2GFOA

Structure of the catalytic domain of human ubiquitin carboxyl-terminal hydrolase 8
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
348
structure length
339
Chain Sequence
IRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
publication title Amino-terminal Dimerization, NRDP1-Rhodanese Interaction, and Inhibited Catalytic Domain Conformation of the Ubiquitin-specific Protease 8 (USP8).
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 339
sequence length 348
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2006-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2gfoA00
4PI3A 4YV8A 5J94A 3IEJA 3H89A 1YT7A 4PP2E 2FUDA 1NPZA 3IV2A 1AIMA 3C9EA 5A24A 2ACTA 3MTNA 4CDCB 3N3GA 1CVZA 3BOWA 3P5WA 3IOQA 1TLOA 1PE6A 1YK8A 5JH3A 1ZIVA 5EGWA 1EWMA 2DCBA 2R9CA 3O0UA 2YJBA 1KFXL 1U9XA 1NQCA 2R9MA 2NQIA 4MSXA 1EF7A 4YYUA 2XU1A 3USVA 1F29A 2BDLA 1AYVA 1PXVA 3M99A 1CPJA 1ITOA 3QT4A 3F5VA 4W5CA 1QOLA 1ZCMA 1ATKA 4YYRA 8PCHA 1YALA 2P86A 3HWNA 2Y6EA 3P5VA 3HHIA 4X6HA 2FO5A 4OELA 4MZOA 2FQ9A 2BDZA 2AS8A 4N79A 3ZUAA 2B1NA 3V6CA 4BQVA 4N4ZA 4AXMA 2XU4A 1SP4B 1QDQA 3WXEA 1ME4A 2HXZA 1CJLA 2F7DA 2FYEA 4CDEB 3TNXA 2JQGR 4PP1A 5EF4A 3OF9A 3K24A 1MDWA 1ME3A 4BS5A 3WXGA 1F2BA 3N3KA 1CS8A 2FT2A 4QRXA 3PW3A 3KSEA 2PBHA 4G54A 1CB5A 3V6EA 2VHFA 4QH6A 1QXPA 2DJFB 3CBKA 3KFQA 4YYWA 4X6JA 1BQIA 2NQGA 1NB3A 5K16A 1EWPA 2GHUA 4N8WA 1ICFA 1U9QX 5PADA 1YVBA 2PADA 3QJ3A 1S4VA 2FRQA 2C0YA 1GMYA 3OVXA 1SNKA 1NLJA 4QBBA 1GLOA 2FTDA 4MZSA 2FRAA 4YVAA 4CDFB 2ATOA 6PADA 2IPPB 3MORA 2OULA 1KHQA 1M6DA 3ERVA 4FK5A 2GFOA 4FJCA 2G6DA 1AU0A 1NB5A 1KXRA 1TL9A 4QRVA 2AYNA 4P6EA 1EWLA 1AU3A 9PAPA 1EWOA 3F75A 3H7DA 3U8EA 3KW9A 2HD5A 3CH2X 3PDFA 3QSDA 4BSQA 3LFYA 1PADA 3RVXA 2PREA 2YJ8A 2YJCA 3WXFA 3HHAA 5CVOB 1U5IA 3S3RA 1FH0A 1A6RA 2E01A 1AU4A 2CB5A 4Q8HA 2O6XA 1VJVA 2YJ9A 2Y5BA 1KFUL 2OZ2A 3H8BA 1AECA 3K8UA 2XU3A 3IUTA 7PCKA 2G8EA 1Q6KA 3H8CA 3GCBA 1BY8A 3H6SA 3KWZA 4OEMA 2DJGB 4XUIA 2AVWA 5CHVA 3OVZA 1MIRA 4WA6A 4YYVA 4I04A 1Y08A 3OISA 1KHPA 1VSNA 1THEA 3BCNA 1GCBA 3NHEA 2HH5A 1U9VA 2G7YA 2HHNA 2F1GA 2H7JA 4CZWA 1POPA 4XR7A 4DMYA 2DC8A 2AIMA 4Q8GA 1NL6A 3IMAA 4FIPA 1F2AA 2IBIA 1DF0A 3RVVA 5FPWA 3E1ZB 3CH3X 4X6IA 2R9NA 4HWYA 1AU2A 3CBJA 4ZUXU 3BC3A 4W5BA 4CDDB 2E02A 1O0EA 1MEGA 1PIPA 1YK7A 1CSBB 1CQDA 3MHHA 3KWBX 3AI8A 1STFE 1PBHA 2WBFX 3OF8A 1PPDA 1MEMA 2P7UA 4YYQA 3P5UA 4QRGA 2E00A 3K9MA 3RVWA 2XU5A 2P0RA 1K3BB 3I3TA 1F2CA 1PPNA 3PBHA 2ARYA 2PNSA 3N4CA 5CHTA 2NQAA 1CV8A 2JQFR 1TU6A 2DC7A 2AUXA 2DCAA 2DCCA 5F02A 3B79A 1PPPA 3BWKA 2AYOA 1QMYA 2YJ2A 1U9WA 2DC9A 1GECE 3IHPA 4BPVA 2DCDA 3LXSA 4BS6A 3KX1A 1BGOA 4DMXA 1HUCB 1PPOA 4W4UA 4I05A 2B1MA 2R6NA 3PNRA 1JQPA 4I07A 5CVMA 1AYWA 4K7CA 3S3QA 2R9OA 4YYSA 1MS6A 1Y4HA 2NQDB 2DZYA 3BPMA 2VHSA 3HD3A 5CVNB 5JA7A 2OP3A 3KKUA 2R9FA 2G8JA 1CTEA 3I06A 4P6GA 4PADA 2DC6A 1MHWA 1XKGA 1BP4A 3D6SA 3P5XA 1PCIA 4AXLA 1DEUA 1AYUA 1X9YA 3MHSA 3O1GA 2AU1A 1IWDA 2CIOA 4KLBA 2AUZA 2DZZA 3BPFA 4RY2A 3DF0A 2E03A
chains in the Genus database with same CATH superfamily
4PI3A 4YV8A 5J94A 3IEJA 3H89A 1YT7A 4PP2E 3PHXA 2FUDA 1NPZA 3IV2A 1AIMA 3C9EA 5A24A 3RNVA 2ACTA 3MTNA 5JZEA 4CDCB 3N3GA 3BBAA 4R3DA 1CVZA 3BOWA 4D8BA 3P5WA 3IOQA 1TLOA 1PE6A 1YK8A 5JH3A 1ZIVA 5EGWA 1EWMA 2DCBA 2R9CA 3O0UA 2YJBA 1KFXL 1U9XA 1NQCA 2R9MA 2NQIA 2HWKA 4MSXA 1EF7A 4YYUA 2Z84A 3PRMA 2XU1A 3USVA 1F29A 2BDLA 1AYVA 1PXVA 3E9SA 3M99A 3OQCA 1CPJA 1ITOA 2J7QA 3QT4A 3F5VA 4W5CA 1QOLA 1ZCMA 3BY4A 1ATKA 4YYRA 4A5UA 8PCHA 1YALA 2P86A 3HWNA 2Y6EA 3P5VA 3HHIA 4X6HA 2FO5A 4OELA 4MZOA 2FQ9A 2BDZA 2AS8A 4N79A 3B21A 2B1NA 3ZUAA 3V6CA 4BQVA 4N4ZA 4AXMA 2XU4A 1SP4B 1DKIA 1QDQA 3WXEA 1ME4A 2HXZA 1CJLA 2F7DA 2FYEA 4CDEB 3TNXA 2JQGR 3PHWA 4PP1A 5EF4A 3OF9A 3K24A 2JRIA 1MDWA 1ME3A 4MM3B 4BS5A 3WXGA 3PRPA 1F2BA 3N3KA 1CS8A 4IP3A 2FT2A 4QRXA 3PW3A 3KSEA 2PBHA 4G54A 1CB5A 3BB7A 3V6EA 2VHFA 4QH6A 4BOSA 1QXPA 4MI7A 2DJFB 3CBKA 3KFQA 4YYWA 4X6JA 3TMPA 1BQIA 2NQGA 1NB3A 4P16A 5K16A 1EWPA 2GHUA 4N8WA 1ICFA 1U9QX 5PADA 1YVBA 2PADA 3QJ3A 1S4VA 2FRQA 2C0YA 2DOSA 1GMYA 3OVXA 1SNKA 1NLJA 4QBBA 1GLOA 2FTDA 4MZSA 2FRAA 4YVAA 4CDFB 2ATOA 6PADA 2IPPB 3MORA 2OULA 4IUMA 1KHQA 1M6DA 3ERVA 3IFUA 4FK5A 2GFOA 4FJCA 4M0WA 2G6DA 1AU0A 1YZBA 1NB5A 1KXRA 1TL9A 4QRVA 2AYNA 4P6EA 1EWLA 1AU3A 9PAPA 1EWOA 3F75A 3H7DA 1UKFA 3W31A 3U8EA 3KW9A 2HD5A 3CH2X 3PDFA 3QSDA 4BSQA 3LFYA 1PADA 3RVXA 2PREA 2YJ8A 2YJCA 5EZSA 3WXFA 3HHAA 4XZXA 5CVOB 1U5IA 3S3RA 1FH0A 1A6RA 2E01A 1AU4A 2CB5A 4Q8HA 2O6XA 5KO3A 2JTCA 4HXDB 1VJVA 2YJ9A 3MP2A 4GUAA 2Y5BA 1KFUL 2OZ2A 3H8BA 1AECA 3K8UA 3O65A 3TRKA 2XU3A 3IUTA 7PCKA 2G8EA 1Q6KA 3H8CA 3GCBA 1BY8A 3H6SA 4OVZA 3KWZA 4OEMA 2DJGB 4XUIA 2AVWA 5CHVA 3OVZA 1MIRA 2UZJA 4WA6A 4YYVA 4REZA 2J7QC 4I04A 3PSEA 1Y08A 3OISA 1KHPA 1VSNA 1THEA 3BCNA 1GCBA 3NHEA 2HH5A 1U9VA 2G7YA 2HHNA 2F1GA 2H7JA 4CZWA 1POPA 4XR7A 4DMYA 2DC8A 2AIMA 4Q8GA 1NL6A 3IMAA 4FIPA 3ZNHA 1F2AA 2IBIA 1DF0A 3RVVA 5FPWA 4RKXA 4D8EA 3E1ZB 3CH3X 3PHUA 4X6IA 4BOUA 2R9NA 4HWYA 1AU2A 3CBJA 4BOPA 4ZUXU 3BC3A 4W5BA 4CDDB 2E02A 2FE8A 1O0EA 1MEGA 5EZQA 1PIPA 1YK7A 1CSBB 1CQDA 3MHHA 3KWBX 3AI8A 1STFE 2BTWB 1PBHA 4D8IA 2AGAA 2WBFX 4WURA 4BOZA 3OF8A 1PPDA 1MEMA 2P7UA 4YYQA 3P5UA 4QRGA 2E00A 3K9MA 3RVWA 2XU5A 2P0RA 1K3BB 3I3TA 1F2CA 1PPNA 3PBHA 2ARYA 2PNSA 3N4CA 5CHTA 2NQAA 4RNAA 1CV8A 2JQFR 1TU6A 2DC7A 2AUXA 2DCAA 2DCCA 5F02A 3B79A 1PPPA 3BWKA 2AYOA 1QMYA 4OW0A 2YJ2A 1U9WA 2DC9A 1GECE 3IHPA 4BPVA 2DCDA 3LXSA 4RF0A 4BS6A 3KX1A 1BGOA 4DMXA 1HUCB 3PT2A 1PPOA 4W4UA 4I05A 4ZTBA 2B1MA 2R6NA 3PNRA 1JQPA 4I07A 5CVMA 1AYWA 4K7CA 3S3QA 2R9OA 4RF1A 4YYSA 1MS6A 1Y4HA 2NQDB 2DZYA 3BPMA 3C0RA 2VHSA 3HD3A 5CVNB 5JA7A 2OP3A 3KKUA 2R9FA 2G8JA 1CTEA 3I06A 4P6GA 4PADA 2DC6A 1MHWA 1XKGA 1BP4A 3D6SA 1PVJA 5E6JA 3P5XA 1PCIA 4AXLA 1DEUA 1AYUA 1X9YA 3MHSA 3MJ5A 3MTVA 3O1GA 2BTWA 4BOQA 2AU1A 1IWDA 2CIOA 4KLBA 2AUZA 2DZZA 3BPFA 4PT5A 2BU3A 4RY2A 3W30A 3DF0A 2E03A 4OVZB
chains in the Genus database with same CATH topology
4PI3A 4YV8A 5J94A 3IEJA 3H89A 1YT7A 4PP2E 2FUDA 1NPZA 3IV2A 1AIMA 3C9EA 5A24A 2ACTA 3MTNA 4CDCB 3N3GA 1CVZA 3BOWA 3P5WA 3IOQA 1TLOA 1PE6A 1YK8A 5JH3A 1ZIVA 5EGWA 1EWMA 2DCBA 2R9CA 3O0UA 2YJBA 2BSZA 1KFXL 1U9XA 1NQCA 2R9MA 3LTWA 2NQIA 4MSXA 1EF7A 4YYUA 2XU1A 3USVA 1F29A 2BDLA 1AYVA 1PXVA 3M99A 4NV8A 1CPJA 1ITOA 3QT4A 3F5VA 4W5CA 1QOLA 1ZCMA 1ATKA 4YYRA 8PCHA 1YALA 2P86A 3HWNA 2Y6EA 3P5VA 3HHIA 4X6HA 2FO5A 4OELA 4MZOA 2FQ9A 2BDZA 2AS8A 4N79A 3ZUAA 2B1NA 3V6CA 4BQVA 4N4ZA 4AXMA 2XU4A 1SP4B 1QDQA 3WXEA 1ME4A 2HXZA 1CJLA 2F7DA 2FYEA 4CDEB 3TNXA 2JQGR 4PP1A 4GUZA 5EF4A 3OF9A 3K24A 1MDWA 1ME3A 4BS5A 3WXGA 1F2BA 3N3KA 1CS8A 2FT2A 4QRXA 3PW3A 3KSEA 2PBHA 4G54A 1CB5A 3V6EA 2VHFA 4QH6A 1QXPA 2DJFB 3CBKA 3KFQA 4YYWA 4X6JA 1BQIA 2NQGA 1NB3A 5K16A 1EWPA 2GHUA 4N8WA 1ICFA 1U9QX 5PADA 1YVBA 2PADA 3QJ3A 1S4VA 2FRQA 1W6FA 2C0YA 1GMYA 3OVXA 1SNKA 1NLJA 4QBBA 1GLOA 2FTDA 4MZSA 2FRAA 4YVAA 4CDFB 2ATOA 6PADA 2IPPB 3MORA 2OULA 1KHQA 1M6DA 3ERVA 4FK5A 2GFOA 4FJCA 4BGFA 2G6DA 1AU0A 1NB5A 1KXRA 1TL9A 4QRVA 2AYNA 4P6EA 1EWLA 1AU3A 9PAPA 1EWOA 3F75A 3H7DA 4C5PA 3U8EA 3KW9A 2HD5A 1E2TA 3CH2X 3PDFA 3QSDA 4BSQA 3LFYA 1PADA 3RVXA 2PREA 2YJ8A 2YJCA 3WXFA 3HHAA 5CVOB 1U5IA 3S3RA 1FH0A 1A6RA 2E01A 1AU4A 2CB5A 4Q8HA 2O6XA 1VJVA 2YJ9A 2Y5BA 1KFUL 2OZ2A 3H8BA 1AECA 3K8UA 2XU3A 3IUTA 7PCKA 2G8EA 1Q6KA 3H8CA 3GCBA 1BY8A 3H6SA 3KWZA 4OEMA 2DJGB 4XUIA 2AVWA 5CHVA 3OVZA 1MIRA 4WA6A 1W4TA 4YYVA 4I04A 1Y08A 3OISA 1KHPA 1VSNA 1THEA 3BCNA 1GCBA 3NHEA 2HH5A 1U9VA 2G7YA 2HHNA 2F1GA 2H7JA 4CZWA 1POPA 4XR7A 4DMYA 2DC8A 2AIMA 4Q8GA 1NL6A 3IMAA 4FIPA 2VFCA 1F2AA 2IBIA 3D9WA 1DF0A 3RVVA 5FPWA 3E1ZB 3CH3X 4X6IA 2R9NA 4HWYA 1AU2A 3CBJA 4ZUXU 3BC3A 4W5BA 4CDDB 2E02A 1O0EA 1MEGA 1PIPA 1YK7A 1CSBB 1CQDA 3MHHA 3KWBX 3AI8A 1STFE 1PBHA 2WBFX 3OF8A 1PPDA 1MEMA 2P7UA 4YYQA 3P5UA 4QRGA 2E00A 3K9MA 3RVWA 2XU5A 2P0RA 1K3BB 3I3TA 1F2CA 1PPNA 3PBHA 2ARYA 2PNSA 3N4CA 5CHTA 2NQAA 1CV8A 2JQFR 1TU6A 2DC7A 2AUXA 2DCAA 2DCCA 5F02A 3B79A 1PPPA 3BWKA 2AYOA 1QMYA 2YJ2A 1U9WA 4NV7A 2DC9A 1GECE 3IHPA 4BPVA 2DCDA 3LXSA 4BS6A 3KX1A 1BGOA 4DMXA 1HUCB 1PPOA 4W4UA 4I05A 2B1MA 2R6NA 2VFBA 3PNRA 1JQPA 4I07A 5CVMA 1AYWA 4K7CA 3S3QA 2R9OA 4YYSA 1MS6A 1Y4HA 2NQDB 2DZYA 3BPMA 2VHSA 3HD3A 5CVNB 5JA7A 2OP3A 3KKUA 2R9FA 2G8JA 1CTEA 3I06A 4P6GA 4PADA 2DC6A 1MHWA 1XKGA 1W5RA 1GX3A 1BP4A 3D6SA 3P5XA 4B55A 1PCIA 4AXLA 1DEUA 1AYUA 1X9YA 3MHSA 3O1GA 2AU1A 1IWDA 2CIOA 4KLBA 2AUZA 2DZZA 3BPFA 4RY2A 3DF0A 2E03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PI3 A;  4YV8 A;  5J94 A;  3IEJ A;  3H89 A;  1YT7 A;  4PP2 E;  2FUD A;  1NPZ A;  3IV2 A;  1AIM A;  3C9E A;  5A24 A;  2ACT A;  3MTN A;  4CDC B;  3N3G A;  1CVZ A;  3BOW A;  3P5W A;  3IOQ A;  1TLO A;  1PE6 A;  1YK8 A;  5JH3 A;  1ZIV A;  5EGW A;  1EWM A;  2DCB A;  2R9C A;  3O0U A;  2YJB A;  1KFX L;  1U9X A;  1NQC A;  2R9M A;  2NQI A;  4MSX A;  1EF7 A;  4YYU A;  2XU1 A;  3USV A;  1F29 A;  2BDL A;  1AYV A;  1PXV A;  3M99 A;  1CPJ A;  1ITO A;  3QT4 A;  3F5V A;  4W5C A;  1QOL A;  1ZCM A;  1ATK A;  4YYR A;  8PCH A;  1YAL A;  2P86 A;  3HWN A;  2Y6E A;  3P5V A;  3HHI A;  4X6H A;  2FO5 A;  4OEL A;  4MZO A;  2FQ9 A;  2BDZ A;  2AS8 A;  4N79 A;  3ZUA A;  2B1N A;  3V6C A;  4BQV A;  4N4Z A;  4AXM A;  2XU4 A;  1SP4 B;  1QDQ A;  3WXE A;  1ME4 A;  2HXZ A;  1CJL A;  2F7D A;  2FYE A;  4CDE B;  3TNX A;  2JQG R;  4PP1 A;  5EF4 A;  3OF9 A;  3K24 A;  1MDW A;  1ME3 A;  4BS5 A;  3WXG A;  1F2B A;  3N3K A;  1CS8 A;  2FT2 A;  4QRX A;  3PW3 A;  3KSE A;  2PBH A;  4G54 A;  1CB5 A;  3V6E A;  2VHF A;  4QH6 A;  1QXP A;  2DJF B;  3CBK A;  3KFQ A;  4YYW A;  4X6J A;  1BQI A;  2NQG A;  1NB3 A;  5K16 A;  1EWP A;  2GHU A;  4N8W A;  1ICF A;  1U9Q X;  5PAD A;  1YVB A;  2PAD A;  3QJ3 A;  1S4V A;  2FRQ A;  2C0Y A;  1GMY A;  3OVX A;  1SNK A;  1NLJ A;  4QBB A;  1GLO A;  2FTD A;  4MZS A;  2FRA A;  4YVA A;  4CDF B;  2ATO A;  6PAD A;  2IPP B;  3MOR A;  2OUL A;  1KHQ A;  1M6D A;  3ERV A;  4FK5 A;  2GFO A;  4FJC A;  2G6D A;  1AU0 A;  1NB5 A;  1KXR A;  1TL9 A;  4QRV A;  2AYN A;  4P6E A;  1EWL A;  1AU3 A;  9PAP A;  1EWO A;  3F75 A;  3H7D A;  3U8E A;  3KW9 A;  2HD5 A;  3CH2 X;  3PDF A;  3QSD A;  4BSQ A;  3LFY A;  1PAD A;  3RVX A;  2PRE A;  2YJ8 A;  2YJC A;  3WXF A;  3HHA A;  5CVO B;  1U5I A;  3S3R A;  1FH0 A;  1A6R A;  2E01 A;  1AU4 A;  2CB5 A;  4Q8H A;  2O6X A;  1VJV A;  2YJ9 A;  2Y5B A;  1KFU L;  2OZ2 A;  3H8B A;  1AEC A;  3K8U A;  2XU3 A;  3IUT A;  7PCK A;  2G8E A;  1Q6K A;  3H8C A;  3GCB A;  1BY8 A;  3H6S A;  3KWZ A;  4OEM A;  2DJG B;  4XUI A;  2AVW A;  5CHV A;  3OVZ A;  1MIR A;  4WA6 A;  4YYV A;  4I04 A;  1Y08 A;  3OIS A;  1KHP A;  1VSN A;  1THE A;  3BCN A;  1GCB A;  3NHE A;  2HH5 A;  1U9V A;  2G7Y A;  2HHN A;  2F1G A;  2H7J A;  4CZW A;  1POP A;  4XR7 A;  4DMY A;  2DC8 A;  2AIM A;  4Q8G A;  1NL6 A;  3IMA A;  4FIP A;  1F2A A;  2IBI A;  1DF0 A;  3RVV A;  5FPW A;  3E1Z B;  3CH3 X;  4X6I A;  2R9N A;  4HWY A;  1AU2 A;  3CBJ A;  4ZUX U;  3BC3 A;  4W5B A;  4CDD B;  2E02 A;  1O0E A;  1MEG A;  1PIP A;  1YK7 A;  1CSB B;  1CQD A;  3MHH A;  3KWB X;  3AI8 A;  1STF E;  1PBH A;  2WBF X;  3OF8 A;  1PPD A;  1MEM A;  2P7U A;  4YYQ A;  3P5U A;  4QRG A;  2E00 A;  3K9M A;  3RVW A;  2XU5 A;  2P0R A;  1K3B B;  3I3T A;  1F2C A;  1PPN A;  3PBH A;  2ARY A;  2PNS A;  3N4C A;  5CHT A;  2NQA A;  1CV8 A;  2JQF R;  1TU6 A;  2DC7 A;  2AUX A;  2DCA A;  2DCC A;  5F02 A;  3B79 A;  1PPP A;  3BWK A;  2AYO A;  1QMY A;  2YJ2 A;  1U9W A;  2DC9 A;  1GEC E;  3IHP A;  4BPV A;  2DCD A;  3LXS A;  4BS6 A;  3KX1 A;  1BGO A;  4DMX A;  1HUC B;  1PPO A;  4W4U A;  4I05 A;  2B1M A;  2R6N A;  3PNR A;  1JQP A;  4I07 A;  5CVM A;  1AYW A;  4K7C A;  3S3Q A;  2R9O A;  4YYS A;  1MS6 A;  1Y4H A;  2NQD B;  2DZY A;  3BPM A;  2VHS A;  3HD3 A;  5CVN B;  5JA7 A;  2OP3 A;  3KKU A;  2R9F A;  2G8J A;  1CTE A;  3I06 A;  4P6G A;  4PAD A;  2DC6 A;  1MHW A;  1XKG A;  1BP4 A;  3D6S A;  3P5X A;  1PCI A;  4AXL A;  1DEU A;  1AYU A;  1X9Y A;  3MHS A;  3O1G A;  2AU1 A;  1IWD A;  2CIO A;  4KLB A;  2AUZ A;  2DZZ A;  3BPF A;  4RY2 A;  3DF0 A;  2E03 A; 
#chains in the Genus database with same CATH topology
 4PI3 A;  4YV8 A;  5J94 A;  3IEJ A;  3H89 A;  1YT7 A;  4PP2 E;  3PHX A;  2FUD A;  1NPZ A;  3IV2 A;  1AIM A;  3C9E A;  5A24 A;  3RNV A;  2ACT A;  3MTN A;  5JZE A;  4CDC B;  3N3G A;  3BBA A;  4R3D A;  1CVZ A;  3BOW A;  4D8B A;  3P5W A;  3IOQ A;  1TLO A;  1PE6 A;  1YK8 A;  5JH3 A;  1ZIV A;  5EGW A;  1EWM A;  2DCB A;  2R9C A;  3O0U A;  2YJB A;  1KFX L;  1U9X A;  1NQC A;  2R9M A;  2NQI A;  2HWK A;  4MSX A;  1EF7 A;  4YYU A;  2Z84 A;  3PRM A;  2XU1 A;  3USV A;  1F29 A;  2BDL A;  1AYV A;  1PXV A;  3E9S A;  3M99 A;  3OQC A;  1CPJ A;  1ITO A;  2J7Q A;  3QT4 A;  3F5V A;  4W5C A;  1QOL A;  1ZCM A;  3BY4 A;  1ATK A;  4YYR A;  4A5U A;  8PCH A;  1YAL A;  2P86 A;  3HWN A;  2Y6E A;  3P5V A;  3HHI A;  4X6H A;  2FO5 A;  4OEL A;  4MZO A;  2FQ9 A;  2BDZ A;  2AS8 A;  4N79 A;  3B21 A;  2B1N A;  3ZUA A;  3V6C A;  4BQV A;  4N4Z A;  4AXM A;  2XU4 A;  1SP4 B;  1DKI A;  1QDQ A;  3WXE A;  1ME4 A;  2HXZ A;  1CJL A;  2F7D A;  2FYE A;  4CDE B;  3TNX A;  2JQG R;  3PHW A;  4PP1 A;  5EF4 A;  3OF9 A;  3K24 A;  2JRI A;  1MDW A;  1ME3 A;  4MM3 B;  4BS5 A;  3WXG A;  3PRP A;  1F2B A;  3N3K A;  1CS8 A;  4IP3 A;  2FT2 A;  4QRX A;  3PW3 A;  3KSE A;  2PBH A;  4G54 A;  1CB5 A;  3BB7 A;  3V6E A;  2VHF A;  4QH6 A;  4BOS A;  1QXP A;  4MI7 A;  2DJF B;  3CBK A;  3KFQ A;  4YYW A;  4X6J A;  3TMP A;  1BQI A;  2NQG A;  1NB3 A;  4P16 A;  5K16 A;  1EWP A;  2GHU A;  4N8W A;  1ICF A;  1U9Q X;  5PAD A;  1YVB A;  2PAD A;  3QJ3 A;  1S4V A;  2FRQ A;  2C0Y A;  2DOS A;  1GMY A;  3OVX A;  1SNK A;  1NLJ A;  4QBB A;  1GLO A;  2FTD A;  4MZS A;  2FRA A;  4YVA A;  4CDF B;  2ATO A;  6PAD A;  2IPP B;  3MOR A;  2OUL A;  4IUM A;  1KHQ A;  1M6D A;  3ERV A;  3IFU A;  4FK5 A;  2GFO A;  4FJC A;  4M0W A;  2G6D A;  1AU0 A;  1YZB A;  1NB5 A;  1KXR A;  1TL9 A;  4QRV A;  2AYN A;  4P6E A;  1EWL A;  1AU3 A;  9PAP A;  1EWO A;  3F75 A;  3H7D A;  1UKF A;  3W31 A;  3U8E A;  3KW9 A;  2HD5 A;  3CH2 X;  3PDF A;  3QSD A;  4BSQ A;  3LFY A;  1PAD A;  3RVX A;  2PRE A;  2YJ8 A;  2YJC A;  5EZS A;  3WXF A;  3HHA A;  4XZX A;  5CVO B;  1U5I A;  3S3R A;  1FH0 A;  1A6R A;  2E01 A;  1AU4 A;  2CB5 A;  4Q8H A;  2O6X A;  5KO3 A;  2JTC A;  4HXD B;  1VJV A;  2YJ9 A;  3MP2 A;  4GUA A;  2Y5B A;  1KFU L;  2OZ2 A;  3H8B A;  1AEC A;  3K8U A;  3O65 A;  3TRK A;  2XU3 A;  3IUT A;  7PCK A;  2G8E A;  1Q6K A;  3H8C A;  3GCB A;  1BY8 A;  3H6S A;  4OVZ A;  3KWZ A;  4OEM A;  2DJG B;  4XUI A;  2AVW A;  5CHV A;  3OVZ A;  1MIR A;  2UZJ A;  4WA6 A;  4YYV A;  4REZ A;  2J7Q C;  4I04 A;  3PSE A;  1Y08 A;  3OIS A;  1KHP A;  1VSN A;  1THE A;  3BCN A;  1GCB A;  3NHE A;  2HH5 A;  1U9V A;  2G7Y A;  2HHN A;  2F1G A;  2H7J A;  4CZW A;  1POP A;  4XR7 A;  4DMY A;  2DC8 A;  2AIM A;  4Q8G A;  1NL6 A;  3IMA A;  4FIP A;  3ZNH A;  1F2A A;  2IBI A;  1DF0 A;  3RVV A;  5FPW A;  4RKX A;  4D8E A;  3E1Z B;  3CH3 X;  3PHU A;  4X6I A;  4BOU A;  2R9N A;  4HWY A;  1AU2 A;  3CBJ A;  4BOP A;  4ZUX U;  3BC3 A;  4W5B A;  4CDD B;  2E02 A;  2FE8 A;  1O0E A;  1MEG A;  5EZQ A;  1PIP A;  1YK7 A;  1CSB B;  1CQD A;  3MHH A;  3KWB X;  3AI8 A;  1STF E;  2BTW B;  1PBH A;  4D8I A;  2AGA A;  2WBF X;  4WUR A;  4BOZ A;  3OF8 A;  1PPD A;  1MEM A;  2P7U A;  4YYQ A;  3P5U A;  4QRG A;  2E00 A;  3K9M A;  3RVW A;  2XU5 A;  2P0R A;  1K3B B;  3I3T A;  1F2C A;  1PPN A;  3PBH A;  2ARY A;  2PNS A;  3N4C A;  5CHT A;  2NQA A;  4RNA A;  1CV8 A;  2JQF R;  1TU6 A;  2DC7 A;  2AUX A;  2DCA A;  2DCC A;  5F02 A;  3B79 A;  1PPP A;  3BWK A;  2AYO A;  1QMY A;  4OW0 A;  2YJ2 A;  1U9W A;  2DC9 A;  1GEC E;  3IHP A;  4BPV A;  2DCD A;  3LXS A;  4RF0 A;  4BS6 A;  3KX1 A;  1BGO A;  4DMX A;  1HUC B;  3PT2 A;  1PPO A;  4W4U A;  4I05 A;  4ZTB A;  2B1M A;  2R6N A;  3PNR A;  1JQP A;  4I07 A;  5CVM A;  1AYW A;  4K7C A;  3S3Q A;  2R9O A;  4RF1 A;  4YYS A;  1MS6 A;  1Y4H A;  2NQD B;  2DZY A;  3BPM A;  3C0R A;  2VHS A;  3HD3 A;  5CVN B;  5JA7 A;  2OP3 A;  3KKU A;  2R9F A;  2G8J A;  1CTE A;  3I06 A;  4P6G A;  4PAD A;  2DC6 A;  1MHW A;  1XKG A;  1BP4 A;  3D6S A;  1PVJ A;  5E6J A;  3P5X A;  1PCI A;  4AXL A;  1DEU A;  1AYU A;  1X9Y A;  3MHS A;  3MJ5 A;  3MTV A;  3O1G A;  2BTW A;  4BOQ A;  2AU1 A;  1IWD A;  2CIO A;  4KLB A;  2AUZ A;  2DZZ A;  3BPF A;  4PT5 A;  2BU3 A;  4RY2 A;  3W30 A;  3DF0 A;  2E03 A;  4OVZ B; 
#chains in the Genus database with same CATH homology
 4PI3 A;  4YV8 A;  5J94 A;  3IEJ A;  3H89 A;  1YT7 A;  4PP2 E;  2FUD A;  1NPZ A;  3IV2 A;  1AIM A;  3C9E A;  5A24 A;  2ACT A;  3MTN A;  4CDC B;  3N3G A;  1CVZ A;  3BOW A;  3P5W A;  3IOQ A;  1TLO A;  1PE6 A;  1YK8 A;  5JH3 A;  1ZIV A;  5EGW A;  1EWM A;  2DCB A;  2R9C A;  3O0U A;  2YJB A;  2BSZ A;  1KFX L;  1U9X A;  1NQC A;  2R9M A;  3LTW A;  2NQI A;  4MSX A;  1EF7 A;  4YYU A;  2XU1 A;  3USV A;  1F29 A;  2BDL A;  1AYV A;  1PXV A;  3M99 A;  4NV8 A;  1CPJ A;  1ITO A;  3QT4 A;  3F5V A;  4W5C A;  1QOL A;  1ZCM A;  1ATK A;  4YYR A;  8PCH A;  1YAL A;  2P86 A;  3HWN A;  2Y6E A;  3P5V A;  3HHI A;  4X6H A;  2FO5 A;  4OEL A;  4MZO A;  2FQ9 A;  2BDZ A;  2AS8 A;  4N79 A;  3ZUA A;  2B1N A;  3V6C A;  4BQV A;  4N4Z A;  4AXM A;  2XU4 A;  1SP4 B;  1QDQ A;  3WXE A;  1ME4 A;  2HXZ A;  1CJL A;  2F7D A;  2FYE A;  4CDE B;  3TNX A;  2JQG R;  4PP1 A;  4GUZ A;  5EF4 A;  3OF9 A;  3K24 A;  1MDW A;  1ME3 A;  4BS5 A;  3WXG A;  1F2B A;  3N3K A;  1CS8 A;  2FT2 A;  4QRX A;  3PW3 A;  3KSE A;  2PBH A;  4G54 A;  1CB5 A;  3V6E A;  2VHF A;  4QH6 A;  1QXP A;  2DJF B;  3CBK A;  3KFQ A;  4YYW A;  4X6J A;  1BQI A;  2NQG A;  1NB3 A;  5K16 A;  1EWP A;  2GHU A;  4N8W A;  1ICF A;  1U9Q X;  5PAD A;  1YVB A;  2PAD A;  3QJ3 A;  1S4V A;  2FRQ A;  1W6F A;  2C0Y A;  1GMY A;  3OVX A;  1SNK A;  1NLJ A;  4QBB A;  1GLO A;  2FTD A;  4MZS A;  2FRA A;  4YVA A;  4CDF B;  2ATO A;  6PAD A;  2IPP B;  3MOR A;  2OUL A;  1KHQ A;  1M6D A;  3ERV A;  4FK5 A;  2GFO A;  4FJC A;  4BGF A;  2G6D A;  1AU0 A;  1NB5 A;  1KXR A;  1TL9 A;  4QRV A;  2AYN A;  4P6E A;  1EWL A;  1AU3 A;  9PAP A;  1EWO A;  3F75 A;  3H7D A;  4C5P A;  3U8E A;  3KW9 A;  2HD5 A;  1E2T A;  3CH2 X;  3PDF A;  3QSD A;  4BSQ A;  3LFY A;  1PAD A;  3RVX A;  2PRE A;  2YJ8 A;  2YJC A;  3WXF A;  3HHA A;  5CVO B;  1U5I A;  3S3R A;  1FH0 A;  1A6R A;  2E01 A;  1AU4 A;  2CB5 A;  4Q8H A;  2O6X A;  1VJV A;  2YJ9 A;  2Y5B A;  1KFU L;  2OZ2 A;  3H8B A;  1AEC A;  3K8U A;  2XU3 A;  3IUT A;  7PCK A;  2G8E A;  1Q6K A;  3H8C A;  3GCB A;  1BY8 A;  3H6S A;  3KWZ A;  4OEM A;  2DJG B;  4XUI A;  2AVW A;  5CHV A;  3OVZ A;  1MIR A;  4WA6 A;  1W4T A;  4YYV A;  4I04 A;  1Y08 A;  3OIS A;  1KHP A;  1VSN A;  1THE A;  3BCN A;  1GCB A;  3NHE A;  2HH5 A;  1U9V A;  2G7Y A;  2HHN A;  2F1G A;  2H7J A;  4CZW A;  1POP A;  4XR7 A;  4DMY A;  2DC8 A;  2AIM A;  4Q8G A;  1NL6 A;  3IMA A;  4FIP A;  2VFC A;  1F2A A;  2IBI A;  3D9W A;  1DF0 A;  3RVV A;  5FPW A;  3E1Z B;  3CH3 X;  4X6I A;  2R9N A;  4HWY A;  1AU2 A;  3CBJ A;  4ZUX U;  3BC3 A;  4W5B A;  4CDD B;  2E02 A;  1O0E A;  1MEG A;  1PIP A;  1YK7 A;  1CSB B;  1CQD A;  3MHH A;  3KWB X;  3AI8 A;  1STF E;  1PBH A;  2WBF X;  3OF8 A;  1PPD A;  1MEM A;  2P7U A;  4YYQ A;  3P5U A;  4QRG A;  2E00 A;  3K9M A;  3RVW A;  2XU5 A;  2P0R A;  1K3B B;  3I3T A;  1F2C A;  1PPN A;  3PBH A;  2ARY A;  2PNS A;  3N4C A;  5CHT A;  2NQA A;  1CV8 A;  2JQF R;  1TU6 A;  2DC7 A;  2AUX A;  2DCA A;  2DCC A;  5F02 A;  3B79 A;  1PPP A;  3BWK A;  2AYO A;  1QMY A;  2YJ2 A;  1U9W A;  4NV7 A;  2DC9 A;  1GEC E;  3IHP A;  4BPV A;  2DCD A;  3LXS A;  4BS6 A;  3KX1 A;  1BGO A;  4DMX A;  1HUC B;  1PPO A;  4W4U A;  4I05 A;  2B1M A;  2R6N A;  2VFB A;  3PNR A;  1JQP A;  4I07 A;  5CVM A;  1AYW A;  4K7C A;  3S3Q A;  2R9O A;  4YYS A;  1MS6 A;  1Y4H A;  2NQD B;  2DZY A;  3BPM A;  2VHS A;  3HD3 A;  5CVN B;  5JA7 A;  2OP3 A;  3KKU A;  2R9F A;  2G8J A;  1CTE A;  3I06 A;  4P6G A;  4PAD A;  2DC6 A;  1MHW A;  1XKG A;  1W5R A;  1GX3 A;  1BP4 A;  3D6S A;  3P5X A;  4B55 A;  1PCI A;  4AXL A;  1DEU A;  1AYU A;  1X9Y A;  3MHS A;  3O1G A;  2AU1 A;  1IWD A;  2CIO A;  4KLB A;  2AUZ A;  2DZZ A;  3BPF A;  4RY2 A;  3DF0 A;  2E03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...