4N8WA

Cathepsin k - chondroitin sulfate complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
213
structure length
213
Chain Sequence
DSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of collagen fiber degradation by cathepsin K.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin K
total genus 66
structure length 213
sequence length 213
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2013-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4n8wA00
3P5UA 1EWLA 5CHTA 3BC3A 4X6JA 2AYNA 3H8CA 4YYSA 3IHPA 3BOWA 3F5VA 3C9EA 1ME4A 1F29A 4FK5A 1S4VA 3I3TA 4I04A 3ZUAA 3KFQA 3OF9A 2DCCA 2YJ9A 3MORA 1MHWA 5EGWA 2OZ2A 4QRXA 1EWMA 2NQGA 1Q6KA 3B79A 2DCDA 3CH2X 2FRAA 1POPA 3V6CA 2R9OA 3KSEA 2XU3A 1KHQA 3O1GA 2AUZA 4AXLA 1AYVA 2ARYA 1ICFA 1PPPA 3PDFA 2DJGB 1EWOA 1QDQA 2FRQA 1TU6A 4Q8HA 4N79A 1MDWA 1F2BA 2YJ8A 3K8UA 2HH5A 1NB3A 3PNRA 4YYRA 3KX1A 3N3KA 2R6NA 2Y5BA 4YYQA 3BWKA 2VHSA 3QT4A 1YVBA 3NHEA 3RVVA 3IV2A 2DZYA 3AI8A 2FYEA 2NQAA 5CHVA 4Q8GA 5EF4A 4WA6A 1PCIA 3IOQA 5CVNB 4PP1A 1CPJA 2AVWA 2G8EA 1NLJA 7PCKA 2P7UA 2F7DA 1NB5A 4I05A 3S3RA 2O6XA 2YJCA 3ERVA 1U5IA 5K16A 1EF7A 1CTEA 1GECE 1PPNA 4PI3A 4W5CA 1KFUL 1CV8A 5PADA 9PAPA 1CSBB 2VHFA 2E03A 3IMAA 3WXEA 4YYUA 1DEUA 1QXPA 3KKUA 1M6DA 1PXVA 3USVA 3OVZA 4BS5A 2FO5A 1ATKA 1AU0A 1SP4B 4CDCB 2P86A 4N4ZA 4G54A 4MZSA 4OEMA 2H7JA 3PW3A 3LXSA 4BPVA 5CVMA 6PADA 1VJVA 1XKGA 3E1ZB 4BSQA 4OELA 1X9YA 3OF8A 4XR7A 1TLOA 3H7DA 2GHUA 2PREA 3BCNA 1AU3A 3M99A 4QRVA 1MEMA 1QMYA 1AYUA 3K24A 2YJBA 3WXFA 4N8WA 2C0YA 1K3BB 3QJ3A 4QH6A 4K7CA 2FT2A 2NQIA 1BY8A 3MHHA 1CS8A 1IWDA 2Y6EA 1PBHA 3LFYA 8PCHA 3CBJA 3WXGA 5J94A 2YJ2A 1KHPA 2GFOA 5JH3A 2PADA 3MTNA 3IUTA 1TL9A 1NL6A 1YK7A 4CDDB 3BPFA 3DF0A 1GLOA 4P6GA 2DC7A 2NQDB 3TNXA 2DZZA 4HWYA 1SNKA 3H89A 3O0UA 3GCBA 2AU1A 3P5WA 1CVZA 1F2AA 2G8JA 2AUXA 1KXRA 4MZOA 1O0EA 1ME3A 1YT7A 1BP4A 4PP2E 2DCBA 2G6DA 4QBBA 2XU1A 2BDZA 1NQCA 4PADA 3N3GA 3BPMA 4FIPA 3IEJA 3OISA 4BS6A 2ACTA 5CVOB 2P0RA 2BDLA 1AECA 3QSDA 2R9NA 4I07A 2AYOA 1AU4A 3KWZA 1THEA 2HHNA 1CQDA 1PADA 2E02A 3U8EA 3P5XA 2R9FA 1GMYA 4YYWA 2OULA 3H8BA 2DJFB 4DMXA 2XU5A 3V6EA 1AU2A 5A24A 1NPZA 1ZCMA 1CJLA 1FH0A 4YVAA 4W4UA 1BGOA 3CH3X 3HHIA 4CZWA 3RVWA 3H6SA 3F75A 1Y4HA 2DCAA 3KW9A 4W5BA 1AYWA 1HUCB 2WBFX 2JQFR 2IBIA 2JQGR 2AS8A 4FJCA 2DC8A 3P5VA 2CB5A 2OP3A 3RVXA 3K9MA 1PIPA 2FUDA 1YK8A 3HHAA 1GCBA 2HXZA 2B1MA 3OVXA 4YYVA 4RY2A 1MEGA 4CDEB 3MHSA 2FQ9A 1U9VA 2F1GA 1EWPA 4AXMA 3S3QA 1YALA 5FPWA 1MIRA 4QRGA 1U9WA 1CB5A 2E00A 1STFE 2G7YA 1AIMA 1PE6A 3N4CA 4P6EA 2PNSA 4KLBA 3I06A 4DMYA 1U9XA 2B1NA 4BQVA 4X6HA 2DC6A 4XUIA 4MSXA 1PPOA 4CDFB 4X6IA 1QOLA 2CIOA 5F02A 1A6RA 3D6SA 1ZIVA 2DC9A 4YV8A 1ITOA 2E01A 1VSNA 1BQIA 3HWNA 3CBKA 1U9QX 4ZUXU 2AIMA 2XU4A 2R9CA 1DF0A 1PPDA 2IPPB 5JA7A 2PBHA 2R9MA 2HD5A 1MS6A 3HD3A 3PBHA 1Y08A 3KWBX 1F2CA 2ATOA 2FTDA 1JQPA 1KFXL
chains in the Genus database with same CATH superfamily
3P5UA 1EWLA 5CHTA 3BC3A 4X6JA 2AYNA 3H8CA 4YYSA 3IHPA 3BOWA 3F5VA 3C9EA 1ME4A 1F29A 4FK5A 1S4VA 3I3TA 4I04A 4BOSA 3ZUAA 3KFQA 3OF9A 2DCCA 3MTVA 2YJ9A 4ZTBA 3MORA 1MHWA 5EGWA 2OZ2A 4QRXA 1EWMA 2NQGA 3TRKA 1Q6KA 3B79A 2DCDA 3CH2X 2FRAA 1POPA 3V6CA 4GUAA 2R9OA 3KSEA 2XU3A 1KHQA 3O1GA 2AUZA 4AXLA 1AYVA 1YZBA 1ICFA 1PPPA 2ARYA 3PDFA 2DJGB 1EWOA 1QDQA 2FRQA 1TU6A 4Q8HA 4N79A 1MDWA 1F2BA 2Z84A 2YJ8A 3K8UA 2HH5A 3PRPA 1NB3A 3PNRA 4YYRA 3KX1A 3N3KA 2R6NA 2Y5BA 4YYQA 3OQCA 4OW0A 3BWKA 2VHSA 3QT4A 1YVBA 3NHEA 3RVVA 3IV2A 2DZYA 3AI8A 2FYEA 2NQAA 5CHVA 4Q8GA 5EF4A 4WA6A 1PCIA 3IOQA 5CVNB 4PP1A 1CPJA 4WURA 2AVWA 2G8EA 1NLJA 7PCKA 2P7UA 2F7DA 1NB5A 4I05A 1DKIA 3S3RA 2O6XA 2YJCA 3ERVA 4D8EA 3C0RA 4MI7A 1U5IA 5K16A 1EF7A 1CTEA 1GECE 1PPNA 4PI3A 4W5CA 1KFUL 1CV8A 5PADA 9PAPA 1CSBB 2VHFA 2E03A 3IMAA 3WXEA 1UKFA 4YYUA 3B21A 1DEUA 1QXPA 3KKUA 1M6DA 5JZEA 1PXVA 3USVA 3OVZA 4BS5A 2FO5A 1ATKA 5E6JA 2J7QA 1AU0A 1SP4B 4CDCB 4D8BA 2P86A 4N4ZA 4G54A 4MZSA 4OEMA 2H7JA 2DOSA 3BB7A 3PW3A 3LXSA 4BPVA 5CVMA 6PADA 1VJVA 1XKGA 2J7QC 3E1ZB 4BSQA 4RF1A 4OELA 3PSEA 1X9YA 3OF8A 4XR7A 1TLOA 2JRIA 3H7DA 2GHUA 2PREA 3BCNA 1AU3A 3M99A 4QRVA 1MEMA 1QMYA 1AYUA 3K24A 4BOZA 2YJBA 3WXFA 4N8WA 2C0YA 1K3BB 3QJ3A 4QH6A 4BOQA 4K7CA 1PVJA 2FT2A 2NQIA 1BY8A 3MHHA 1CS8A 1IWDA 2Y6EA 1PBHA 3LFYA 8PCHA 2BTWA 3CBJA 3WXGA 5J94A 2YJ2A 1KHPA 2GFOA 5JH3A 2PADA 4IP3A 3MTNA 3IUTA 1TL9A 1NL6A 2BTWB 1YK7A 4CDDB 3BPFA 3DF0A 1GLOA 2BU3A 3BY4A 4P6GA 2FE8A 2DC7A 5EZSA 2NQDB 3TNXA 2DZZA 4HWYA 1SNKA 3H89A 3O0UA 3GCBA 2JTCA 2AU1A 3P5WA 1CVZA 1F2AA 2G8JA 2AUXA 1KXRA 4MZOA 1O0EA 1ME3A 1YT7A 1BP4A 4MM3B 4PP2E 2DCBA 2G6DA 4QBBA 2XU1A 2BDZA 1NQCA 4PADA 3N3GA 4BOUA 3BPMA 3IFUA 4FIPA 3IEJA 3OISA 4BS6A 2ACTA 3PHXA 2P0RA 2BDLA 5CVOB 4D8IA 1AECA 3QSDA 2R9NA 4P16A 4I07A 2AYOA 1AU4A 3KWZA 1THEA 2HHNA 1CQDA 3W30A 3O65A 1PADA 2E02A 3U8EA 3P5XA 3PRMA 4R3DA 2R9FA 1GMYA 2UZJA 4YYWA 2OULA 3H8BA 2DJFB 4DMXA 2XU5A 3V6EA 3W31A 1AU2A 5A24A 1NPZA 1ZCMA 1CJLA 1FH0A 4YVAA 4W4UA 4PT5A 1BGOA 4REZA 3CH3X 4M0WA 3HHIA 4CZWA 3RVWA 3H6SA 3F75A 1Y4HA 2DCAA 4IUMA 3KW9A 2HWKA 4W5BA 3MP2A 1AYWA 5EZQA 1HUCB 3PHUA 2WBFX 3PT2A 2JQFR 2IBIA 2JQGR 2AS8A 4FJCA 2DC8A 4BOPA 3P5VA 3E9SA 2CB5A 2OP3A 3RVXA 3K9MA 1PIPA 2FUDA 1YK8A 3HHAA 1GCBA 2HXZA 2B1MA 3OVXA 4YYVA 4RY2A 1MEGA 4CDEB 3MHSA 2FQ9A 1U9VA 2F1GA 1EWPA 4AXMA 3PHWA 3S3QA 1YALA 5FPWA 1MIRA 4OVZB 4XZXA 4RF0A 4QRGA 1U9WA 1CB5A 2E00A 1STFE 2G7YA 1AIMA 1PE6A 4HXDB 3N4CA 4P6EA 2PNSA 4KLBA 3I06A 4DMYA 3ZNHA 1U9XA 4A5UA 2B1NA 4BQVA 4X6HA 2DC6A 4XUIA 4MSXA 3TMPA 1PPOA 4CDFB 4X6IA 1QOLA 2CIOA 5F02A 1A6RA 3D6SA 1ZIVA 2DC9A 4YV8A 2AGAA 1ITOA 2E01A 1VSNA 1BQIA 3HWNA 3CBKA 1U9QX 4RKXA 4ZUXU 2AIMA 3BBAA 2XU4A 2R9CA 5KO3A 3RNVA 1DF0A 1PPDA 2IPPB 5JA7A 2PBHA 2R9MA 2HD5A 1MS6A 3HD3A 3PBHA 1Y08A 3MJ5A 3KWBX 1F2CA 4RNAA 2ATOA 2FTDA 4OVZA 1JQPA 1KFXL
chains in the Genus database with same CATH topology
3P5UA 1EWLA 5CHTA 3BC3A 4X6JA 2AYNA 3H8CA 4YYSA 3IHPA 3BOWA 3F5VA 3C9EA 1ME4A 4C5PA 1F29A 4FK5A 1S4VA 3I3TA 4I04A 3ZUAA 3KFQA 3OF9A 2DCCA 2YJ9A 3MORA 2VFBA 1MHWA 5EGWA 2OZ2A 4QRXA 1EWMA 2NQGA 1Q6KA 3B79A 2DCDA 3CH2X 2FRAA 1POPA 3V6CA 2R9OA 3KSEA 2XU3A 1KHQA 3O1GA 2AUZA 4AXLA 1AYVA 2ARYA 1ICFA 1PPPA 3PDFA 2DJGB 1EWOA 1QDQA 2FRQA 1TU6A 4Q8HA 4N79A 1MDWA 1F2BA 2YJ8A 3K8UA 2HH5A 1NB3A 3PNRA 4YYRA 3KX1A 3N3KA 2R6NA 2Y5BA 4YYQA 3BWKA 2VHSA 3QT4A 1YVBA 3NHEA 3RVVA 3IV2A 2DZYA 3AI8A 2FYEA 2NQAA 5CHVA 4Q8GA 3LTWA 5EF4A 4WA6A 1PCIA 3IOQA 5CVNB 4PP1A 1CPJA 2AVWA 2G8EA 1NLJA 7PCKA 2P7UA 2F7DA 1NB5A 4I05A 3S3RA 2O6XA 2YJCA 3ERVA 1U5IA 5K16A 1EF7A 1CTEA 1GECE 1PPNA 4PI3A 4W5CA 1KFUL 1CV8A 5PADA 9PAPA 1CSBB 2VHFA 2E03A 3IMAA 3WXEA 4YYUA 1DEUA 1QXPA 3KKUA 1M6DA 1PXVA 3USVA 3OVZA 4BS5A 2FO5A 1ATKA 1W4TA 1AU0A 4B55A 1SP4B 4CDCB 2P86A 4N4ZA 4G54A 4MZSA 4OEMA 2H7JA 3PW3A 3LXSA 4BPVA 5CVMA 6PADA 3D9WA 1VJVA 1XKGA 3E1ZB 4BSQA 4OELA 1X9YA 3OF8A 4XR7A 1TLOA 3H7DA 2GHUA 2PREA 3BCNA 1AU3A 3M99A 4QRVA 1MEMA 1QMYA 1AYUA 3K24A 2YJBA 3WXFA 4N8WA 2C0YA 1K3BB 3QJ3A 4QH6A 4K7CA 2FT2A 2NQIA 1BY8A 3MHHA 1CS8A 1IWDA 2Y6EA 1PBHA 3LFYA 8PCHA 3CBJA 3WXGA 5J94A 2YJ2A 1KHPA 2GFOA 5JH3A 1E2TA 2PADA 3MTNA 3IUTA 1TL9A 1NL6A 1YK7A 4CDDB 3BPFA 3DF0A 1GLOA 4P6GA 2DC7A 2NQDB 3TNXA 2DZZA 4HWYA 1SNKA 3H89A 3O0UA 3GCBA 2AU1A 3P5WA 1CVZA 1F2AA 2G8JA 2AUXA 1GX3A 1KXRA 4MZOA 1O0EA 1ME3A 1YT7A 1BP4A 4PP2E 2DCBA 2G6DA 4QBBA 2XU1A 2BDZA 4NV8A 1NQCA 4PADA 3N3GA 3BPMA 4FIPA 3IEJA 3OISA 4BS6A 4NV7A 2ACTA 5CVOB 2P0RA 2BDLA 1AECA 3QSDA 2R9NA 4I07A 2AYOA 1AU4A 3KWZA 1THEA 2HHNA 1CQDA 1PADA 2E02A 3U8EA 3P5XA 2R9FA 1GMYA 4YYWA 2OULA 3H8BA 2DJFB 4DMXA 2XU5A 3V6EA 1AU2A 5A24A 1NPZA 1ZCMA 1CJLA 1FH0A 4YVAA 4W4UA 1BGOA 3CH3X 3HHIA 4CZWA 3RVWA 3H6SA 3F75A 1Y4HA 2DCAA 3KW9A 1W6FA 4W5BA 1AYWA 1HUCB 2WBFX 2JQFR 4GUZA 2IBIA 2JQGR 2AS8A 4FJCA 2DC8A 3P5VA 2VFCA 2CB5A 2OP3A 3RVXA 3K9MA 1PIPA 2FUDA 1YK8A 3HHAA 1GCBA 2HXZA 2B1MA 3OVXA 4YYVA 4RY2A 1MEGA 4CDEB 3MHSA 2FQ9A 1U9VA 2F1GA 1EWPA 4AXMA 3S3QA 1YALA 5FPWA 1MIRA 4QRGA 1U9WA 1CB5A 2E00A 1STFE 2G7YA 1AIMA 1PE6A 3N4CA 4P6EA 2PNSA 4KLBA 3I06A 4DMYA 1U9XA 2B1NA 4BQVA 4X6HA 2DC6A 4XUIA 4MSXA 1PPOA 4CDFB 4X6IA 1QOLA 4BGFA 2CIOA 2BSZA 1A6RA 3D6SA 5F02A 1ZIVA 2DC9A 4YV8A 1ITOA 2E01A 1VSNA 1W5RA 1BQIA 3HWNA 3CBKA 1U9QX 4ZUXU 2AIMA 2XU4A 2R9CA 1DF0A 1PPDA 2IPPB 5JA7A 2PBHA 2R9MA 2HD5A 1MS6A 3HD3A 3PBHA 1Y08A 3KWBX 1F2CA 2ATOA 2FTDA 1JQPA 1KFXL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P5U A;  1EWL A;  5CHT A;  3BC3 A;  4X6J A;  2AYN A;  3H8C A;  4YYS A;  3IHP A;  3BOW A;  3F5V A;  3C9E A;  1ME4 A;  1F29 A;  4FK5 A;  1S4V A;  3I3T A;  4I04 A;  3ZUA A;  3KFQ A;  3OF9 A;  2DCC A;  2YJ9 A;  3MOR A;  1MHW A;  5EGW A;  2OZ2 A;  4QRX A;  1EWM A;  2NQG A;  1Q6K A;  3B79 A;  2DCD A;  3CH2 X;  2FRA A;  1POP A;  3V6C A;  2R9O A;  3KSE A;  2XU3 A;  1KHQ A;  3O1G A;  2AUZ A;  4AXL A;  1AYV A;  2ARY A;  1ICF A;  1PPP A;  3PDF A;  2DJG B;  1EWO A;  1QDQ A;  2FRQ A;  1TU6 A;  4Q8H A;  4N79 A;  1MDW A;  1F2B A;  2YJ8 A;  3K8U A;  2HH5 A;  1NB3 A;  3PNR A;  4YYR A;  3KX1 A;  3N3K A;  2R6N A;  2Y5B A;  4YYQ A;  3BWK A;  2VHS A;  3QT4 A;  1YVB A;  3NHE A;  3RVV A;  3IV2 A;  2DZY A;  3AI8 A;  2FYE A;  2NQA A;  5CHV A;  4Q8G A;  5EF4 A;  4WA6 A;  1PCI A;  3IOQ A;  5CVN B;  4PP1 A;  1CPJ A;  2AVW A;  2G8E A;  1NLJ A;  7PCK A;  2P7U A;  2F7D A;  1NB5 A;  4I05 A;  3S3R A;  2O6X A;  2YJC A;  3ERV A;  1U5I A;  5K16 A;  1EF7 A;  1CTE A;  1GEC E;  1PPN A;  4PI3 A;  4W5C A;  1KFU L;  1CV8 A;  5PAD A;  9PAP A;  1CSB B;  2VHF A;  2E03 A;  3IMA A;  3WXE A;  4YYU A;  1DEU A;  1QXP A;  3KKU A;  1M6D A;  1PXV A;  3USV A;  3OVZ A;  4BS5 A;  2FO5 A;  1ATK A;  1AU0 A;  1SP4 B;  4CDC B;  2P86 A;  4N4Z A;  4G54 A;  4MZS A;  4OEM A;  2H7J A;  3PW3 A;  3LXS A;  4BPV A;  5CVM A;  6PAD A;  1VJV A;  1XKG A;  3E1Z B;  4BSQ A;  4OEL A;  1X9Y A;  3OF8 A;  4XR7 A;  1TLO A;  3H7D A;  2GHU A;  2PRE A;  3BCN A;  1AU3 A;  3M99 A;  4QRV A;  1MEM A;  1QMY A;  1AYU A;  3K24 A;  2YJB A;  3WXF A;  4N8W A;  2C0Y A;  1K3B B;  3QJ3 A;  4QH6 A;  4K7C A;  2FT2 A;  2NQI A;  1BY8 A;  3MHH A;  1CS8 A;  1IWD A;  2Y6E A;  1PBH A;  3LFY A;  8PCH A;  3CBJ A;  3WXG A;  5J94 A;  2YJ2 A;  1KHP A;  2GFO A;  5JH3 A;  2PAD A;  3MTN A;  3IUT A;  1TL9 A;  1NL6 A;  1YK7 A;  4CDD B;  3BPF A;  3DF0 A;  1GLO A;  4P6G A;  2DC7 A;  2NQD B;  3TNX A;  2DZZ A;  4HWY A;  1SNK A;  3H89 A;  3O0U A;  3GCB A;  2AU1 A;  3P5W A;  1CVZ A;  1F2A A;  2G8J A;  2AUX A;  1KXR A;  4MZO A;  1O0E A;  1ME3 A;  1YT7 A;  1BP4 A;  4PP2 E;  2DCB A;  2G6D A;  4QBB A;  2XU1 A;  2BDZ A;  1NQC A;  4PAD A;  3N3G A;  3BPM A;  4FIP A;  3IEJ A;  3OIS A;  4BS6 A;  2ACT A;  5CVO B;  2P0R A;  2BDL A;  1AEC A;  3QSD A;  2R9N A;  4I07 A;  2AYO A;  1AU4 A;  3KWZ A;  1THE A;  2HHN A;  1CQD A;  1PAD A;  2E02 A;  3U8E A;  3P5X A;  2R9F A;  1GMY A;  4YYW A;  2OUL A;  3H8B A;  2DJF B;  4DMX A;  2XU5 A;  3V6E A;  1AU2 A;  5A24 A;  1NPZ A;  1ZCM A;  1CJL A;  1FH0 A;  4YVA A;  4W4U A;  1BGO A;  3CH3 X;  3HHI A;  4CZW A;  3RVW A;  3H6S A;  3F75 A;  1Y4H A;  2DCA A;  3KW9 A;  4W5B A;  1AYW A;  1HUC B;  2WBF X;  2JQF R;  2IBI A;  2JQG R;  2AS8 A;  4FJC A;  2DC8 A;  3P5V A;  2CB5 A;  2OP3 A;  3RVX A;  3K9M A;  1PIP A;  2FUD A;  1YK8 A;  3HHA A;  1GCB A;  2HXZ A;  2B1M A;  3OVX A;  4YYV A;  4RY2 A;  1MEG A;  4CDE B;  3MHS A;  2FQ9 A;  1U9V A;  2F1G A;  1EWP A;  4AXM A;  3S3Q A;  1YAL A;  5FPW A;  1MIR A;  4QRG A;  1U9W A;  1CB5 A;  2E00 A;  1STF E;  2G7Y A;  1AIM A;  1PE6 A;  3N4C A;  4P6E A;  2PNS A;  4KLB A;  3I06 A;  4DMY A;  1U9X A;  2B1N A;  4BQV A;  4X6H A;  2DC6 A;  4XUI A;  4MSX A;  1PPO A;  4CDF B;  4X6I A;  1QOL A;  2CIO A;  5F02 A;  1A6R A;  3D6S A;  1ZIV A;  2DC9 A;  4YV8 A;  1ITO A;  2E01 A;  1VSN A;  1BQI A;  3HWN A;  3CBK A;  1U9Q X;  4ZUX U;  2AIM A;  2XU4 A;  2R9C A;  1DF0 A;  1PPD A;  2IPP B;  5JA7 A;  2PBH A;  2R9M A;  2HD5 A;  1MS6 A;  3HD3 A;  3PBH A;  1Y08 A;  3KWB X;  1F2C A;  2ATO A;  2FTD A;  1JQP A;  1KFX L; 
#chains in the Genus database with same CATH topology
 3P5U A;  1EWL A;  5CHT A;  3BC3 A;  4X6J A;  2AYN A;  3H8C A;  4YYS A;  3IHP A;  3BOW A;  3F5V A;  3C9E A;  1ME4 A;  1F29 A;  4FK5 A;  1S4V A;  3I3T A;  4I04 A;  4BOS A;  3ZUA A;  3KFQ A;  3OF9 A;  2DCC A;  3MTV A;  2YJ9 A;  4ZTB A;  3MOR A;  1MHW A;  5EGW A;  2OZ2 A;  4QRX A;  1EWM A;  2NQG A;  3TRK A;  1Q6K A;  3B79 A;  2DCD A;  3CH2 X;  2FRA A;  1POP A;  3V6C A;  4GUA A;  2R9O A;  3KSE A;  2XU3 A;  1KHQ A;  3O1G A;  2AUZ A;  4AXL A;  1AYV A;  1YZB A;  1ICF A;  1PPP A;  2ARY A;  3PDF A;  2DJG B;  1EWO A;  1QDQ A;  2FRQ A;  1TU6 A;  4Q8H A;  4N79 A;  1MDW A;  1F2B A;  2Z84 A;  2YJ8 A;  3K8U A;  2HH5 A;  3PRP A;  1NB3 A;  3PNR A;  4YYR A;  3KX1 A;  3N3K A;  2R6N A;  2Y5B A;  4YYQ A;  3OQC A;  4OW0 A;  3BWK A;  2VHS A;  3QT4 A;  1YVB A;  3NHE A;  3RVV A;  3IV2 A;  2DZY A;  3AI8 A;  2FYE A;  2NQA A;  5CHV A;  4Q8G A;  5EF4 A;  4WA6 A;  1PCI A;  3IOQ A;  5CVN B;  4PP1 A;  1CPJ A;  4WUR A;  2AVW A;  2G8E A;  1NLJ A;  7PCK A;  2P7U A;  2F7D A;  1NB5 A;  4I05 A;  1DKI A;  3S3R A;  2O6X A;  2YJC A;  3ERV A;  4D8E A;  3C0R A;  4MI7 A;  1U5I A;  5K16 A;  1EF7 A;  1CTE A;  1GEC E;  1PPN A;  4PI3 A;  4W5C A;  1KFU L;  1CV8 A;  5PAD A;  9PAP A;  1CSB B;  2VHF A;  2E03 A;  3IMA A;  3WXE A;  1UKF A;  4YYU A;  3B21 A;  1DEU A;  1QXP A;  3KKU A;  1M6D A;  5JZE A;  1PXV A;  3USV A;  3OVZ A;  4BS5 A;  2FO5 A;  1ATK A;  5E6J A;  2J7Q A;  1AU0 A;  1SP4 B;  4CDC B;  4D8B A;  2P86 A;  4N4Z A;  4G54 A;  4MZS A;  4OEM A;  2H7J A;  2DOS A;  3BB7 A;  3PW3 A;  3LXS A;  4BPV A;  5CVM A;  6PAD A;  1VJV A;  1XKG A;  2J7Q C;  3E1Z B;  4BSQ A;  4RF1 A;  4OEL A;  3PSE A;  1X9Y A;  3OF8 A;  4XR7 A;  1TLO A;  2JRI A;  3H7D A;  2GHU A;  2PRE A;  3BCN A;  1AU3 A;  3M99 A;  4QRV A;  1MEM A;  1QMY A;  1AYU A;  3K24 A;  4BOZ A;  2YJB A;  3WXF A;  4N8W A;  2C0Y A;  1K3B B;  3QJ3 A;  4QH6 A;  4BOQ A;  4K7C A;  1PVJ A;  2FT2 A;  2NQI A;  1BY8 A;  3MHH A;  1CS8 A;  1IWD A;  2Y6E A;  1PBH A;  3LFY A;  8PCH A;  2BTW A;  3CBJ A;  3WXG A;  5J94 A;  2YJ2 A;  1KHP A;  2GFO A;  5JH3 A;  2PAD A;  4IP3 A;  3MTN A;  3IUT A;  1TL9 A;  1NL6 A;  2BTW B;  1YK7 A;  4CDD B;  3BPF A;  3DF0 A;  1GLO A;  2BU3 A;  3BY4 A;  4P6G A;  2FE8 A;  2DC7 A;  5EZS A;  2NQD B;  3TNX A;  2DZZ A;  4HWY A;  1SNK A;  3H89 A;  3O0U A;  3GCB A;  2JTC A;  2AU1 A;  3P5W A;  1CVZ A;  1F2A A;  2G8J A;  2AUX A;  1KXR A;  4MZO A;  1O0E A;  1ME3 A;  1YT7 A;  1BP4 A;  4MM3 B;  4PP2 E;  2DCB A;  2G6D A;  4QBB A;  2XU1 A;  2BDZ A;  1NQC A;  4PAD A;  3N3G A;  4BOU A;  3BPM A;  3IFU A;  4FIP A;  3IEJ A;  3OIS A;  4BS6 A;  2ACT A;  3PHX A;  2P0R A;  2BDL A;  5CVO B;  4D8I A;  1AEC A;  3QSD A;  2R9N A;  4P16 A;  4I07 A;  2AYO A;  1AU4 A;  3KWZ A;  1THE A;  2HHN A;  1CQD A;  3W30 A;  3O65 A;  1PAD A;  2E02 A;  3U8E A;  3P5X A;  3PRM A;  4R3D A;  2R9F A;  1GMY A;  2UZJ A;  4YYW A;  2OUL A;  3H8B A;  2DJF B;  4DMX A;  2XU5 A;  3V6E A;  3W31 A;  1AU2 A;  5A24 A;  1NPZ A;  1ZCM A;  1CJL A;  1FH0 A;  4YVA A;  4W4U A;  4PT5 A;  1BGO A;  4REZ A;  3CH3 X;  4M0W A;  3HHI A;  4CZW A;  3RVW A;  3H6S A;  3F75 A;  1Y4H A;  2DCA A;  4IUM A;  3KW9 A;  2HWK A;  4W5B A;  3MP2 A;  1AYW A;  5EZQ A;  1HUC B;  3PHU A;  2WBF X;  3PT2 A;  2JQF R;  2IBI A;  2JQG R;  2AS8 A;  4FJC A;  2DC8 A;  4BOP A;  3P5V A;  3E9S A;  2CB5 A;  2OP3 A;  3RVX A;  3K9M A;  1PIP A;  2FUD A;  1YK8 A;  3HHA A;  1GCB A;  2HXZ A;  2B1M A;  3OVX A;  4YYV A;  4RY2 A;  1MEG A;  4CDE B;  3MHS A;  2FQ9 A;  1U9V A;  2F1G A;  1EWP A;  4AXM A;  3PHW A;  3S3Q A;  1YAL A;  5FPW A;  1MIR A;  4OVZ B;  4XZX A;  4RF0 A;  4QRG A;  1U9W A;  1CB5 A;  2E00 A;  1STF E;  2G7Y A;  1AIM A;  1PE6 A;  4HXD B;  3N4C A;  4P6E A;  2PNS A;  4KLB A;  3I06 A;  4DMY A;  3ZNH A;  1U9X A;  4A5U A;  2B1N A;  4BQV A;  4X6H A;  2DC6 A;  4XUI A;  4MSX A;  3TMP A;  1PPO A;  4CDF B;  4X6I A;  1QOL A;  2CIO A;  5F02 A;  1A6R A;  3D6S A;  1ZIV A;  2DC9 A;  4YV8 A;  2AGA A;  1ITO A;  2E01 A;  1VSN A;  1BQI A;  3HWN A;  3CBK A;  1U9Q X;  4RKX A;  4ZUX U;  2AIM A;  3BBA A;  2XU4 A;  2R9C A;  5KO3 A;  3RNV A;  1DF0 A;  1PPD A;  2IPP B;  5JA7 A;  2PBH A;  2R9M A;  2HD5 A;  1MS6 A;  3HD3 A;  3PBH A;  1Y08 A;  3MJ5 A;  3KWB X;  1F2C A;  4RNA A;  2ATO A;  2FTD A;  4OVZ A;  1JQP A;  1KFX L; 
#chains in the Genus database with same CATH homology
 3P5U A;  1EWL A;  5CHT A;  3BC3 A;  4X6J A;  2AYN A;  3H8C A;  4YYS A;  3IHP A;  3BOW A;  3F5V A;  3C9E A;  1ME4 A;  4C5P A;  1F29 A;  4FK5 A;  1S4V A;  3I3T A;  4I04 A;  3ZUA A;  3KFQ A;  3OF9 A;  2DCC A;  2YJ9 A;  3MOR A;  2VFB A;  1MHW A;  5EGW A;  2OZ2 A;  4QRX A;  1EWM A;  2NQG A;  1Q6K A;  3B79 A;  2DCD A;  3CH2 X;  2FRA A;  1POP A;  3V6C A;  2R9O A;  3KSE A;  2XU3 A;  1KHQ A;  3O1G A;  2AUZ A;  4AXL A;  1AYV A;  2ARY A;  1ICF A;  1PPP A;  3PDF A;  2DJG B;  1EWO A;  1QDQ A;  2FRQ A;  1TU6 A;  4Q8H A;  4N79 A;  1MDW A;  1F2B A;  2YJ8 A;  3K8U A;  2HH5 A;  1NB3 A;  3PNR A;  4YYR A;  3KX1 A;  3N3K A;  2R6N A;  2Y5B A;  4YYQ A;  3BWK A;  2VHS A;  3QT4 A;  1YVB A;  3NHE A;  3RVV A;  3IV2 A;  2DZY A;  3AI8 A;  2FYE A;  2NQA A;  5CHV A;  4Q8G A;  3LTW A;  5EF4 A;  4WA6 A;  1PCI A;  3IOQ A;  5CVN B;  4PP1 A;  1CPJ A;  2AVW A;  2G8E A;  1NLJ A;  7PCK A;  2P7U A;  2F7D A;  1NB5 A;  4I05 A;  3S3R A;  2O6X A;  2YJC A;  3ERV A;  1U5I A;  5K16 A;  1EF7 A;  1CTE A;  1GEC E;  1PPN A;  4PI3 A;  4W5C A;  1KFU L;  1CV8 A;  5PAD A;  9PAP A;  1CSB B;  2VHF A;  2E03 A;  3IMA A;  3WXE A;  4YYU A;  1DEU A;  1QXP A;  3KKU A;  1M6D A;  1PXV A;  3USV A;  3OVZ A;  4BS5 A;  2FO5 A;  1ATK A;  1W4T A;  1AU0 A;  4B55 A;  1SP4 B;  4CDC B;  2P86 A;  4N4Z A;  4G54 A;  4MZS A;  4OEM A;  2H7J A;  3PW3 A;  3LXS A;  4BPV A;  5CVM A;  6PAD A;  3D9W A;  1VJV A;  1XKG A;  3E1Z B;  4BSQ A;  4OEL A;  1X9Y A;  3OF8 A;  4XR7 A;  1TLO A;  3H7D A;  2GHU A;  2PRE A;  3BCN A;  1AU3 A;  3M99 A;  4QRV A;  1MEM A;  1QMY A;  1AYU A;  3K24 A;  2YJB A;  3WXF A;  4N8W A;  2C0Y A;  1K3B B;  3QJ3 A;  4QH6 A;  4K7C A;  2FT2 A;  2NQI A;  1BY8 A;  3MHH A;  1CS8 A;  1IWD A;  2Y6E A;  1PBH A;  3LFY A;  8PCH A;  3CBJ A;  3WXG A;  5J94 A;  2YJ2 A;  1KHP A;  2GFO A;  5JH3 A;  1E2T A;  2PAD A;  3MTN A;  3IUT A;  1TL9 A;  1NL6 A;  1YK7 A;  4CDD B;  3BPF A;  3DF0 A;  1GLO A;  4P6G A;  2DC7 A;  2NQD B;  3TNX A;  2DZZ A;  4HWY A;  1SNK A;  3H89 A;  3O0U A;  3GCB A;  2AU1 A;  3P5W A;  1CVZ A;  1F2A A;  2G8J A;  2AUX A;  1GX3 A;  1KXR A;  4MZO A;  1O0E A;  1ME3 A;  1YT7 A;  1BP4 A;  4PP2 E;  2DCB A;  2G6D A;  4QBB A;  2XU1 A;  2BDZ A;  4NV8 A;  1NQC A;  4PAD A;  3N3G A;  3BPM A;  4FIP A;  3IEJ A;  3OIS A;  4BS6 A;  4NV7 A;  2ACT A;  5CVO B;  2P0R A;  2BDL A;  1AEC A;  3QSD A;  2R9N A;  4I07 A;  2AYO A;  1AU4 A;  3KWZ A;  1THE A;  2HHN A;  1CQD A;  1PAD A;  2E02 A;  3U8E A;  3P5X A;  2R9F A;  1GMY A;  4YYW A;  2OUL A;  3H8B A;  2DJF B;  4DMX A;  2XU5 A;  3V6E A;  1AU2 A;  5A24 A;  1NPZ A;  1ZCM A;  1CJL A;  1FH0 A;  4YVA A;  4W4U A;  1BGO A;  3CH3 X;  3HHI A;  4CZW A;  3RVW A;  3H6S A;  3F75 A;  1Y4H A;  2DCA A;  3KW9 A;  1W6F A;  4W5B A;  1AYW A;  1HUC B;  2WBF X;  2JQF R;  4GUZ A;  2IBI A;  2JQG R;  2AS8 A;  4FJC A;  2DC8 A;  3P5V A;  2VFC A;  2CB5 A;  2OP3 A;  3RVX A;  3K9M A;  1PIP A;  2FUD A;  1YK8 A;  3HHA A;  1GCB A;  2HXZ A;  2B1M A;  3OVX A;  4YYV A;  4RY2 A;  1MEG A;  4CDE B;  3MHS A;  2FQ9 A;  1U9V A;  2F1G A;  1EWP A;  4AXM A;  3S3Q A;  1YAL A;  5FPW A;  1MIR A;  4QRG A;  1U9W A;  1CB5 A;  2E00 A;  1STF E;  2G7Y A;  1AIM A;  1PE6 A;  3N4C A;  4P6E A;  2PNS A;  4KLB A;  3I06 A;  4DMY A;  1U9X A;  2B1N A;  4BQV A;  4X6H A;  2DC6 A;  4XUI A;  4MSX A;  1PPO A;  4CDF B;  4X6I A;  1QOL A;  4BGF A;  2CIO A;  2BSZ A;  1A6R A;  3D6S A;  5F02 A;  1ZIV A;  2DC9 A;  4YV8 A;  1ITO A;  2E01 A;  1VSN A;  1W5R A;  1BQI A;  3HWN A;  3CBK A;  1U9Q X;  4ZUX U;  2AIM A;  2XU4 A;  2R9C A;  1DF0 A;  1PPD A;  2IPP B;  5JA7 A;  2PBH A;  2R9M A;  2HD5 A;  1MS6 A;  3HD3 A;  3PBH A;  1Y08 A;  3KWB X;  1F2C A;  2ATO A;  2FTD A;  1JQP A;  1KFX L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...