1PPOA

Determination of the structure of papaya protease omega
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
216
structure length
216
Chain Sequence
b'LPENVDWRKKGAVTPVRHQGSCGSCWAFSAVATVEGINKIRTGKLVELSEQELVDCERRSHGCKGGYPPYALEYVAKNGIHLRSKYPYKAKQGTCRAKQVGGPIVKTSGVGRVQPNNEGNLLNAIAKQPVSVVVESKGRPFQLYKGGIFEGPCGTKVDHAVTAVGYGKSGGKGYILIKNSWGTAWGEKGYIRIKRAPGNSPGVCGLYKSSYYPTKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEASE OMEGA
publication title Determination of the Structure of Papaya Protease Omega
pubmed rcsb
source organism Carica papaya
molecule tags Hydrolase(thiol protease)
total genus 62
structure length 216
sequence length 216
ec nomenclature ec 3.4.22.30: Caricain.
pdb deposition date 1991-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1ppoA00
4MSXA 1A6RA 1ME3A 1F2CA 4XR7A 1DEUA 1NQCA 2XU1A 1MIRA 2NQGA 3S3RA 4YYQA 2G8EA 1CQDA 8PCHA 4CDEB 1ITOA 1NB3A 1PPNA 4DMYA 1NPZA 5JA7A 2FRQA 2CIOA 2B1MA 3BWKA 4PP1A 2H7JA 1VJVA 1MEMA 1ME4A 3BCNA 1ATKA 4WA6A 2YJ9A 1PPPA 4I05A 1YVBA 4YYSA 2B1NA 4CDCB 3MTNA 1AU2A 1STFE 4BQVA 2AYOA 1VSNA 2NQIA 1GMYA 4FK5A 3MORA 4X6IA 1CPJA 2DC9A 3H8CA 2ACTA 2FUDA 4DMXA 7PCKA 4PP2E 3P5UA 2FQ9A 3IUTA 1YK7A 3OF9A 4CDDB 4OEMA 3ZUAA 2E01A 1MS6A 4MZSA 3IMAA 4QH6A 1NLJA 4BS6A 2BDZA 2IPPB 3I06A 3V6EA 1PCIA 3QJ3A 3QSDA 2GFOA 2F7DA 1YK8A 1AU0A 4YV8A 1CTEA 1TU6A 3PBHA 1QMYA 5CHTA 3RVVA 3IOQA 3E1ZB 2WBFX 3P5XA 1CSBB 2VHSA 3KX1A 4XUIA 1U5IA 1ZIVA 1HUCB 4BSQA 3MHHA 1AYVA 3S3QA 1AYWA 2E02A 2G6DA 2PBHA 2XU5A 4P6GA 2OULA 5JH3A 2DCAA 3KSEA 4G54A 3CBJA 3DF0A 3HHIA 3F5VA 1AYUA 3OVXA 1Y4HA 2AS8A 1GLOA 1PE6A 2DJGB 4N79A 1SNKA 3ERVA 2HD5A 2YJBA 2PNSA 4KLBA 4X6HA 5A24A 3LXSA 5K16A 1Q6KA 3IEJA 1KFUL 5EF4A 4YVAA 1U9VA 2NQAA 3P5VA 1BQIA 2HXZA 2AUXA 2YJCA 2P0RA 2R9FA 1CV8A 1THEA 5J94A 1ZCMA 2FRAA 1MHWA 2FT2A 3M99A 3PDFA 3LFYA 1GCBA 1QXPA 1PXVA 9PAPA 1DF0A 1CS8A 4QBBA 4AXLA 1XKGA 2JQFR 3F75A 1QDQA 1AIMA 3K8UA 2G8JA 4CZWA 3H89A 2E00A 2JQGR 1PBHA 2DC8A 5CVNB 1F2BA 3KW9A 1F2AA 3HHAA 2DJFB 2R9OA 3PNRA 5F02A 1KXRA 3U8EA 3H8BA 4PADA 4AXMA 1BP4A 1U9QX 1YALA 1NL6A 1PPOA 3N3KA 3BPFA 4RY2A 4N8WA 2OZ2A 3MHSA 1KHPA 1KHQA 3H7DA 1EWLA 2C0YA 2R9NA 3QT4A 2DZZA 3V6CA 2YJ2A 1AU4A 1PIPA 4I04A 2Y6EA 2HH5A 2P7UA 2ATOA 2R9MA 1F29A 4P6EA 2AU1A 2CB5A 4FIPA 4HWYA 4YYRA 2E03A 3O1GA 1PPDA 1M6DA 3B79A 4QRGA 3USVA 1CVZA 1GECE 2IBIA 3C9EA 1S4VA 2HHNA 3H6SA 3WXGA 2R9CA 2DCDA 4PI3A 1U9WA 2P86A 1O0EA 3IV2A 1PADA 1JQPA 2XU3A 4QRVA 2AIMA 3HWNA 2DCBA 3WXEA 2FO5A 4QRXA 5CVOB 1AU3A 1ICFA 5EGWA 2R6NA 2DC6A 2G7YA 3PW3A 2OP3A 2DZYA 1CB5A 4BPVA 2AYNA 3D6SA 1BGOA 2YJ8A 3RVXA 3CBKA 1KFXL 1X9YA 2BDLA 1NB5A 2O6XA 2AVWA 4YYWA 5PADA 4X6JA 1EF7A 3TNXA 1TL9A 1K3BB 2DCCA 3KFQA 1EWMA 3OF8A 3WXFA 1BY8A 3BPMA 4CDFB 2F1GA 1U9XA 3N3GA 5CHVA 4W5BA 1QOLA 2GHUA 3AI8A 4W5CA 2XU4A 1TLOA 4I07A 4Q8GA 1AECA 3OVZA 3K9MA 2FYEA 1Y08A 2NQDB 1FH0A 1YT7A 4N4ZA 3K24A 2FTDA 2PREA 3RVWA 1CJLA 3I3TA 4MZOA 3IHPA 1MEGA 3BC3A 2PADA 5CVMA 3NHEA 1MDWA 1EWPA 4Q8HA 3O0UA 3N4CA 4OELA 3KKUA 3P5WA 1EWOA 4W4UA 4BS5A 1POPA 3OISA 5FPWA 4YYUA 6PADA 3CH3X 4YYVA 1IWDA 3GCBA 2VHFA 2ARYA 4ZUXU 3BOWA 4K7CA 4FJCA 2AUZA 2Y5BA 2DC7A 3KWZA 3HD3A 1SP4B 3CH2X 3KWBX
chains in the Genus database with same CATH superfamily
4MSXA 3MTVA 1A6RA 1ME3A 4WURA 1F2CA 4XR7A 1DEUA 1NQCA 4RF1A 3TMPA 2XU1A 3MP2A 2UZJA 1MIRA 2NQGA 3S3RA 4YYQA 2G8EA 1CQDA 8PCHA 4CDEB 1ITOA 1NB3A 1PPNA 4DMYA 1NPZA 5JA7A 2FRQA 2CIOA 4D8BA 2B1MA 3BWKA 3OQCA 4PP1A 2H7JA 1VJVA 1MEMA 1ME4A 3BCNA 1ATKA 4WA6A 2YJ9A 1PPPA 4I05A 1YVBA 4YYSA 2B1NA 4CDCB 3MTNA 1AU2A 1STFE 4P16A 4BQVA 3TRKA 2AYOA 1VSNA 2NQIA 1GMYA 4FK5A 3MORA 4X6IA 1CPJA 2DC9A 4HXDB 4OW0A 3H8CA 2ACTA 2FUDA 4DMXA 7PCKA 4PP2E 3P5UA 2FQ9A 3IUTA 1YK7A 3OF9A 4BOSA 3BY4A 4CDDB 4RKXA 4OEMA 4OVZB 3ZUAA 2E01A 1MS6A 4MZSA 3IMAA 4QH6A 1NLJA 5EZQA 3ZNHA 4BS6A 2BDZA 2IPPB 3I06A 3V6EA 1PCIA 3QJ3A 3QSDA 2GFOA 2F7DA 5E6JA 1YK8A 1AU0A 4BOUA 5EZSA 4YV8A 1CTEA 2J7QC 2HWKA 1TU6A 1YZBA 3PBHA 1QMYA 5CHTA 4MI7A 4D8EA 3RVVA 3IOQA 3E1ZB 2WBFX 3P5XA 1CSBB 2VHSA 3KX1A 4XUIA 1U5IA 1ZIVA 1HUCB 4BSQA 3MHHA 4BOZA 1AYVA 3S3QA 1AYWA 2E02A 2G6DA 2PBHA 2XU5A 4P6GA 2OULA 5JH3A 2DCAA 3KSEA 4G54A 3CBJA 3DF0A 2DOSA 3HHIA 3F5VA 1AYUA 3OVXA 1Y4HA 2AS8A 1GLOA 1PE6A 2DJGB 4N79A 1SNKA 3ERVA 2HD5A 3PHXA 2YJBA 2PNSA 4KLBA 2Z84A 4X6HA 5A24A 2BU3A 3LXSA 5K16A 1Q6KA 3IEJA 1KFUL 5EF4A 4YVAA 1U9VA 2NQAA 3P5VA 1BQIA 2HXZA 2AUXA 2YJCA 2P0RA 1UKFA 1CV8A 1THEA 2R9FA 4PT5A 5J94A 1ZCMA 2FRAA 1MHWA 2FT2A 3M99A 3PDFA 3LFYA 1GCBA 1QXPA 3W31A 1PXVA 9PAPA 1DF0A 1CS8A 4QBBA 4AXLA 4R3DA 1XKGA 2JQFR 3F75A 1QDQA 1AIMA 3K8UA 2G8JA 4CZWA 3H89A 2E00A 4IP3A 2JQGR 1PBHA 3BBAA 2DC8A 3PRPA 1F2BA 5CVNB 3KW9A 1F2AA 3HHAA 2DJFB 2R9OA 3PNRA 5F02A 1KXRA 3U8EA 3H8BA 4PADA 4AXMA 1BP4A 1U9QX 1YALA 1NL6A 1PPOA 3N3KA 3BPFA 4RY2A 2JTCA 2BTWA 4N8WA 2OZ2A 3MHSA 3BB7A 1KHPA 1KHQA 3H7DA 1EWLA 4GUAA 2C0YA 2R9NA 3QT4A 2DZZA 3V6CA 2YJ2A 1AU4A 1PIPA 4I04A 2Y6EA 2HH5A 2P7UA 2ATOA 2R9MA 1F29A 4P6EA 3B21A 2AU1A 2CB5A 4FIPA 4HWYA 4YYRA 2E03A 3O1GA 1PPDA 3W30A 3PHUA 1M6DA 2J7QA 3B79A 4QRGA 3USVA 3PSEA 1CVZA 4IUMA 1GECE 2IBIA 3C9EA 1S4VA 2HHNA 3H6SA 3WXGA 2R9CA 2DCDA 4PI3A 2BTWB 1U9WA 2P86A 1O0EA 3IV2A 1PADA 1JQPA 2XU3A 4QRVA 2AIMA 3HWNA 4BOQA 2DCBA 3WXEA 2FO5A 4QRXA 5CVOB 1AU3A 2FE8A 1ICFA 3PRMA 5EGWA 2R6NA 2DC6A 2G7YA 3PW3A 2OP3A 2DZYA 1CB5A 4BPVA 2AYNA 3D6SA 1BGOA 3PHWA 2YJ8A 3RVXA 4A5UA 3CBKA 1KFXL 4ZTBA 1X9YA 2BDLA 1NB5A 2O6XA 2AVWA 4YYWA 5PADA 4X6JA 1EF7A 3TNXA 1TL9A 3IFUA 1K3BB 4OVZA 2DCCA 3KFQA 1EWMA 3OF8A 3WXFA 1BY8A 3BPMA 4CDFB 2F1GA 1U9XA 3N3GA 5CHVA 4W5BA 1QOLA 2GHUA 3AI8A 4W5CA 2XU4A 1TLOA 4I07A 4REZA 2JRIA 4Q8GA 1AECA 3OVZA 3K9MA 2FYEA 1DKIA 1Y08A 2NQDB 1FH0A 1YT7A 4N4ZA 3K24A 2FTDA 1PVJA 2PREA 3RVWA 4BOPA 1CJLA 2AGAA 3I3TA 4MZOA 3IHPA 3O65A 1MEGA 3BC3A 5KO3A 2PADA 5CVMA 3NHEA 1MDWA 1EWPA 4Q8HA 4D8IA 3O0UA 3N4CA 4OELA 3KKUA 3P5WA 4XZXA 3C0RA 4RNAA 1EWOA 4W4UA 4BS5A 1POPA 3OISA 5FPWA 4YYUA 6PADA 3CH3X 4YYVA 4MM3B 1IWDA 4M0WA 3GCBA 2VHFA 2ARYA 4RF0A 4ZUXU 3BOWA 4K7CA 4FJCA 2AUZA 3E9SA 2Y5BA 2DC7A 3KWZA 5JZEA 3MJ5A 3HD3A 1SP4B 3CH2X 3KWBX 3RNVA 3PT2A
chains in the Genus database with same CATH topology
4MSXA 1A6RA 1ME3A 4GUZA 4BGFA 1F2CA 4XR7A 1DEUA 1NQCA 2XU1A 1MIRA 2NQGA 3S3RA 4YYQA 2G8EA 1CQDA 8PCHA 4CDEB 1ITOA 1NB3A 1PPNA 4DMYA 1NPZA 5JA7A 2FRQA 2CIOA 2B1MA 3BWKA 4PP1A 2H7JA 1VJVA 1MEMA 1ME4A 3BCNA 1ATKA 4WA6A 2YJ9A 1PPPA 4I05A 1YVBA 4YYSA 2B1NA 4CDCB 3MTNA 1AU2A 1STFE 4BQVA 2AYOA 1VSNA 2NQIA 1GMYA 4FK5A 3MORA 4X6IA 1CPJA 2DC9A 3H8CA 2ACTA 2FUDA 4DMXA 7PCKA 4PP2E 3P5UA 2FQ9A 3IUTA 1YK7A 3OF9A 4CDDB 4OEMA 3ZUAA 2E01A 1MS6A 4MZSA 3IMAA 4QH6A 1NLJA 4BS6A 2BDZA 2IPPB 3I06A 3V6EA 1PCIA 3QJ3A 3QSDA 2GFOA 2F7DA 1YK8A 1AU0A 4YV8A 1CTEA 1TU6A 3PBHA 1QMYA 5CHTA 3RVVA 3IOQA 3E1ZB 2WBFX 3P5XA 1CSBB 2VHSA 3KX1A 4XUIA 1U5IA 1ZIVA 1HUCB 4BSQA 3MHHA 1AYVA 1E2TA 1AYWA 2E02A 3S3QA 2G6DA 2PBHA 2XU5A 4P6GA 2OULA 5JH3A 2DCAA 3KSEA 4G54A 3CBJA 3DF0A 3HHIA 3F5VA 1AYUA 3LTWA 3OVXA 1Y4HA 2AS8A 1GLOA 1PE6A 2DJGB 4N79A 1SNKA 3ERVA 2HD5A 2YJBA 2PNSA 4KLBA 4X6HA 5A24A 3LXSA 5K16A 1Q6KA 3IEJA 1KFUL 4C5PA 5EF4A 4YVAA 1U9VA 2NQAA 1W6FA 3P5VA 1BQIA 2HXZA 2AUXA 2YJCA 2P0RA 2R9FA 1CV8A 1THEA 2VFCA 5J94A 1ZCMA 2FRAA 1MHWA 2FT2A 3M99A 3PDFA 3LFYA 1GCBA 1QXPA 1PXVA 9PAPA 1DF0A 1CS8A 4QBBA 4AXLA 4NV8A 1XKGA 2JQFR 3F75A 1QDQA 1AIMA 3K8UA 2G8JA 4CZWA 3H89A 2E00A 2JQGR 1PBHA 2DC8A 5CVNB 1F2BA 3KW9A 1F2AA 3HHAA 2DJFB 2R9OA 3PNRA 5F02A 1KXRA 3U8EA 3D9WA 3H8BA 4PADA 4AXMA 1BP4A 1U9QX 1YALA 1NL6A 1PPOA 3N3KA 3BPFA 4RY2A 4N8WA 2OZ2A 3MHSA 1KHPA 1KHQA 3H7DA 1EWLA 2C0YA 1W4TA 2R9NA 3QT4A 2DZZA 3V6CA 2YJ2A 1AU4A 1PIPA 1GX3A 4I04A 2Y6EA 2HH5A 2P7UA 2ATOA 2R9MA 1F29A 4P6EA 2AU1A 2CB5A 4FIPA 4HWYA 4YYRA 2E03A 3O1GA 1PPDA 4NV7A 1M6DA 3B79A 4QRGA 3USVA 1CVZA 1GECE 2IBIA 3C9EA 1S4VA 2HHNA 3H6SA 3WXGA 2R9CA 2DCDA 4PI3A 1U9WA 2P86A 1O0EA 3IV2A 1PADA 1JQPA 2XU3A 4QRVA 2AIMA 3HWNA 2DCBA 3WXEA 2FO5A 4QRXA 5CVOB 1AU3A 1ICFA 5EGWA 2R6NA 2DC6A 2G7YA 3PW3A 2OP3A 2DZYA 1CB5A 4BPVA 2AYNA 3D6SA 1BGOA 2YJ8A 3RVXA 3CBKA 1KFXL 1X9YA 2BDLA 1NB5A 2O6XA 2AVWA 4YYWA 5PADA 4X6JA 1EF7A 3TNXA 1TL9A 1K3BB 2DCCA 3KFQA 1EWMA 3OF8A 1W5RA 3WXFA 1BY8A 3BPMA 4CDFB 2F1GA 1U9XA 3N3GA 5CHVA 4W5BA 1QOLA 2GHUA 3AI8A 4W5CA 2XU4A 2VFBA 1TLOA 4I07A 4Q8GA 1AECA 3OVZA 3K9MA 2FYEA 1Y08A 2NQDB 1FH0A 1YT7A 4N4ZA 3K24A 2FTDA 2PREA 3RVWA 1CJLA 3I3TA 4MZOA 3IHPA 1MEGA 3BC3A 2PADA 5CVMA 2BSZA 3NHEA 1MDWA 1EWPA 4Q8HA 3O0UA 3N4CA 4OELA 3KKUA 3P5WA 1EWOA 4W4UA 4BS5A 1POPA 3OISA 5FPWA 4YYUA 6PADA 4B55A 3CH3X 4YYVA 1IWDA 3GCBA 2VHFA 2ARYA 4ZUXU 3BOWA 4K7CA 4FJCA 2AUZA 2Y5BA 2DC7A 3KWZA 3HD3A 1SP4B 3CH2X 3KWBX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MSX A;  1A6R A;  1ME3 A;  1F2C A;  4XR7 A;  1DEU A;  1NQC A;  2XU1 A;  1MIR A;  2NQG A;  3S3R A;  4YYQ A;  2G8E A;  1CQD A;  8PCH A;  4CDE B;  1ITO A;  1NB3 A;  1PPN A;  4DMY A;  1NPZ A;  5JA7 A;  2FRQ A;  2CIO A;  2B1M A;  3BWK A;  4PP1 A;  2H7J A;  1VJV A;  1MEM A;  1ME4 A;  3BCN A;  1ATK A;  4WA6 A;  2YJ9 A;  1PPP A;  4I05 A;  1YVB A;  4YYS A;  2B1N A;  4CDC B;  3MTN A;  1AU2 A;  1STF E;  4BQV A;  2AYO A;  1VSN A;  2NQI A;  1GMY A;  4FK5 A;  3MOR A;  4X6I A;  1CPJ A;  2DC9 A;  3H8C A;  2ACT A;  2FUD A;  4DMX A;  7PCK A;  4PP2 E;  3P5U A;  2FQ9 A;  3IUT A;  1YK7 A;  3OF9 A;  4CDD B;  4OEM A;  3ZUA A;  2E01 A;  1MS6 A;  4MZS A;  3IMA A;  4QH6 A;  1NLJ A;  4BS6 A;  2BDZ A;  2IPP B;  3I06 A;  3V6E A;  1PCI A;  3QJ3 A;  3QSD A;  2GFO A;  2F7D A;  1YK8 A;  1AU0 A;  4YV8 A;  1CTE A;  1TU6 A;  3PBH A;  1QMY A;  5CHT A;  3RVV A;  3IOQ A;  3E1Z B;  2WBF X;  3P5X A;  1CSB B;  2VHS A;  3KX1 A;  4XUI A;  1U5I A;  1ZIV A;  1HUC B;  4BSQ A;  3MHH A;  1AYV A;  3S3Q A;  1AYW A;  2E02 A;  2G6D A;  2PBH A;  2XU5 A;  4P6G A;  2OUL A;  5JH3 A;  2DCA A;  3KSE A;  4G54 A;  3CBJ A;  3DF0 A;  3HHI A;  3F5V A;  1AYU A;  3OVX A;  1Y4H A;  2AS8 A;  1GLO A;  1PE6 A;  2DJG B;  4N79 A;  1SNK A;  3ERV A;  2HD5 A;  2YJB A;  2PNS A;  4KLB A;  4X6H A;  5A24 A;  3LXS A;  5K16 A;  1Q6K A;  3IEJ A;  1KFU L;  5EF4 A;  4YVA A;  1U9V A;  2NQA A;  3P5V A;  1BQI A;  2HXZ A;  2AUX A;  2YJC A;  2P0R A;  2R9F A;  1CV8 A;  1THE A;  5J94 A;  1ZCM A;  2FRA A;  1MHW A;  2FT2 A;  3M99 A;  3PDF A;  3LFY A;  1GCB A;  1QXP A;  1PXV A;  9PAP A;  1DF0 A;  1CS8 A;  4QBB A;  4AXL A;  1XKG A;  2JQF R;  3F75 A;  1QDQ A;  1AIM A;  3K8U A;  2G8J A;  4CZW A;  3H89 A;  2E00 A;  2JQG R;  1PBH A;  2DC8 A;  5CVN B;  1F2B A;  3KW9 A;  1F2A A;  3HHA A;  2DJF B;  2R9O A;  3PNR A;  5F02 A;  1KXR A;  3U8E A;  3H8B A;  4PAD A;  4AXM A;  1BP4 A;  1U9Q X;  1YAL A;  1NL6 A;  1PPO A;  3N3K A;  3BPF A;  4RY2 A;  4N8W A;  2OZ2 A;  3MHS A;  1KHP A;  1KHQ A;  3H7D A;  1EWL A;  2C0Y A;  2R9N A;  3QT4 A;  2DZZ A;  3V6C A;  2YJ2 A;  1AU4 A;  1PIP A;  4I04 A;  2Y6E A;  2HH5 A;  2P7U A;  2ATO A;  2R9M A;  1F29 A;  4P6E A;  2AU1 A;  2CB5 A;  4FIP A;  4HWY A;  4YYR A;  2E03 A;  3O1G A;  1PPD A;  1M6D A;  3B79 A;  4QRG A;  3USV A;  1CVZ A;  1GEC E;  2IBI A;  3C9E A;  1S4V A;  2HHN A;  3H6S A;  3WXG A;  2R9C A;  2DCD A;  4PI3 A;  1U9W A;  2P86 A;  1O0E A;  3IV2 A;  1PAD A;  1JQP A;  2XU3 A;  4QRV A;  2AIM A;  3HWN A;  2DCB A;  3WXE A;  2FO5 A;  4QRX A;  5CVO B;  1AU3 A;  1ICF A;  5EGW A;  2R6N A;  2DC6 A;  2G7Y A;  3PW3 A;  2OP3 A;  2DZY A;  1CB5 A;  4BPV A;  2AYN A;  3D6S A;  1BGO A;  2YJ8 A;  3RVX A;  3CBK A;  1KFX L;  1X9Y A;  2BDL A;  1NB5 A;  2O6X A;  2AVW A;  4YYW A;  5PAD A;  4X6J A;  1EF7 A;  3TNX A;  1TL9 A;  1K3B B;  2DCC A;  3KFQ A;  1EWM A;  3OF8 A;  3WXF A;  1BY8 A;  3BPM A;  4CDF B;  2F1G A;  1U9X A;  3N3G A;  5CHV A;  4W5B A;  1QOL A;  2GHU A;  3AI8 A;  4W5C A;  2XU4 A;  1TLO A;  4I07 A;  4Q8G A;  1AEC A;  3OVZ A;  3K9M A;  2FYE A;  1Y08 A;  2NQD B;  1FH0 A;  1YT7 A;  4N4Z A;  3K24 A;  2FTD A;  2PRE A;  3RVW A;  1CJL A;  3I3T A;  4MZO A;  3IHP A;  1MEG A;  3BC3 A;  2PAD A;  5CVM A;  3NHE A;  1MDW A;  1EWP A;  4Q8H A;  3O0U A;  3N4C A;  4OEL A;  3KKU A;  3P5W A;  1EWO A;  4W4U A;  4BS5 A;  1POP A;  3OIS A;  5FPW A;  4YYU A;  6PAD A;  3CH3 X;  4YYV A;  1IWD A;  3GCB A;  2VHF A;  2ARY A;  4ZUX U;  3BOW A;  4K7C A;  4FJC A;  2AUZ A;  2Y5B A;  2DC7 A;  3KWZ A;  3HD3 A;  1SP4 B;  3CH2 X;  3KWB X; 
#chains in the Genus database with same CATH topology
 4MSX A;  3MTV A;  1A6R A;  1ME3 A;  4WUR A;  1F2C A;  4XR7 A;  1DEU A;  1NQC A;  4RF1 A;  3TMP A;  2XU1 A;  3MP2 A;  2UZJ A;  1MIR A;  2NQG A;  3S3R A;  4YYQ A;  2G8E A;  1CQD A;  8PCH A;  4CDE B;  1ITO A;  1NB3 A;  1PPN A;  4DMY A;  1NPZ A;  5JA7 A;  2FRQ A;  2CIO A;  4D8B A;  2B1M A;  3BWK A;  3OQC A;  4PP1 A;  2H7J A;  1VJV A;  1MEM A;  1ME4 A;  3BCN A;  1ATK A;  4WA6 A;  2YJ9 A;  1PPP A;  4I05 A;  1YVB A;  4YYS A;  2B1N A;  4CDC B;  3MTN A;  1AU2 A;  1STF E;  4P16 A;  4BQV A;  3TRK A;  2AYO A;  1VSN A;  2NQI A;  1GMY A;  4FK5 A;  3MOR A;  4X6I A;  1CPJ A;  2DC9 A;  4HXD B;  4OW0 A;  3H8C A;  2ACT A;  2FUD A;  4DMX A;  7PCK A;  4PP2 E;  3P5U A;  2FQ9 A;  3IUT A;  1YK7 A;  3OF9 A;  4BOS A;  3BY4 A;  4CDD B;  4RKX A;  4OEM A;  4OVZ B;  3ZUA A;  2E01 A;  1MS6 A;  4MZS A;  3IMA A;  4QH6 A;  1NLJ A;  5EZQ A;  3ZNH A;  4BS6 A;  2BDZ A;  2IPP B;  3I06 A;  3V6E A;  1PCI A;  3QJ3 A;  3QSD A;  2GFO A;  2F7D A;  5E6J A;  1YK8 A;  1AU0 A;  4BOU A;  5EZS A;  4YV8 A;  1CTE A;  2J7Q C;  2HWK A;  1TU6 A;  1YZB A;  3PBH A;  1QMY A;  5CHT A;  4MI7 A;  4D8E A;  3RVV A;  3IOQ A;  3E1Z B;  2WBF X;  3P5X A;  1CSB B;  2VHS A;  3KX1 A;  4XUI A;  1U5I A;  1ZIV A;  1HUC B;  4BSQ A;  3MHH A;  4BOZ A;  1AYV A;  3S3Q A;  1AYW A;  2E02 A;  2G6D A;  2PBH A;  2XU5 A;  4P6G A;  2OUL A;  5JH3 A;  2DCA A;  3KSE A;  4G54 A;  3CBJ A;  3DF0 A;  2DOS A;  3HHI A;  3F5V A;  1AYU A;  3OVX A;  1Y4H A;  2AS8 A;  1GLO A;  1PE6 A;  2DJG B;  4N79 A;  1SNK A;  3ERV A;  2HD5 A;  3PHX A;  2YJB A;  2PNS A;  4KLB A;  2Z84 A;  4X6H A;  5A24 A;  2BU3 A;  3LXS A;  5K16 A;  1Q6K A;  3IEJ A;  1KFU L;  5EF4 A;  4YVA A;  1U9V A;  2NQA A;  3P5V A;  1BQI A;  2HXZ A;  2AUX A;  2YJC A;  2P0R A;  1UKF A;  1CV8 A;  1THE A;  2R9F A;  4PT5 A;  5J94 A;  1ZCM A;  2FRA A;  1MHW A;  2FT2 A;  3M99 A;  3PDF A;  3LFY A;  1GCB A;  1QXP A;  3W31 A;  1PXV A;  9PAP A;  1DF0 A;  1CS8 A;  4QBB A;  4AXL A;  4R3D A;  1XKG A;  2JQF R;  3F75 A;  1QDQ A;  1AIM A;  3K8U A;  2G8J A;  4CZW A;  3H89 A;  2E00 A;  4IP3 A;  2JQG R;  1PBH A;  3BBA A;  2DC8 A;  3PRP A;  1F2B A;  5CVN B;  3KW9 A;  1F2A A;  3HHA A;  2DJF B;  2R9O A;  3PNR A;  5F02 A;  1KXR A;  3U8E A;  3H8B A;  4PAD A;  4AXM A;  1BP4 A;  1U9Q X;  1YAL A;  1NL6 A;  1PPO A;  3N3K A;  3BPF A;  4RY2 A;  2JTC A;  2BTW A;  4N8W A;  2OZ2 A;  3MHS A;  3BB7 A;  1KHP A;  1KHQ A;  3H7D A;  1EWL A;  4GUA A;  2C0Y A;  2R9N A;  3QT4 A;  2DZZ A;  3V6C A;  2YJ2 A;  1AU4 A;  1PIP A;  4I04 A;  2Y6E A;  2HH5 A;  2P7U A;  2ATO A;  2R9M A;  1F29 A;  4P6E A;  3B21 A;  2AU1 A;  2CB5 A;  4FIP A;  4HWY A;  4YYR A;  2E03 A;  3O1G A;  1PPD A;  3W30 A;  3PHU A;  1M6D A;  2J7Q A;  3B79 A;  4QRG A;  3USV A;  3PSE A;  1CVZ A;  4IUM A;  1GEC E;  2IBI A;  3C9E A;  1S4V A;  2HHN A;  3H6S A;  3WXG A;  2R9C A;  2DCD A;  4PI3 A;  2BTW B;  1U9W A;  2P86 A;  1O0E A;  3IV2 A;  1PAD A;  1JQP A;  2XU3 A;  4QRV A;  2AIM A;  3HWN A;  4BOQ A;  2DCB A;  3WXE A;  2FO5 A;  4QRX A;  5CVO B;  1AU3 A;  2FE8 A;  1ICF A;  3PRM A;  5EGW A;  2R6N A;  2DC6 A;  2G7Y A;  3PW3 A;  2OP3 A;  2DZY A;  1CB5 A;  4BPV A;  2AYN A;  3D6S A;  1BGO A;  3PHW A;  2YJ8 A;  3RVX A;  4A5U A;  3CBK A;  1KFX L;  4ZTB A;  1X9Y A;  2BDL A;  1NB5 A;  2O6X A;  2AVW A;  4YYW A;  5PAD A;  4X6J A;  1EF7 A;  3TNX A;  1TL9 A;  3IFU A;  1K3B B;  4OVZ A;  2DCC A;  3KFQ A;  1EWM A;  3OF8 A;  3WXF A;  1BY8 A;  3BPM A;  4CDF B;  2F1G A;  1U9X A;  3N3G A;  5CHV A;  4W5B A;  1QOL A;  2GHU A;  3AI8 A;  4W5C A;  2XU4 A;  1TLO A;  4I07 A;  4REZ A;  2JRI A;  4Q8G A;  1AEC A;  3OVZ A;  3K9M A;  2FYE A;  1DKI A;  1Y08 A;  2NQD B;  1FH0 A;  1YT7 A;  4N4Z A;  3K24 A;  2FTD A;  1PVJ A;  2PRE A;  3RVW A;  4BOP A;  1CJL A;  2AGA A;  3I3T A;  4MZO A;  3IHP A;  3O65 A;  1MEG A;  3BC3 A;  5KO3 A;  2PAD A;  5CVM A;  3NHE A;  1MDW A;  1EWP A;  4Q8H A;  4D8I A;  3O0U A;  3N4C A;  4OEL A;  3KKU A;  3P5W A;  4XZX A;  3C0R A;  4RNA A;  1EWO A;  4W4U A;  4BS5 A;  1POP A;  3OIS A;  5FPW A;  4YYU A;  6PAD A;  3CH3 X;  4YYV A;  4MM3 B;  1IWD A;  4M0W A;  3GCB A;  2VHF A;  2ARY A;  4RF0 A;  4ZUX U;  3BOW A;  4K7C A;  4FJC A;  2AUZ A;  3E9S A;  2Y5B A;  2DC7 A;  3KWZ A;  5JZE A;  3MJ5 A;  3HD3 A;  1SP4 B;  3CH2 X;  3KWB X;  3RNV A;  3PT2 A; 
#chains in the Genus database with same CATH homology
 4MSX A;  1A6R A;  1ME3 A;  4GUZ A;  4BGF A;  1F2C A;  4XR7 A;  1DEU A;  1NQC A;  2XU1 A;  1MIR A;  2NQG A;  3S3R A;  4YYQ A;  2G8E A;  1CQD A;  8PCH A;  4CDE B;  1ITO A;  1NB3 A;  1PPN A;  4DMY A;  1NPZ A;  5JA7 A;  2FRQ A;  2CIO A;  2B1M A;  3BWK A;  4PP1 A;  2H7J A;  1VJV A;  1MEM A;  1ME4 A;  3BCN A;  1ATK A;  4WA6 A;  2YJ9 A;  1PPP A;  4I05 A;  1YVB A;  4YYS A;  2B1N A;  4CDC B;  3MTN A;  1AU2 A;  1STF E;  4BQV A;  2AYO A;  1VSN A;  2NQI A;  1GMY A;  4FK5 A;  3MOR A;  4X6I A;  1CPJ A;  2DC9 A;  3H8C A;  2ACT A;  2FUD A;  4DMX A;  7PCK A;  4PP2 E;  3P5U A;  2FQ9 A;  3IUT A;  1YK7 A;  3OF9 A;  4CDD B;  4OEM A;  3ZUA A;  2E01 A;  1MS6 A;  4MZS A;  3IMA A;  4QH6 A;  1NLJ A;  4BS6 A;  2BDZ A;  2IPP B;  3I06 A;  3V6E A;  1PCI A;  3QJ3 A;  3QSD A;  2GFO A;  2F7D A;  1YK8 A;  1AU0 A;  4YV8 A;  1CTE A;  1TU6 A;  3PBH A;  1QMY A;  5CHT A;  3RVV A;  3IOQ A;  3E1Z B;  2WBF X;  3P5X A;  1CSB B;  2VHS A;  3KX1 A;  4XUI A;  1U5I A;  1ZIV A;  1HUC B;  4BSQ A;  3MHH A;  1AYV A;  1E2T A;  1AYW A;  2E02 A;  3S3Q A;  2G6D A;  2PBH A;  2XU5 A;  4P6G A;  2OUL A;  5JH3 A;  2DCA A;  3KSE A;  4G54 A;  3CBJ A;  3DF0 A;  3HHI A;  3F5V A;  1AYU A;  3LTW A;  3OVX A;  1Y4H A;  2AS8 A;  1GLO A;  1PE6 A;  2DJG B;  4N79 A;  1SNK A;  3ERV A;  2HD5 A;  2YJB A;  2PNS A;  4KLB A;  4X6H A;  5A24 A;  3LXS A;  5K16 A;  1Q6K A;  3IEJ A;  1KFU L;  4C5P A;  5EF4 A;  4YVA A;  1U9V A;  2NQA A;  1W6F A;  3P5V A;  1BQI A;  2HXZ A;  2AUX A;  2YJC A;  2P0R A;  2R9F A;  1CV8 A;  1THE A;  2VFC A;  5J94 A;  1ZCM A;  2FRA A;  1MHW A;  2FT2 A;  3M99 A;  3PDF A;  3LFY A;  1GCB A;  1QXP A;  1PXV A;  9PAP A;  1DF0 A;  1CS8 A;  4QBB A;  4AXL A;  4NV8 A;  1XKG A;  2JQF R;  3F75 A;  1QDQ A;  1AIM A;  3K8U A;  2G8J A;  4CZW A;  3H89 A;  2E00 A;  2JQG R;  1PBH A;  2DC8 A;  5CVN B;  1F2B A;  3KW9 A;  1F2A A;  3HHA A;  2DJF B;  2R9O A;  3PNR A;  5F02 A;  1KXR A;  3U8E A;  3D9W A;  3H8B A;  4PAD A;  4AXM A;  1BP4 A;  1U9Q X;  1YAL A;  1NL6 A;  1PPO A;  3N3K A;  3BPF A;  4RY2 A;  4N8W A;  2OZ2 A;  3MHS A;  1KHP A;  1KHQ A;  3H7D A;  1EWL A;  2C0Y A;  1W4T A;  2R9N A;  3QT4 A;  2DZZ A;  3V6C A;  2YJ2 A;  1AU4 A;  1PIP A;  1GX3 A;  4I04 A;  2Y6E A;  2HH5 A;  2P7U A;  2ATO A;  2R9M A;  1F29 A;  4P6E A;  2AU1 A;  2CB5 A;  4FIP A;  4HWY A;  4YYR A;  2E03 A;  3O1G A;  1PPD A;  4NV7 A;  1M6D A;  3B79 A;  4QRG A;  3USV A;  1CVZ A;  1GEC E;  2IBI A;  3C9E A;  1S4V A;  2HHN A;  3H6S A;  3WXG A;  2R9C A;  2DCD A;  4PI3 A;  1U9W A;  2P86 A;  1O0E A;  3IV2 A;  1PAD A;  1JQP A;  2XU3 A;  4QRV A;  2AIM A;  3HWN A;  2DCB A;  3WXE A;  2FO5 A;  4QRX A;  5CVO B;  1AU3 A;  1ICF A;  5EGW A;  2R6N A;  2DC6 A;  2G7Y A;  3PW3 A;  2OP3 A;  2DZY A;  1CB5 A;  4BPV A;  2AYN A;  3D6S A;  1BGO A;  2YJ8 A;  3RVX A;  3CBK A;  1KFX L;  1X9Y A;  2BDL A;  1NB5 A;  2O6X A;  2AVW A;  4YYW A;  5PAD A;  4X6J A;  1EF7 A;  3TNX A;  1TL9 A;  1K3B B;  2DCC A;  3KFQ A;  1EWM A;  3OF8 A;  1W5R A;  3WXF A;  1BY8 A;  3BPM A;  4CDF B;  2F1G A;  1U9X A;  3N3G A;  5CHV A;  4W5B A;  1QOL A;  2GHU A;  3AI8 A;  4W5C A;  2XU4 A;  2VFB A;  1TLO A;  4I07 A;  4Q8G A;  1AEC A;  3OVZ A;  3K9M A;  2FYE A;  1Y08 A;  2NQD B;  1FH0 A;  1YT7 A;  4N4Z A;  3K24 A;  2FTD A;  2PRE A;  3RVW A;  1CJL A;  3I3T A;  4MZO A;  3IHP A;  1MEG A;  3BC3 A;  2PAD A;  5CVM A;  2BSZ A;  3NHE A;  1MDW A;  1EWP A;  4Q8H A;  3O0U A;  3N4C A;  4OEL A;  3KKU A;  3P5W A;  1EWO A;  4W4U A;  4BS5 A;  1POP A;  3OIS A;  5FPW A;  4YYU A;  6PAD A;  4B55 A;  3CH3 X;  4YYV A;  1IWD A;  3GCB A;  2VHF A;  2ARY A;  4ZUX U;  3BOW A;  4K7C A;  4FJC A;  2AUZ A;  2Y5B A;  2DC7 A;  3KWZ A;  3HD3 A;  1SP4 B;  3CH2 X;  3KWB X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...