPA 1YT7A 2XU5A 1BP4A 2E01A 2VFCA 1NB5A 1YK8A 4FJCA 1NB3A 3H8CA 2ARYA 1AYWA 2YJBA 1VJVA 3IMAA 9PAPA 1PPDA 3OVXA 1U9XA 4K7CA 1ATKA 5FPWA 4AXMA 3AI8A 4CDCB 3B79A 2HH5A 5CVNB 3WXFA 4PI3A 4YYVA 3P5UA 3D9WA 3KFQA 3HHIA 3HWNA 4W5BA 1ZIVA 4I04A 1JQPA 1EF7A 2R9NA 4KLBA 3WXEA 1DF0A 2AYOA 8PCHA 1CB5A 3H89A 1PADA 3I06A 3I3TA 5F02A 2NQAA 1CSBB 2CB5A 3PBHA 4XUIA 2R9OA 2DCAA 1SNKA 3BOWA 1DEUA 3KSEA 2E03A 1GLOA 2DC9A 2VHSA 1NPZA 3O1GA 1HUCB 2Y6EA 3TNXA 1IWDA 4PP2E 5JH3A 2XU4A 2GHUA 4BPVA 3RVXA 1ICFA 4PP1A 3BC3A 4G54A 2AU1A 3IEJA 2FYEA 2WBFX 2AVWA 1NL6A 2DC7A 3H6SA 2PBHA 3IOQA 3HHAA 1PXVA 4MZOA 5CHTA 3NHEA 3QT4A 2R9FA 3USVA 3MTNA 2C0YA 4QRVA 2BDLA 4QRGA 3PDFA 3IUTA 1AYUA 3M99A 2AS8A 1CPJA 1CV8A 7PCKA 1BGOA 3V6CA 4N8WA 2FUDA 3CH2X 2JQFR 4W4UA 2DC8A 3PNRA 1MEMA 5EGWA 3S3QA 6PADA 1Y4HA 2P7UA 3GCBA 4BSQA 2YJ8A 2DCBA 4QBBA 4BQVA 2IPPB 2OZ2A 4BGFA 1ITOA 4YVAA 2AYNA 4Q8GA 1PE6A 1KXRA 2E02A 2PNSA 3MHHA 4XR7A 4BS5A 3WXGA 1GMYA 2IBIA 2DJFB 3BCNA 1AU0A 1FH0A 3KKUA 4DMXA 1AU2A 2NQGA 3N4CA 2YJ9A 3S3RA 3OVZA 1KHPA 3PW3A 1BQIA 3V6EA 2AUZA 3OF9A 1W5RA 1YK7A 3U8EA 2DJGB 4ZUXU 5K16A 1MS6A 2P0RA 2H7JA 2JQGR 5JA7A 3KWBX 1AIMA 1TL9A 4OELA 4YYUA 2BSZA 2OULA 1MIRA 3KWZA 3N3KA 1EWMA 3P5XA 5J94A 2XU3A 1U5IA 1F2CA 2HXZA 3LXSA 1BY8A 1XKGA 4MZSA 4NV7A 1W4TA 3RVWA 2VFBA 3D6SA 3KW9A 3H8BA 2R9MA 1CQDA 3IV2A 4HWYA 2B1NA 2B1MA 4GUZA 1KHQA 3KX1A 2FTDA 4CDEB 5PADA 1A6RA 1U9QX 1F29A 4FIPA 3CBKA 4CZWA 3P5WA 4DMYA 1AYVA 1PPNA 3P5VA 1STFE 2XU1A 2NQIA 3RVVA 4I05A 1MDWA 1YVBA 2DCCA 5CVOB 3MHSA 1CS8A 1CJLA 3IHPA 1QOLA 1PCIA 3BPMA 1MEGA 3LTWA 4CDFB 2VHFA 1QMYA 1PBHA 2P86A 2FRAA 3QSDA 1THEA 2FT2A 4BS6A 5A24A 2O6XA 2F1GA 1ZCMA 2AIMA 2G6DA 4YYSA 1U9WA 4B55A 1O0EA 4RY2A 2YJ2A 5EF4A 2FRQA 1CTEA 4YYRA 2ACTA 1S4VA 2NQDB 4C5PA 1NLJA 4Q8HA 3OF8A 3HD3A 1M6DA 1AU3A 1TU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F5V A;  2DZY A;  4P6E A;  1CVZ A;  2G8J A;  3QJ3 A;  2OP3 A;  2E00 A;  4OEM A;  4W5C A;  3CH3 X;  3ERV A;  1F2B A;  1AU4 A;  2G7Y A;  3BWK A;  3K24 A;  4YYQ A;  1EWO A;  1SP4 B;  3LFY A;  4X6J A;  1EWL A;  1F2A A;  4FK5 A;  2G8E A;  1QDQ A;  1GCB A;  1TLO A;  1X9Y A;  2ATO A;  4MSX A;  4X6H A;  4I07 A;  1Y08 A;  1YAL A;  1KFX L;  5CHV A;  3CBJ A;  2GFO A;  1PPO A;  1PPP A;  2R9C A;  1ME3 A;  3F75 A;  3K9M A;  3O0U A;  4YYW A;  4CDD B;  2CIO A;  5CVM A;  4N4Z A;  2DC6 A;  2DZZ A;  3ZUA A;  2FQ9 A;  2PRE A;  4AXL A;  2R6N A;  4X6I A;  4P6G A;  4YV8 A;  1KFU L;  4QRX A;  3OIS A;  4PAD A;  3DF0 A;  2AUX A;  2BDZ A;  2HHN A;  4N79 A;  1EWP A;  2DCD A;  1MHW A;  2F7D A;  1QXP A;  3H7D A;  1PIP A;  4QH6 A;  1Q6K A;  1VSN A;  2Y5B A;  3C9E A;  1NQC A;  3E1Z B;  3N3G A;  3MOR A;  1AEC A;  3K8U A;  1GEC E;  2FO5 A;  2YJC A;  4WA6 A;  1ME4 A;  3BPF A;  2HD5 A;  1K3B B;  1U9V A;  2PAD A;  1POP A;  1YT7 A;  2XU5 A;  1BP4 A;  2E01 A;  1NB5 A;  1YK8 A;  4FJC A;  1NB3 A;  3H8C A;  2ARY A;  1AYW A;  2YJB A;  1VJV A;  3IMA A;  9PAP A;  1PPD A;  3OVX A;  1U9X A;  4K7C A;  1ATK A;  5FPW A;  4AXM A;  3AI8 A;  4CDC B;  3B79 A;  2HH5 A;  5CVN B;  3WXF A;  4PI3 A;  4YYV A;  3P5U A;  3KFQ A;  3HHI A;  3HWN A;  4W5B A;  1ZIV A;  4I04 A;  1JQP A;  1EF7 A;  2R9N A;  4KLB A;  3WXE A;  1DF0 A;  2AYO A;  8PCH A;  1CB5 A;  3H89 A;  1PAD A;  3I06 A;  3I3T A;  5F02 A;  2NQA A;  1CSB B;  2CB5 A;  3PBH A;  4XUI A;  2R9O A;  2DCA A;  1SNK A;  3BOW A;  1DEU A;  3KSE A;  2E03 A;  1GLO A;  2DC9 A;  2VHS A;  1NPZ A;  3O1G A;  1HUC B;  2Y6E A;  3TNX A;  1IWD A;  4PP2 E;  5JH3 A;  2XU4 A;  2GHU A;  4BPV A;  3RVX A;  1ICF A;  4PP1 A;  3BC3 A;  4G54 A;  2AU1 A;  3IEJ A;  2FYE A;  2WBF X;  2AVW A;  1NL6 A;  2DC7 A;  3H6S A;  2PBH A;  3IOQ A;  3HHA A;  1PXV A;  4MZO A;  5CHT A;  3NHE A;  3QT4 A;  2R9F A;  3USV A;  3MTN A;  2C0Y A;  4QRV A;  2BDL A;  4QRG A;  3PDF A;  3IUT A;  1AYU A;  3M99 A;  2AS8 A;  1CPJ A;  1CV8 A;  7PCK A;  1BGO A;  3V6C A;  4N8W A;  2FUD A;  3CH2 X;  2JQF R;  4W4U A;  2DC8 A;  3PNR A;  1MEM A;  5EGW A;  3S3Q A;  6PAD A;  1Y4H A;  2P7U A;  3GCB A;  4BSQ A;  2YJ8 A;  2DCB A;  4QBB A;  4BQV A;  2IPP B;  2OZ2 A;  1ITO A;  4YVA A;  2AYN A;  4Q8G A;  1PE6 A;  1KXR A;  2E02 A;  2PNS A;  3MHH A;  4XR7 A;  4BS5 A;  3WXG A;  1GMY A;  2IBI A;  2DJF B;  3BCN A;  1AU0 A;  1FH0 A;  3KKU A;  4DMX A;  1AU2 A;  2NQG A;  3N4C A;  2YJ9 A;  3S3R A;  3OVZ A;  1KHP A;  3PW3 A;  1BQI A;  3V6E A;  2AUZ A;  3OF9 A;  1YK7 A;  3U8E A;  2DJG B;  4ZUX U;  5K16 A;  1MS6 A;  2P0R A;  2H7J A;  2JQG R;  5JA7 A;  3KWB X;  1AIM A;  1TL9 A;  4OEL A;  4YYU A;  2OUL A;  1MIR A;  3KWZ A;  3N3K A;  1EWM A;  3P5X A;  5J94 A;  2XU3 A;  1U5I A;  1F2C A;  2HXZ A;  3LXS A;  1BY8 A;  1XKG A;  4MZS A;  3RVW A;  3D6S A;  3KW9 A;  3H8B A;  2R9M A;  1CQD A;  3IV2 A;  4HWY A;  2B1N A;  2B1M A;  1KHQ A;  3KX1 A;  2FTD A;  4CDE B;  5PAD A;  1A6R A;  1U9Q X;  1F29 A;  4FIP A;  3CBK A;  4CZW A;  3P5W A;  4DMY A;  1AYV A;  1PPN A;  3P5V A;  1STF E;  2XU1 A;  2NQI A;  3RVV A;  4I05 A;  1MDW A;  1YVB A;  2DCC A;  5CVO B;  3MHS A;  1CS8 A;  1CJL A;  3IHP A;  1QOL A;  1PCI A;  3BPM A;  1MEG A;  4CDF B;  2VHF A;  1QMY A;  1PBH A;  2P86 A;  2FRA A;  3QSD A;  1THE A;  2FT2 A;  4BS6 A;  5A24 A;  2O6X A;  2F1G A;  1ZCM A;  2AIM A;  2G6D A;  4YYS A;  1U9W A;  1O0E A;  4RY2 A;  2YJ2 A;  5EF4 A;  2FRQ A;  1CTE A;  4YYR A;  2ACT A;  1S4V A;  2NQD B;  1NLJ A;  4Q8H A;  3OF8 A;  3HD3 A;  1M6D A;  1AU3 A;  1TU6 A; 
#chains in the Genus database with same CATH topology
 3F5V A;  2DZY A;  4P6E A;  1CVZ A;  2G8J A;  2UZJ A;  3QJ3 A;  2OP3 A;  3TRK A;  2E00 A;  4OEM A;  5KO3 A;  4OVZ A;  4W5C A;  3RNV A;  3CH3 X;  4BOQ A;  3W30 A;  3ERV A;  1F2B A;  3PHU A;  1AU4 A;  2G7Y A;  3BWK A;  3K24 A;  4YYQ A;  1EWO A;  1SP4 B;  3LFY A;  4X6J A;  1EWL A;  1F2A A;  4FK5 A;  2G8E A;  1QDQ A;  2J7Q C;  1GCB A;  1TLO A;  1X9Y A;  2ATO A;  4MSX A;  4X6H A;  3C0R A;  4I07 A;  1Y08 A;  1YAL A;  1KFX L;  5CHV A;  3CBJ A;  2GFO A;  4R3D A;  1PPO A;  1PPP A;  3OQC A;  2R9C A;  1ME3 A;  3F75 A;  3K9M A;  3O0U A;  4YYW A;  4CDD B;  2CIO A;  5CVM A;  4N4Z A;  4XZX A;  4D8I A;  2DC6 A;  2DZZ A;  3ZUA A;  3BBA A;  2BTW B;  2FQ9 A;  2PRE A;  4P16 A;  2JRI A;  4AXL A;  2R6N A;  4X6I A;  4P6G A;  4A5U A;  4YV8 A;  1KFU L;  4QRX A;  3OIS A;  4PAD A;  3DF0 A;  4D8B A;  5JZE A;  2AUX A;  4D8E A;  2BDZ A;  2HHN A;  4N79 A;  1EWP A;  2DCD A;  1MHW A;  2F7D A;  1QXP A;  3H7D A;  1PIP A;  4QH6 A;  1Q6K A;  1VSN A;  2Z84 A;  2Y5B A;  3C9E A;  4BOS A;  5E6J A;  1NQC A;  2DOS A;  3E1Z B;  3N3G A;  3MOR A;  1AEC A;  3K8U A;  4IUM A;  1GEC E;  2FO5 A;  2YJC A;  4WA6 A;  1ME4 A;  3BPF A;  2HD5 A;  1K3B B;  4OVZ B;  1U9V A;  2PAD A;  1POP A;  1YT7 A;  2XU5 A;  4RF1 A;  1BP4 A;  2E01 A;  1NB5 A;  1YK8 A;  4FJC A;  1NB3 A;  3H8C A;  2ARY A;  1AYW A;  2YJB A;  1VJV A;  3IMA A;  3PHX A;  9PAP A;  3W31 A;  1PPD A;  3OVX A;  1U9X A;  4K7C A;  1ATK A;  5FPW A;  4AXM A;  3AI8 A;  4CDC B;  4WUR A;  3B79 A;  2HH5 A;  5CVN B;  3WXF A;  2FE8 A;  4PI3 A;  4YYV A;  3P5U A;  4HXD B;  3KFQ A;  3HHI A;  3HWN A;  4W5B A;  1ZIV A;  4I04 A;  1JQP A;  1EF7 A;  2R9N A;  4KLB A;  3WXE A;  1DF0 A;  2AYO A;  8PCH A;  1CB5 A;  3H89 A;  1PAD A;  4BOZ A;  3I06 A;  3I3T A;  5F02 A;  2NQA A;  1CSB B;  3BY4 A;  2CB5 A;  3PBH A;  4XUI A;  2R9O A;  4BOP A;  2DCA A;  1SNK A;  3BOW A;  3E9S A;  1DEU A;  3KSE A;  2E03 A;  1GLO A;  2DC9 A;  2VHS A;  1NPZ A;  3O1G A;  1HUC B;  2Y6E A;  3TNX A;  1IWD A;  4PP2 E;  4M0W A;  5JH3 A;  2XU4 A;  1PVJ A;  2GHU A;  4BPV A;  3RVX A;  3O65 A;  1ICF A;  4PP1 A;  3BC3 A;  4G54 A;  5EZS A;  2AU1 A;  3IEJ A;  2FYE A;  2WBF X;  2AVW A;  1NL6 A;  2DC7 A;  3H6S A;  1UKF A;  3PHW A;  2PBH A;  3IOQ A;  3HHA A;  3TMP A;  1PXV A;  4MZO A;  5CHT A;  3NHE A;  3QT4 A;  2R9F A;  3USV A;  3MTN A;  2C0Y A;  4QRV A;  2BDL A;  4QRG A;  2BU3 A;  3PDF A;  3IUT A;  1AYU A;  3M99 A;  2AS8 A;  1CPJ A;  1CV8 A;  7PCK A;  1BGO A;  3V6C A;  2HWK A;  3PRP A;  4N8W A;  2FUD A;  3CH2 X;  2JQF R;  3PSE A;  4W4U A;  2DC8 A;  3PNR A;  2BTW A;  1MEM A;  5EGW A;  3S3Q A;  6PAD A;  1Y4H A;  2P7U A;  3GCB A;  4BSQ A;  2YJ8 A;  2DCB A;  4QBB A;  4BQV A;  2IPP B;  2OZ2 A;  1ITO A;  4YVA A;  2AYN A;  3MP2 A;  4Q8G A;  1PE6 A;  1KXR A;  2E02 A;  2PNS A;  3MHH A;  4XR7 A;  4BS5 A;  3WXG A;  1GMY A;  2IBI A;  2DJF B;  3BCN A;  1AU0 A;  1FH0 A;  3KKU A;  4DMX A;  1AU2 A;  2NQG A;  3N4C A;  2YJ9 A;  3S3R A;  3OVZ A;  1KHP A;  3PW3 A;  1BQI A;  3V6E A;  2AUZ A;  3OF9 A;  1YK7 A;  3MJ5 A;  3U8E A;  2DJG B;  4ZUX U;  5K16 A;  4RNA A;  1MS6 A;  2P0R A;  4MI7 A;  4RKX A;  2H7J A;  2JQG R;  2J7Q A;  5JA7 A;  3KWB X;  1AIM A;  1TL9 A;  4OEL A;  4YYU A;  2OUL A;  1MIR A;  4IP3 A;  3KWZ A;  3N3K A;  1EWM A;  3P5X A;  3ZNH A;  5J94 A;  2XU3 A;  1DKI A;  1U5I A;  3MTV A;  4ZTB A;  1F2C A;  2HXZ A;  3LXS A;  4REZ A;  1BY8 A;  3PRM A;  1XKG A;  4MZS A;  3RVW A;  3D6S A;  3KW9 A;  3H8B A;  2R9M A;  1CQD A;  3IV2 A;  4HWY A;  2B1N A;  2B1M A;  1KHQ A;  2AGA A;  3KX1 A;  2FTD A;  4CDE B;  3IFU A;  5PAD A;  1A6R A;  1U9Q X;  1F29 A;  4FIP A;  3CBK A;  3B21 A;  4CZW A;  3P5W A;  4DMY A;  1AYV A;  1PPN A;  2JTC A;  3P5V A;  1STF E;  2XU1 A;  2NQI A;  3RVV A;  4I05 A;  1MDW A;  3BB7 A;  1YVB A;  2DCC A;  5CVO B;  3MHS A;  1CS8 A;  1CJL A;  3IHP A;  5EZQ A;  1QOL A;  1PCI A;  3BPM A;  1YZB A;  1MEG A;  4CDF B;  2VHF A;  4OW0 A;  1QMY A;  1PBH A;  2P86 A;  2FRA A;  3QSD A;  1THE A;  2FT2 A;  4BOU A;  4BS6 A;  5A24 A;  2O6X A;  4MM3 B;  3PT2 A;  2F1G A;  1ZCM A;  2AIM A;  2G6D A;  4YYS A;  4RF0 A;  1U9W A;  1O0E A;  4RY2 A;  2YJ2 A;  5EF4 A;  2FRQ A;  4PT5 A;  1CTE A;  4YYR A;  2ACT A;  1S4V A;  2NQD B;  1NLJ A;  4Q8H A;  4GUA A;  3OF8 A;  3HD3 A;  1M6D A;  1AU3 A;  1TU6 A; 
#chains in the Genus database with same CATH homology
 3F5V A;  2DZY A;  4P6E A;  1CVZ A;  2G8J A;  3QJ3 A;  2OP3 A;  2E00 A;  4OEM A;  4W5C A;  3CH3 X;  3ERV A;  1F2B A;  1AU4 A;  2G7Y A;  3BWK A;  3K24 A;  4YYQ A;  1EWO A;  1SP4 B;  3LFY A;  4X6J A;  1EWL A;  1W6F A;  1F2A A;  1E2T A;  4FK5 A;  2G8E A;  1QDQ A;  1GX3 A;  1GCB A;  1TLO A;  1X9Y A;  2ATO A;  4MSX A;  4X6H A;  4I07 A;  1Y08 A;  1YAL A;  1KFX L;  5CHV A;  3CBJ A;  2GFO A;  1PPO A;  1PPP A;  2R9C A;  1ME3 A;  3F75 A;  3K9M A;  3O0U A;  4YYW A;  4CDD B;  2CIO A;  5CVM A;  4N4Z A;  2DC6 A;  2DZZ A;  3ZUA A;  2FQ9 A;  2PRE A;  4AXL A;  2R6N A;  4X6I A;  4P6G A;  4YV8 A;  1KFU L;  4QRX A;  3OIS A;  4PAD A;  3DF0 A;  2AUX A;  2BDZ A;  2HHN A;  4N79 A;  1EWP A;  2DCD A;  1MHW A;  2F7D A;  1QXP A;  3H7D A;  1PIP A;  4QH6 A;  1Q6K A;  1VSN A;  2Y5B A;  3C9E A;  1NQC A;  3E1Z B;  3N3G A;  3MOR A;  1AEC A;  4NV8 A;  3K8U A;  1GEC E;  2FO5 A;  2YJC A;  4WA6 A;  1ME4 A;  3BPF A;  2HD5 A;  1K3B B;  1U9V A;  2PAD A;  1POP A;  1YT7 A;  2XU5 A;  1BP4 A;  2E01 A;  2VFC A;  1NB5 A;  1YK8 A;  4FJC A;  1NB3 A;  3H8C A;  2ARY A;  1AYW A;  2YJB A;  1VJV A;  3IMA A;  9PAP A;  1PPD A;  3OVX A;  1U9X A;  4K7C A;  1ATK A;  5FPW A;  4AXM A;  3AI8 A;  4CDC B;  3B79 A;  2HH5 A;  5CVN B;  3WXF A;  4PI3 A;  4YYV A;  3P5U A;  3D9W A;  3KFQ A;  3HHI A;  3HWN A;  4W5B A;  1ZIV A;  4I04 A;  1JQP A;  1EF7 A;  2R9N A;  4KLB A;  3WXE A;  1DF0 A;  2AYO A;  8PCH A;  1CB5 A;  3H89 A;  1PAD A;  3I06 A;  3I3T A;  5F02 A;  2NQA A;  1CSB B;  2CB5 A;  3PBH A;  4XUI A;  2R9O A;  2DCA A;  1SNK A;  3BOW A;  1DEU A;  3KSE A;  2E03 A;  1GLO A;  2DC9 A;  2VHS A;  1NPZ A;  3O1G A;  1HUC B;  2Y6E A;  3TNX A;  1IWD A;  4PP2 E;  5JH3 A;  2XU4 A;  2GHU A;  4BPV A;  3RVX A;  1ICF A;  4PP1 A;  3BC3 A;  4G54 A;  2AU1 A;  3IEJ A;  2FYE A;  2WBF X;  2AVW A;  1NL6 A;  2DC7 A;  3H6S A;  2PBH A;  3IOQ A;  3HHA A;  1PXV A;  4MZO A;  5CHT A;  3NHE A;  3QT4 A;  2R9F A;  3USV A;  3MTN A;  2C0Y A;  4QRV A;  2BDL A;  4QRG A;  3PDF A;  3IUT A;  1AYU A;  3M99 A;  2AS8 A;  1CPJ A;  1CV8 A;  7PCK A;  1BGO A;  3V6C A;  4N8W A;  2FUD A;  3CH2 X;  2JQF R;  4W4U A;  2DC8 A;  3PNR A;  1MEM A;  5EGW A;  3S3Q A;  6PAD A;  1Y4H A;  2P7U A;  3GCB A;  4BSQ A;  2YJ8 A;  2DCB A;  4QBB A;  4BQV A;  2IPP B;  2OZ2 A;  4BGF A;  1ITO A;  4YVA A;  2AYN A;  4Q8G A;  1PE6 A;  1KXR A;  2E02 A;  2PNS A;  3MHH A;  4XR7 A;  4BS5 A;  3WXG A;  1GMY A;  2IBI A;  2DJF B;  3BCN A;  1AU0 A;  1FH0 A;  3KKU A;  4DMX A;  1AU2 A;  2NQG A;  3N4C A;  2YJ9 A;  3S3R A;  3OVZ A;  1KHP A;  3PW3 A;  1BQI A;  3V6E A;  2AUZ A;  3OF9 A;  1W5R A;  1YK7 A;  3U8E A;  2DJG B;  4ZUX U;  5K16 A;  1MS6 A;  2P0R A;  2H7J A;  2JQG R;  5JA7 A;  3KWB X;  1AIM A;  1TL9 A;  4OEL A;  4YYU A;  2BSZ A;  2OUL A;  1MIR A;  3KWZ A;  3N3K A;  1EWM A;  3P5X A;  5J94 A;  2XU3 A;  1U5I A;  1F2C A;  2HXZ A;  3LXS A;  1BY8 A;  1XKG A;  4MZS A;  4NV7 A;  1W4T A;  3RVW A;  2VFB A;  3D6S A;  3KW9 A;  3H8B A;  2R9M A;  1CQD A;  3IV2 A;  4HWY A;  2B1N A;  2B1M A;  4GUZ A;  1KHQ A;  3KX1 A;  2FTD A;  4CDE B;  5PAD A;  1A6R A;  1U9Q X;  1F29 A;  4FIP A;  3CBK A;  4CZW A;  3P5W A;  4DMY A;  1AYV A;  1PPN A;  3P5V A;  1STF E;  2XU1 A;  2NQI A;  3RVV A;  4I05 A;  1MDW A;  1YVB A;  2DCC A;  5CVO B;  3MHS A;  1CS8 A;  1CJL A;  3IHP A;  1QOL A;  1PCI A;  3BPM A;  1MEG A;  3LTW A;  4CDF B;  2VHF A;  1QMY A;  1PBH A;  2P86 A;  2FRA A;  3QSD A;  1THE A;  2FT2 A;  4BS6 A;  5A24 A;  2O6X A;  2F1G A;  1ZCM A;  2AIM A;  2G6D A;  4YYS A;  1U9W A;  4B55 A;  1O0E A;  4RY2 A;  2YJ2 A;  5EF4 A;  2FRQ A;  1CTE A;  4YYR A;  2ACT A;  1S4V A;  2NQD B;  4C5P A;  1NLJ A;  4Q8H A;  3OF8 A;  3HD3 A;  1M6D A;  1AU3 A;  1TU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...