4N8WA

Cathepsin k - chondroitin sulfate complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
213
structure length
213
Chain Sequence
DSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title Structural basis of collagen fiber degradation by cathepsin K.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 66
structure length 213
sequence length 213
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2013-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4n8wA00
2OULA 5JA7A 2Y6EA 4Q8GA 2R6NA 1ICFA 4OEMA 1KXRA 1PPDA 2R9NA 3U8EA 4P6EA 3H89A 3MHHA 2AIMA 2XU4A 3N4CA 4DMYA 3CH3X 1AU4A 4BS5A 4YYQA 4W5CA 1CVZA 3HWNA 5CVNB 2PNSA 3P5XA 2H7JA 1U9WA 3F75A 4BPVA 3H7DA 9PAPA 1AU0A 1DF0A 4FJCA 2FRAA 2P86A 2DCBA 1Q6KA 1U9QX 4X6HA 3WXFA 2DC9A 2XU1A 1PPPA 3KFQA 2G6DA 2FO5A 1NB5A 1JQPA 1MIRA 1CTEA 1EWOA 1QXPA 4PI3A 2G8JA 3IHPA 4HWYA 3BOWA 2AU1A 4YYSA 1F2CA 2DJGB 1IWDA 2C0YA 2GFOA 2FUDA 4BQVA 4CZWA 2Y5BA 2YJBA 4MSXA 4CDFB 8PCHA 1MDWA 4N8WA 3OISA 3S3RA 4MZOA 1ZCMA 3QJ3A 4RY2A 4I07A 1A6RA 3GCBA 3OVZA 2CIOA 5CHVA 1FH0A 2IPPB 4QBBA 1YVBA 2AYNA 1NPZA 2FYEA 2G8EA 2DZZA 1EWMA 2R9CA 3KKUA 3F5VA 4OELA 3I3TA 2HXZA 1M6DA 1MEGA 3P5UA 1TL9A 1F29A 1F2AA 3WXEA 2R9MA 1PPOA 3M99A 4YYVA 1BGOA 5EF4A 1CB5A 3USVA 1YALA 5EGWA 3IOQA 4QRGA 4BS6A 3H8BA 1YT7A 1CQDA 2AS8A 4W4UA 3WXGA 7PCKA 4PP2E 4YVAA 1PXVA 1PPNA 4ZUXU 1TU6A 3LXSA 4CDEB 2F1GA 2HD5A 2FRQA 1SP4B 1XKGA 2JQGR 1GMYA 3LFYA 3TNXA 2BDLA 5JH3A 1S4VA 1Y08A 3P5WA 1BP4A 3IUTA 3S3QA 4YYRA 3PBHA 2G7YA 1PIPA 1ME4A 2BDZA 4QRVA 3BPFA 1KFUL 3QSDA 4KLBA 2OP3A 1YK7A 4XUIA 1ITOA 2HH5A 4I04A 2FTDA 2R9OA 3O0UA 1MHWA 2GHUA 4AXMA 3PDFA 1ATKA 1NLJA 2NQDB 2YJ8A 4YYWA 3I06A 1KFXL 1CV8A 4X6IA 1F2BA 1CPJA 3E1ZB 1PE6A 2YJ9A 4QRXA 2OZ2A 3V6CA 4MZSA 1CJLA 3K9MA 1PADA 1AIMA 2ATOA 1U5IA 3O1GA 1YK8A 1ME3A 5J94A 2E03A 5A24A 3K8UA 4CDCB 1BY8A 1POPA 3H8CA 4P6GA 4YV8A 2O6XA 1SNKA 3N3GA 3DF0A 2XU5A 1AYUA 2IBIA 2AVWA 2DC8A 3V6EA 4BSQA 2AYOA 1GCBA 3MHSA 3RVVA 3N3KA 1MS6A 1VSNA 2VHSA 4G54A 3CBKA 1VJVA 3ERVA 3CH2X 1KHQA 5F02A 3BWKA 2AUXA 1QDQA 5CVMA 4FK5A 2E01A 3IMAA 2PADA 2WBFX 1TLOA 3RVXA 4XR7A 3KW9A 2NQIA 3HD3A 3KWBX 1X9YA 1AYWA 2ACTA 2YJ2A 4QH6A 3K24A 2P7UA 3MTNA 4DMXA 3OF8A 1QOLA 2F7DA 5PADA 5CVOB 3BCNA 1EWLA 2DCDA 1AU2A 3RVWA 1MEMA 1Y4HA 1THEA 2DJFB 2JQFR 3C9EA 3OF9A 2PREA 3KSEA 2DCAA 3NHEA 1GECE 1AYVA 3H6SA 3ZUAA 2NQGA 1PCIA 2ARYA 2AUZA 2DCCA 3P5VA 4PADA 1U9VA 1AU3A 2R9FA 2E02A 4WA6A 4X6JA 2CB5A 3HHIA 1K3BB 5CHTA 2XU3A 1NB3A 6PADA 1BQIA 1DEUA 2B1MA 1O0EA 4FIPA 3KX1A 1ZIVA 1U9XA 2B1NA 1AECA 4CDDB 3CBJA 3KWZA 3PW3A 3BC3A 3PNRA 3D6SA 1STFE 1CSBB 1EF7A 1CS8A 2PBHA 5FPWA 4K7CA 1EWPA 3BPMA 2VHFA 2FT2A 5K16A 3IEJA 3MORA 1PBHA 1HUCB 1QMYA 1GLOA 2HHNA 2FQ9A 2P0RA 1NL6A 3QT4A 4W5BA 4I05A 2YJCA 1KHPA 3HHAA 4PP1A 2DC6A 3AI8A 4N79A 2DZYA 3OVXA 2DC7A 1NQCA 2NQAA 4YYUA 4N4ZA 2E00A 4Q8HA 4AXLA 3IV2A 3B79A
chains in the Genus database with same CATH superfamily
2OULA 5JA7A 2Y6EA 3E9SA 4Q8GA 2R6NA 1ICFA 4OEMA 1KXRA 1PPDA 2R9NA 3U8EA 4IP3A 2Z84A 4P6EA 3H89A 3MHHA 2AIMA 2XU4A 3N4CA 3RNVA 4DMYA 3CH3X 4BOQA 1AU4A 4BS5A 4BOSA 4YYQA 4W5CA 1CVZA 3HWNA 5CVNB 4RF1A 2PNSA 3P5XA 2H7JA 1U9WA 3F75A 4BPVA 3H7DA 3MJ5A 9PAPA 1AU0A 1DF0A 5EZSA 4FJCA 2FRAA 2P86A 1DKIA 2BTWA 2DCBA 1Q6KA 4GUAA 4OVZA 1U9QX 4X6HA 3WXFA 2DC9A 2XU1A 1PPPA 3C0RA 3KFQA 2G6DA 4IUMA 2FO5A 1NB5A 1JQPA 1MIRA 1CTEA 1EWOA 1QXPA 4PI3A 2G8JA 3IHPA 4HWYA 3BOWA 4R3DA 2AU1A 4YYSA 4D8IA 1F2CA 2DJGB 1IWDA 2C0YA 2GFOA 2FUDA 4BQVA 4CZWA 2Y5BA 2YJBA 4MSXA 4CDFB 8PCHA 1MDWA 4N8WA 3OISA 3S3RA 4MZOA 1ZCMA 3MP2A 3QJ3A 4RY2A 4I07A 1A6RA 2J7QC 3GCBA 3OVZA 2CIOA 5CHVA 1FH0A 1UKFA 2IPPB 4QBBA 3OQCA 1YVBA 4RF0A 2AYNA 1NPZA 4M0WA 2FYEA 2G8EA 2DZZA 1EWMA 2R9CA 3KKUA 3BY4A 3F5VA 4OELA 3I3TA 2HXZA 1M6DA 1MEGA 3P5UA 2DOSA 1TL9A 1F29A 1F2AA 3WXEA 2R9MA 1PPOA 3M99A 4YYVA 1BGOA 5EF4A 1CB5A 3PHWA 3USVA 1YALA 5EGWA 3IOQA 4QRGA 4BS6A 3H8BA 4MI7A 1PVJA 1YT7A 1CQDA 1YZBA 2AS8A 4WURA 4W4UA 3PT2A 3WXGA 5KO3A 5E6JA 7PCKA 4PP2E 4HXDB 4YVAA 1PXVA 1PPNA 4ZUXU 1TU6A 3LXSA 4RKXA 4CDEB 2F1GA 4MM3B 2HD5A 2FRQA 1SP4B 1XKGA 2JQGR 1GMYA 3LFYA 3TNXA 2BDLA 5JH3A 1S4VA 1Y08A 4D8BA 3P5WA 1BP4A 3IUTA 3S3QA 4YYRA 3PBHA 2G7YA 1PIPA 3MTVA 3PHUA 1ME4A 2BDZA 4P16A 4QRVA 3BPFA 1KFUL 3QSDA 4KLBA 2OP3A 1YK7A 4XUIA 1ITOA 2HH5A 4I04A 3W31A 2BTWB 2FTDA 4OVZB 2R9OA 3O0UA 4REZA 1MHWA 2GHUA 4AXMA 3ZNHA 3PDFA 1ATKA 1NLJA 2NQDB 2YJ8A 4YYWA 3I06A 1KFXL 4ZTBA 3O65A 1CV8A 5JZEA 4PT5A 4X6IA 1F2BA 2JTCA 1CPJA 3E1ZB 1PE6A 2YJ9A 4QRXA 2OZ2A 3V6CA 4MZSA 1CJLA 3K9MA 1PADA 4D8EA 1AIMA 2ATOA 1U5IA 3O1GA 3TRKA 1YK8A 1ME3A 5J94A 4RNAA 2E03A 5A24A 3K8UA 4CDCB 1BY8A 1POPA 3H8CA 2BU3A 4P6GA 4YV8A 2O6XA 1SNKA 3PHXA 3B21A 3N3GA 3DF0A 2XU5A 1AYUA 2IBIA 2JRIA 2AVWA 2DC8A 3V6EA 4BSQA 2AYOA 1GCBA 3MHSA 3RVVA 3N3KA 1MS6A 3TMPA 1VSNA 2VHSA 4G54A 3CBKA 1VJVA 3ERVA 3CH2X 1KHQA 5F02A 3BWKA 4BOZA 2AUXA 1QDQA 5CVMA 4FK5A 2E01A 3IMAA 2PADA 2WBFX 1TLOA 3RVXA 4XR7A 3KW9A 2NQIA 3HD3A 3KWBX 1X9YA 1AYWA 2ACTA 2YJ2A 4QH6A 3K24A 2P7UA 3MTNA 4DMXA 3OF8A 1QOLA 2F7DA 4OW0A 5PADA 5CVOB 2J7QA 3BCNA 1EWLA 2DCDA 1AU2A 3RVWA 4XZXA 1MEMA 1Y4HA 2UZJA 3PRMA 1THEA 2DJFB 2JQFR 3C9EA 3OF9A 2PREA 3KSEA 3PSEA 2DCAA 3NHEA 1GECE 3W30A 1AYVA 3H6SA 3ZUAA 2NQGA 1PCIA 2ARYA 2AUZA 2DCCA 3IFUA 3P5VA 4PADA 1U9VA 1AU3A 2R9FA 2E02A 4WA6A 4X6JA 2CB5A 3HHIA 2FE8A 1K3BB 5CHTA 2XU3A 2AGAA 1NB3A 3BB7A 6PADA 1BQIA 1DEUA 2B1MA 1O0EA 4FIPA 3KX1A 1ZIVA 1U9XA 2B1NA 1AECA 2HWKA 4CDDB 4A5UA 3CBJA 3KWZA 3PW3A 3BC3A 3PNRA 3D6SA 1STFE 1CSBB 1EF7A 1CS8A 2PBHA 5FPWA 4K7CA 5EZQA 1EWPA 3BPMA 2VHFA 2FT2A 5K16A 3IEJA 3MORA 1PBHA 1HUCB 1QMYA 4BOPA 1GLOA 2HHNA 2FQ9A 2P0RA 1NL6A 3QT4A 4W5BA 4I05A 2YJCA 1KHPA 4BOUA 3HHAA 4PP1A 2DC6A 3AI8A 4N79A 2DZYA 3OVXA 3PRPA 2DC7A 1NQCA 2NQAA 4YYUA 4N4ZA 2E00A 4Q8HA 3BBAA 4AXLA 3IV2A 3B79A
chains in the Genus database with same CATH topology
2OULA 5JA7A 2Y6EA 4Q8GA 2R6NA 1ICFA 4OEMA 1KXRA 1PPDA 2R9NA 3U8EA 4P6EA 3H89A 3MHHA 2AIMA 2XU4A 3N4CA 4DMYA 3CH3X 1AU4A 3LTWA 4BS5A 4YYQA 4NV8A 4W5CA 1CVZA 3HWNA 5CVNB 2PNSA 3P5XA 2H7JA 1U9WA 3F75A 4BPVA 3H7DA 9PAPA 1AU0A 1DF0A 4FJCA 2FRAA 2P86A 2DCBA 1Q6KA 1U9QX 4X6HA 3WXFA 2DC9A 2XU1A 1PPPA 3KFQA 2G6DA 2FO5A 1NB5A 1JQPA 1MIRA 1CTEA 1EWOA 1QXPA 4PI3A 2G8JA 3IHPA 4HWYA 3BOWA 2AU1A 4YYSA 1F2CA 2DJGB 1IWDA 2C0YA 2GFOA 2FUDA 4BQVA 4CZWA 2Y5BA 2YJBA 4MSXA 4CDFB 8PCHA 1MDWA 4N8WA 3OISA 3S3RA 4MZOA 1ZCMA 3QJ3A 4RY2A 4I07A 1A6RA 3GCBA 3OVZA 2CIOA 5CHVA 1FH0A 2BSZA 2IPPB 4QBBA 1YVBA 2AYNA 1NPZA 2FYEA 2G8EA 2DZZA 1EWMA 2R9CA 3KKUA 3F5VA 4OELA 3I3TA 2HXZA 1M6DA 1MEGA 3P5UA 1E2TA 1TL9A 1F29A 1F2AA 3WXEA 2R9MA 1PPOA 3M99A 4YYVA 1BGOA 5EF4A 1CB5A 3USVA 1YALA 5EGWA 3IOQA 4QRGA 4BS6A 3H8BA 1YT7A 1CQDA 2AS8A 4W4UA 3WXGA 7PCKA 4PP2E 4YVAA 1PXVA 1PPNA 4ZUXU 1TU6A 3LXSA 4CDEB 2F1GA 2HD5A 2FRQA 1SP4B 1XKGA 2JQGR 1GMYA 3LFYA 3TNXA 2BDLA 5JH3A 1S4VA 1Y08A 3P5WA 1BP4A 3IUTA 3S3QA 4YYRA 3PBHA 2G7YA 1PIPA 1ME4A 2BDZA 4QRVA 3BPFA 1GX3A 1KFUL 3QSDA 4KLBA 2OP3A 1YK7A 4XUIA 1ITOA 2HH5A 4I04A 2FTDA 2R9OA 3O0UA 1MHWA 2GHUA 4AXMA 3PDFA 1ATKA 1NLJA 2NQDB 2YJ8A 4YYWA 3I06A 1KFXL 4C5PA 1CV8A 4BGFA 4GUZA 4X6IA 1F2BA 1CPJA 3E1ZB 1PE6A 2YJ9A 4QRXA 2OZ2A 3V6CA 4MZSA 1CJLA 3K9MA 1PADA 1AIMA 2ATOA 1U5IA 3O1GA 1YK8A 1ME3A 5J94A 2E03A 5A24A 3K8UA 4CDCB 1BY8A 1POPA 3H8CA 1W5RA 4P6GA 4YV8A 2O6XA 1SNKA 3N3GA 3DF0A 2XU5A 1AYUA 2IBIA 2AVWA 2DC8A 3V6EA 4BSQA 2AYOA 3D9WA 1GCBA 3MHSA 3RVVA 3N3KA 1MS6A 1VSNA 2VFCA 2VHSA 4G54A 3CBKA 1VJVA 3ERVA 3CH2X 1KHQA 5F02A 3BWKA 2AUXA 1QDQA 5CVMA 4FK5A 2E01A 3IMAA 2PADA 2WBFX 1TLOA 3RVXA 4XR7A 3KW9A 2NQIA 3HD3A 3KWBX 1X9YA 1AYWA 2ACTA 2YJ2A 4QH6A 3K24A 2P7UA 3MTNA 4DMXA 3OF8A 1QOLA 2F7DA 5PADA 5CVOB 3BCNA 1EWLA 2DCDA 2VFBA 1AU2A 3RVWA 1MEMA 1Y4HA 1THEA 2DJFB 2JQFR 3C9EA 3OF9A 2PREA 3KSEA 2DCAA 3NHEA 1GECE 1AYVA 3H6SA 3ZUAA 2NQGA 1PCIA 2ARYA 2AUZA 2DCCA 3P5VA 4PADA 1U9VA 1AU3A 2R9FA 2E02A 4WA6A 4X6JA 2CB5A 3HHIA 1K3BB 5CHTA 2XU3A 1NB3A 6PADA 1BQIA 1DEUA 2B1MA 1O0EA 4FIPA 3KX1A 1ZIVA 1U9XA 2B1NA 1AECA 4CDDB 4NV7A 3CBJA 3KWZA 3PW3A 3BC3A 3PNRA 3D6SA 1STFE 1CSBB 1EF7A 1W4TA 1CS8A 2PBHA 5FPWA 4K7CA 1EWPA 3BPMA 2VHFA 2FT2A 5K16A 3IEJA 3MORA 1PBHA 1HUCB 1W6FA 1QMYA 1GLOA 2HHNA 2FQ9A 2P0RA 1NL6A 3QT4A 4B55A 4W5BA 4I05A 2YJCA 1KHPA 3HHAA 4PP1A 2DC6A 3AI8A 4N79A 2DZYA 3OVXA 2DC7A 1NQCA 2NQAA 4YYUA 4N4ZA 2E00A 4Q8HA 4AXLA 3IV2A 3B79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OUL A;  5JA7 A;  2Y6E A;  4Q8G A;  2R6N A;  1ICF A;  4OEM A;  1KXR A;  1PPD A;  2R9N A;  3U8E A;  4P6E A;  3H89 A;  3MHH A;  2AIM A;  2XU4 A;  3N4C A;  4DMY A;  3CH3 X;  1AU4 A;  4BS5 A;  4YYQ A;  4W5C A;  1CVZ A;  3HWN A;  5CVN B;  2PNS A;  3P5X A;  2H7J A;  1U9W A;  3F75 A;  4BPV A;  3H7D A;  9PAP A;  1AU0 A;  1DF0 A;  4FJC A;  2FRA A;  2P86 A;  2DCB A;  1Q6K A;  1U9Q X;  4X6H A;  3WXF A;  2DC9 A;  2XU1 A;  1PPP A;  3KFQ A;  2G6D A;  2FO5 A;  1NB5 A;  1JQP A;  1MIR A;  1CTE A;  1EWO A;  1QXP A;  4PI3 A;  2G8J A;  3IHP A;  4HWY A;  3BOW A;  2AU1 A;  4YYS A;  1F2C A;  2DJG B;  1IWD A;  2C0Y A;  2GFO A;  2FUD A;  4BQV A;  4CZW A;  2Y5B A;  2YJB A;  4MSX A;  4CDF B;  8PCH A;  1MDW A;  4N8W A;  3OIS A;  3S3R A;  4MZO A;  1ZCM A;  3QJ3 A;  4RY2 A;  4I07 A;  1A6R A;  3GCB A;  3OVZ A;  2CIO A;  5CHV A;  1FH0 A;  2IPP B;  4QBB A;  1YVB A;  2AYN A;  1NPZ A;  2FYE A;  2G8E A;  2DZZ A;  1EWM A;  2R9C A;  3KKU A;  3F5V A;  4OEL A;  3I3T A;  2HXZ A;  1M6D A;  1MEG A;  3P5U A;  1TL9 A;  1F29 A;  1F2A A;  3WXE A;  2R9M A;  1PPO A;  3M99 A;  4YYV A;  1BGO A;  5EF4 A;  1CB5 A;  3USV A;  1YAL A;  5EGW A;  3IOQ A;  4QRG A;  4BS6 A;  3H8B A;  1YT7 A;  1CQD A;  2AS8 A;  4W4U A;  3WXG A;  7PCK A;  4PP2 E;  4YVA A;  1PXV A;  1PPN A;  4ZUX U;  1TU6 A;  3LXS A;  4CDE B;  2F1G A;  2HD5 A;  2FRQ A;  1SP4 B;  1XKG A;  2JQG R;  1GMY A;  3LFY A;  3TNX A;  2BDL A;  5JH3 A;  1S4V A;  1Y08 A;  3P5W A;  1BP4 A;  3IUT A;  3S3Q A;  4YYR A;  3PBH A;  2G7Y A;  1PIP A;  1ME4 A;  2BDZ A;  4QRV A;  3BPF A;  1KFU L;  3QSD A;  4KLB A;  2OP3 A;  1YK7 A;  4XUI A;  1ITO A;  2HH5 A;  4I04 A;  2FTD A;  2R9O A;  3O0U A;  1MHW A;  2GHU A;  4AXM A;  3PDF A;  1ATK A;  1NLJ A;  2NQD B;  2YJ8 A;  4YYW A;  3I06 A;  1KFX L;  1CV8 A;  4X6I A;  1F2B A;  1CPJ A;  3E1Z B;  1PE6 A;  2YJ9 A;  4QRX A;  2OZ2 A;  3V6C A;  4MZS A;  1CJL A;  3K9M A;  1PAD A;  1AIM A;  2ATO A;  1U5I A;  3O1G A;  1YK8 A;  1ME3 A;  5J94 A;  2E03 A;  5A24 A;  3K8U A;  4CDC B;  1BY8 A;  1POP A;  3H8C A;  4P6G A;  4YV8 A;  2O6X A;  1SNK A;  3N3G A;  3DF0 A;  2XU5 A;  1AYU A;  2IBI A;  2AVW A;  2DC8 A;  3V6E A;  4BSQ A;  2AYO A;  1GCB A;  3MHS A;  3RVV A;  3N3K A;  1MS6 A;  1VSN A;  2VHS A;  4G54 A;  3CBK A;  1VJV A;  3ERV A;  3CH2 X;  1KHQ A;  5F02 A;  3BWK A;  2AUX A;  1QDQ A;  5CVM A;  4FK5 A;  2E01 A;  3IMA A;  2PAD A;  2WBF X;  1TLO A;  3RVX A;  4XR7 A;  3KW9 A;  2NQI A;  3HD3 A;  3KWB X;  1X9Y A;  1AYW A;  2ACT A;  2YJ2 A;  4QH6 A;  3K24 A;  2P7U A;  3MTN A;  4DMX A;  3OF8 A;  1QOL A;  2F7D A;  5PAD A;  5CVO B;  3BCN A;  1EWL A;  2DCD A;  1AU2 A;  3RVW A;  1MEM A;  1Y4H A;  1THE A;  2DJF B;  2JQF R;  3C9E A;  3OF9 A;  2PRE A;  3KSE A;  2DCA A;  3NHE A;  1GEC E;  1AYV A;  3H6S A;  3ZUA A;  2NQG A;  1PCI A;  2ARY A;  2AUZ A;  2DCC A;  3P5V A;  4PAD A;  1U9V A;  1AU3 A;  2R9F A;  2E02 A;  4WA6 A;  4X6J A;  2CB5 A;  3HHI A;  1K3B B;  5CHT A;  2XU3 A;  1NB3 A;  6PAD A;  1BQI A;  1DEU A;  2B1M A;  1O0E A;  4FIP A;  3KX1 A;  1ZIV A;  1U9X A;  2B1N A;  1AEC A;  4CDD B;  3CBJ A;  3KWZ A;  3PW3 A;  3BC3 A;  3PNR A;  3D6S A;  1STF E;  1CSB B;  1EF7 A;  1CS8 A;  2PBH A;  5FPW A;  4K7C A;  1EWP A;  3BPM A;  2VHF A;  2FT2 A;  5K16 A;  3IEJ A;  3MOR A;  1PBH A;  1HUC B;  1QMY A;  1GLO A;  2HHN A;  2FQ9 A;  2P0R A;  1NL6 A;  3QT4 A;  4W5B A;  4I05 A;  2YJC A;  1KHP A;  3HHA A;  4PP1 A;  2DC6 A;  3AI8 A;  4N79 A;  2DZY A;  3OVX A;  2DC7 A;  1NQC A;  2NQA A;  4YYU A;  4N4Z A;  2E00 A;  4Q8H A;  4AXL A;  3IV2 A;  3B79 A; 
#chains in the Genus database with same CATH topology
 2OUL A;  5JA7 A;  2Y6E A;  3E9S A;  4Q8G A;  2R6N A;  1ICF A;  4OEM A;  1KXR A;  1PPD A;  2R9N A;  3U8E A;  4IP3 A;  2Z84 A;  4P6E A;  3H89 A;  3MHH A;  2AIM A;  2XU4 A;  3N4C A;  3RNV A;  4DMY A;  3CH3 X;  4BOQ A;  1AU4 A;  4BS5 A;  4BOS A;  4YYQ A;  4W5C A;  1CVZ A;  3HWN A;  5CVN B;  4RF1 A;  2PNS A;  3P5X A;  2H7J A;  1U9W A;  3F75 A;  4BPV A;  3H7D A;  3MJ5 A;  9PAP A;  1AU0 A;  1DF0 A;  5EZS A;  4FJC A;  2FRA A;  2P86 A;  1DKI A;  2BTW A;  2DCB A;  1Q6K A;  4GUA A;  4OVZ A;  1U9Q X;  4X6H A;  3WXF A;  2DC9 A;  2XU1 A;  1PPP A;  3C0R A;  3KFQ A;  2G6D A;  4IUM A;  2FO5 A;  1NB5 A;  1JQP A;  1MIR A;  1CTE A;  1EWO A;  1QXP A;  4PI3 A;  2G8J A;  3IHP A;  4HWY A;  3BOW A;  4R3D A;  2AU1 A;  4YYS A;  4D8I A;  1F2C A;  2DJG B;  1IWD A;  2C0Y A;  2GFO A;  2FUD A;  4BQV A;  4CZW A;  2Y5B A;  2YJB A;  4MSX A;  4CDF B;  8PCH A;  1MDW A;  4N8W A;  3OIS A;  3S3R A;  4MZO A;  1ZCM A;  3MP2 A;  3QJ3 A;  4RY2 A;  4I07 A;  1A6R A;  2J7Q C;  3GCB A;  3OVZ A;  2CIO A;  5CHV A;  1FH0 A;  1UKF A;  2IPP B;  4QBB A;  3OQC A;  1YVB A;  4RF0 A;  2AYN A;  1NPZ A;  4M0W A;  2FYE A;  2G8E A;  2DZZ A;  1EWM A;  2R9C A;  3KKU A;  3BY4 A;  3F5V A;  4OEL A;  3I3T A;  2HXZ A;  1M6D A;  1MEG A;  3P5U A;  2DOS A;  1TL9 A;  1F29 A;  1F2A A;  3WXE A;  2R9M A;  1PPO A;  3M99 A;  4YYV A;  1BGO A;  5EF4 A;  1CB5 A;  3PHW A;  3USV A;  1YAL A;  5EGW A;  3IOQ A;  4QRG A;  4BS6 A;  3H8B A;  4MI7 A;  1PVJ A;  1YT7 A;  1CQD A;  1YZB A;  2AS8 A;  4WUR A;  4W4U A;  3PT2 A;  3WXG A;  5KO3 A;  5E6J A;  7PCK A;  4PP2 E;  4HXD B;  4YVA A;  1PXV A;  1PPN A;  4ZUX U;  1TU6 A;  3LXS A;  4RKX A;  4CDE B;  2F1G A;  4MM3 B;  2HD5 A;  2FRQ A;  1SP4 B;  1XKG A;  2JQG R;  1GMY A;  3LFY A;  3TNX A;  2BDL A;  5JH3 A;  1S4V A;  1Y08 A;  4D8B A;  3P5W A;  1BP4 A;  3IUT A;  3S3Q A;  4YYR A;  3PBH A;  2G7Y A;  1PIP A;  3MTV A;  3PHU A;  1ME4 A;  2BDZ A;  4P16 A;  4QRV A;  3BPF A;  1KFU L;  3QSD A;  4KLB A;  2OP3 A;  1YK7 A;  4XUI A;  1ITO A;  2HH5 A;  4I04 A;  3W31 A;  2BTW B;  2FTD A;  4OVZ B;  2R9O A;  3O0U A;  4REZ A;  1MHW A;  2GHU A;  4AXM A;  3ZNH A;  3PDF A;  1ATK A;  1NLJ A;  2NQD B;  2YJ8 A;  4YYW A;  3I06 A;  1KFX L;  4ZTB A;  3O65 A;  1CV8 A;  5JZE A;  4PT5 A;  4X6I A;  1F2B A;  2JTC A;  1CPJ A;  3E1Z B;  1PE6 A;  2YJ9 A;  4QRX A;  2OZ2 A;  3V6C A;  4MZS A;  1CJL A;  3K9M A;  1PAD A;  4D8E A;  1AIM A;  2ATO A;  1U5I A;  3O1G A;  3TRK A;  1YK8 A;  1ME3 A;  5J94 A;  4RNA A;  2E03 A;  5A24 A;  3K8U A;  4CDC B;  1BY8 A;  1POP A;  3H8C A;  2BU3 A;  4P6G A;  4YV8 A;  2O6X A;  1SNK A;  3PHX A;  3B21 A;  3N3G A;  3DF0 A;  2XU5 A;  1AYU A;  2IBI A;  2JRI A;  2AVW A;  2DC8 A;  3V6E A;  4BSQ A;  2AYO A;  1GCB A;  3MHS A;  3RVV A;  3N3K A;  1MS6 A;  3TMP A;  1VSN A;  2VHS A;  4G54 A;  3CBK A;  1VJV A;  3ERV A;  3CH2 X;  1KHQ A;  5F02 A;  3BWK A;  4BOZ A;  2AUX A;  1QDQ A;  5CVM A;  4FK5 A;  2E01 A;  3IMA A;  2PAD A;  2WBF X;  1TLO A;  3RVX A;  4XR7 A;  3KW9 A;  2NQI A;  3HD3 A;  3KWB X;  1X9Y A;  1AYW A;  2ACT A;  2YJ2 A;  4QH6 A;  3K24 A;  2P7U A;  3MTN A;  4DMX A;  3OF8 A;  1QOL A;  2F7D A;  4OW0 A;  5PAD A;  5CVO B;  2J7Q A;  3BCN A;  1EWL A;  2DCD A;  1AU2 A;  3RVW A;  4XZX A;  1MEM A;  1Y4H A;  2UZJ A;  3PRM A;  1THE A;  2DJF B;  2JQF R;  3C9E A;  3OF9 A;  2PRE A;  3KSE A;  3PSE A;  2DCA A;  3NHE A;  1GEC E;  3W30 A;  1AYV A;  3H6S A;  3ZUA A;  2NQG A;  1PCI A;  2ARY A;  2AUZ A;  2DCC A;  3IFU A;  3P5V A;  4PAD A;  1U9V A;  1AU3 A;  2R9F A;  2E02 A;  4WA6 A;  4X6J A;  2CB5 A;  3HHI A;  2FE8 A;  1K3B B;  5CHT A;  2XU3 A;  2AGA A;  1NB3 A;  3BB7 A;  6PAD A;  1BQI A;  1DEU A;  2B1M A;  1O0E A;  4FIP A;  3KX1 A;  1ZIV A;  1U9X A;  2B1N A;  1AEC A;  2HWK A;  4CDD B;  4A5U A;  3CBJ A;  3KWZ A;  3PW3 A;  3BC3 A;  3PNR A;  3D6S A;  1STF E;  1CSB B;  1EF7 A;  1CS8 A;  2PBH A;  5FPW A;  4K7C A;  5EZQ A;  1EWP A;  3BPM A;  2VHF A;  2FT2 A;  5K16 A;  3IEJ A;  3MOR A;  1PBH A;  1HUC B;  1QMY A;  4BOP A;  1GLO A;  2HHN A;  2FQ9 A;  2P0R A;  1NL6 A;  3QT4 A;  4W5B A;  4I05 A;  2YJC A;  1KHP A;  4BOU A;  3HHA A;  4PP1 A;  2DC6 A;  3AI8 A;  4N79 A;  2DZY A;  3OVX A;  3PRP A;  2DC7 A;  1NQC A;  2NQA A;  4YYU A;  4N4Z A;  2E00 A;  4Q8H A;  3BBA A;  4AXL A;  3IV2 A;  3B79 A; 
#chains in the Genus database with same CATH homology
 2OUL A;  5JA7 A;  2Y6E A;  4Q8G A;  2R6N A;  1ICF A;  4OEM A;  1KXR A;  1PPD A;  2R9N A;  3U8E A;  4P6E A;  3H89 A;  3MHH A;  2AIM A;  2XU4 A;  3N4C A;  4DMY A;  3CH3 X;  1AU4 A;  3LTW A;  4BS5 A;  4YYQ A;  4NV8 A;  4W5C A;  1CVZ A;  3HWN A;  5CVN B;  2PNS A;  3P5X A;  2H7J A;  1U9W A;  3F75 A;  4BPV A;  3H7D A;  9PAP A;  1AU0 A;  1DF0 A;  4FJC A;  2FRA A;  2P86 A;  2DCB A;  1Q6K A;  1U9Q X;  4X6H A;  3WXF A;  2DC9 A;  2XU1 A;  1PPP A;  3KFQ A;  2G6D A;  2FO5 A;  1NB5 A;  1JQP A;  1MIR A;  1CTE A;  1EWO A;  1QXP A;  4PI3 A;  2G8J A;  3IHP A;  4HWY A;  3BOW A;  2AU1 A;  4YYS A;  1F2C A;  2DJG B;  1IWD A;  2C0Y A;  2GFO A;  2FUD A;  4BQV A;  4CZW A;  2Y5B A;  2YJB A;  4MSX A;  4CDF B;  8PCH A;  1MDW A;  4N8W A;  3OIS A;  3S3R A;  4MZO A;  1ZCM A;  3QJ3 A;  4RY2 A;  4I07 A;  1A6R A;  3GCB A;  3OVZ A;  2CIO A;  5CHV A;  1FH0 A;  2BSZ A;  2IPP B;  4QBB A;  1YVB A;  2AYN A;  1NPZ A;  2FYE A;  2G8E A;  2DZZ A;  1EWM A;  2R9C A;  3KKU A;  3F5V A;  4OEL A;  3I3T A;  2HXZ A;  1M6D A;  1MEG A;  3P5U A;  1E2T A;  1TL9 A;  1F29 A;  1F2A A;  3WXE A;  2R9M A;  1PPO A;  3M99 A;  4YYV A;  1BGO A;  5EF4 A;  1CB5 A;  3USV A;  1YAL A;  5EGW A;  3IOQ A;  4QRG A;  4BS6 A;  3H8B A;  1YT7 A;  1CQD A;  2AS8 A;  4W4U A;  3WXG A;  7PCK A;  4PP2 E;  4YVA A;  1PXV A;  1PPN A;  4ZUX U;  1TU6 A;  3LXS A;  4CDE B;  2F1G A;  2HD5 A;  2FRQ A;  1SP4 B;  1XKG A;  2JQG R;  1GMY A;  3LFY A;  3TNX A;  2BDL A;  5JH3 A;  1S4V A;  1Y08 A;  3P5W A;  1BP4 A;  3IUT A;  3S3Q A;  4YYR A;  3PBH A;  2G7Y A;  1PIP A;  1ME4 A;  2BDZ A;  4QRV A;  3BPF A;  1GX3 A;  1KFU L;  3QSD A;  4KLB A;  2OP3 A;  1YK7 A;  4XUI A;  1ITO A;  2HH5 A;  4I04 A;  2FTD A;  2R9O A;  3O0U A;  1MHW A;  2GHU A;  4AXM A;  3PDF A;  1ATK A;  1NLJ A;  2NQD B;  2YJ8 A;  4YYW A;  3I06 A;  1KFX L;  4C5P A;  1CV8 A;  4BGF A;  4GUZ A;  4X6I A;  1F2B A;  1CPJ A;  3E1Z B;  1PE6 A;  2YJ9 A;  4QRX A;  2OZ2 A;  3V6C A;  4MZS A;  1CJL A;  3K9M A;  1PAD A;  1AIM A;  2ATO A;  1U5I A;  3O1G A;  1YK8 A;  1ME3 A;  5J94 A;  2E03 A;  5A24 A;  3K8U A;  4CDC B;  1BY8 A;  1POP A;  3H8C A;  1W5R A;  4P6G A;  4YV8 A;  2O6X A;  1SNK A;  3N3G A;  3DF0 A;  2XU5 A;  1AYU A;  2IBI A;  2AVW A;  2DC8 A;  3V6E A;  4BSQ A;  2AYO A;  3D9W A;  1GCB A;  3MHS A;  3RVV A;  3N3K A;  1MS6 A;  1VSN A;  2VFC A;  2VHS A;  4G54 A;  3CBK A;  1VJV A;  3ERV A;  3CH2 X;  1KHQ A;  5F02 A;  3BWK A;  2AUX A;  1QDQ A;  5CVM A;  4FK5 A;  2E01 A;  3IMA A;  2PAD A;  2WBF X;  1TLO A;  3RVX A;  4XR7 A;  3KW9 A;  2NQI A;  3HD3 A;  3KWB X;  1X9Y A;  1AYW A;  2ACT A;  2YJ2 A;  4QH6 A;  3K24 A;  2P7U A;  3MTN A;  4DMX A;  3OF8 A;  1QOL A;  2F7D A;  5PAD A;  5CVO B;  3BCN A;  1EWL A;  2DCD A;  2VFB A;  1AU2 A;  3RVW A;  1MEM A;  1Y4H A;  1THE A;  2DJF B;  2JQF R;  3C9E A;  3OF9 A;  2PRE A;  3KSE A;  2DCA A;  3NHE A;  1GEC E;  1AYV A;  3H6S A;  3ZUA A;  2NQG A;  1PCI A;  2ARY A;  2AUZ A;  2DCC A;  3P5V A;  4PAD A;  1U9V A;  1AU3 A;  2R9F A;  2E02 A;  4WA6 A;  4X6J A;  2CB5 A;  3HHI A;  1K3B B;  5CHT A;  2XU3 A;  1NB3 A;  6PAD A;  1BQI A;  1DEU A;  2B1M A;  1O0E A;  4FIP A;  3KX1 A;  1ZIV A;  1U9X A;  2B1N A;  1AEC A;  4CDD B;  4NV7 A;  3CBJ A;  3KWZ A;  3PW3 A;  3BC3 A;  3PNR A;  3D6S A;  1STF E;  1CSB B;  1EF7 A;  1W4T A;  1CS8 A;  2PBH A;  5FPW A;  4K7C A;  1EWP A;  3BPM A;  2VHF A;  2FT2 A;  5K16 A;  3IEJ A;  3MOR A;  1PBH A;  1HUC B;  1W6F A;  1QMY A;  1GLO A;  2HHN A;  2FQ9 A;  2P0R A;  1NL6 A;  3QT4 A;  4B55 A;  4W5B A;  4I05 A;  2YJC A;  1KHP A;  3HHA A;  4PP1 A;  2DC6 A;  3AI8 A;  4N79 A;  2DZY A;  3OVX A;  2DC7 A;  1NQC A;  2NQA A;  4YYU A;  4N4Z A;  2E00 A;  4Q8H A;  4AXL A;  3IV2 A;  3B79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...