4N8WA

Cathepsin k - chondroitin sulfate complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
213
structure length
213
Chain Sequence
DSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin K
publication title Structural basis of collagen fiber degradation by cathepsin K.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 213
sequence length 213
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2013-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4n8wA00
2FT2A 2B1MA 1PPOA 3GCBA 4QRXA 2FUDA 3KKUA 3E1ZB 3QJ3A 2AYNA 2G6DA 4X6HA 4YYQA 3OVZA 4MZOA 2GFOA 4K7CA 4W5CA 1PXVA 2E00A 1Q6KA 4PP1A 4PP2E 1MS6A 5EF4A 2DCDA 1SP4B 5CVNB 2C0YA 3AI8A 4CDDB 2ATOA 5K16A 2FTDA 2R9NA 1PIPA 2Y5BA 5A24A 4DMYA 3K9MA 3MTNA 1FH0A 1O0EA 2R6NA 2JQFR 1NLJA 3BCNA 1VJVA 2FRQA 1NB5A 3RVVA 4OEMA 3M99A 1NB3A 3RVWA 2O6XA 1X9YA 3BPMA 1PPDA 2XU5A 3F5VA 1KFUL 3O0UA 2NQGA 1BP4A 2CB5A 3IMAA 3C9EA 2G8JA 1KXRA 2GHUA 2PNSA 4HWYA 2IPPB 3I06A 4CDEB 2HHNA 1CS8A 4CDCB 4I07A 1JQPA 3IEJA 3H7DA 2R9FA 5EGWA 1EWLA 1BGOA 2OZ2A 1U9QX 5F02A 3MHHA 1F2AA 1GMYA 1Y4HA 1TLOA 2P7UA 4MSXA 4FK5A 2AS8A 3IUTA 2CIOA 2E01A 1AU3A 1EWMA 3QT4A 4I05A 1ME4A 2E03A 3CBJA 4BS5A 3CH3X 4Q8HA 1A6RA 2BDZA 1EF7A 3N3KA 1EWOA 3DF0A 4BSQA 1BY8A 2P86A 1BQIA 3H8CA 3KWZA 4AXMA 4P6GA 1U9XA 4WA6A 3BWKA 3V6CA 4QH6A 3IV2A 1STFE 2YJBA 3ERVA 1QMYA 3P5VA 3CH2X 1ZCMA 3CBKA 2B1NA 2Y6EA 1AU2A 3H6SA 9PAPA 3F75A 2AUZA 2PADA 3PBHA 2DC9A 1AYWA 3PDFA 3HHIA 1TL9A 1GECE 1GLOA 5CVOB 1AYUA 5CVMA 3P5XA 2OULA 4X6JA 3I3TA 2H7JA 3KSEA 1F2CA 2YJ2A 2VHFA 1IWDA 2AUXA 2FYEA 4YYRA 1CTEA 1CVZA 3OISA 4FIPA 3MHSA 5JA7A 1DF0A 3KWBX 1AU4A 2XU4A 2ARYA 1ZIVA 3BC3A 6PADA 2FRAA 1U5IA 1AECA 1HUCB 4DMXA 1ICFA 2DC8A 1MHWA 1SNKA 1CB5A 3KFQA 4QRGA 2XU1A 3WXEA 4YV8A 4BQVA 2JQGR 3HWNA 2OP3A 3N4CA 5CHTA 2YJCA 4PI3A 2HD5A 1ATKA 2R9MA 4W4UA 1K3BB 4N8WA 2DC7A 4W5BA 1F2BA 2R9OA 4BPVA 1YK7A 2DCBA 1MEMA 3OF9A 3K8UA 1CPJA 1PPNA 1U9WA 4G54A 1EWPA 3LXSA 4P6EA 1CSBB 2NQIA 1THEA 1PPPA 2G8EA 3N3GA 3PNRA 4FJCA 2DJFB 3D6SA 2VHSA 2ACTA 1KHQA 2NQDB 1ME3A 3OVXA 1YALA 1KFXL 3H8BA 1CV8A 2DC6A 3P5WA 4RY2A 1AYVA 1MDWA 1NL6A 1CQDA 1CJLA 2BDLA 2NQAA 3USVA 2PREA 3IOQA 4YYWA 1AU0A 3HHAA 1S4VA 3TNXA 4XUIA 3H89A 3LFYA 7PCKA 1M6DA 3S3QA 1ITOA 2P0RA 1PADA 2G7YA 1PE6A 4AXLA 2HH5A 1NPZA 2DJGB 8PCHA 2DZYA 1PBHA 3BPFA 3BOWA 1YK8A 2DZZA 1PCIA 1QOLA 3B79A 3P5UA 1F29A 2AYOA 1XKGA 2DCAA 2FQ9A 2YJ8A 1GCBA 1TU6A 3IHPA 3ZUAA 2IBIA 1QDQA 1AIMA 2AVWA 3QSDA 2F7DA 5CHVA 5J94A 4Q8GA 1MEGA 2AU1A 1VSNA 1MIRA 4QBBA 4X6IA 3WXFA 3NHEA 4MZSA 4CDFB 3KW9A 4OELA 2E02A 4PADA 1Y08A 5PADA 3K24A 2WBFX 1U9VA 1YVBA 4N4ZA 3PW3A 2F1GA 3O1GA 1YT7A 4I04A 4YYSA 4QRVA 3RVXA 4ZUXU 3OF8A 1NQCA 1QXPA 2R9CA 3KX1A 5FPWA 3V6EA 3MORA 4YVAA 4YYUA 3HD3A 2YJ9A 1POPA 4BS6A 2XU3A 4YYVA 5JH3A 3U8EA 2FO5A 2PBHA 3WXGA 4XR7A 1KHPA 2AIMA 2HXZA 4N79A 3S3RA 4CZWA 1DEUA 2DCCA 4KLBA
chains in the Genus database with same CATH superfamily
2FT2A 2B1MA 1PPOA 3GCBA 4BOUA 4QRXA 3RNVA 2FUDA 3KKUA 3E1ZB 3QJ3A 2AYNA 2G6DA 4X6HA 4YYQA 3OVZA 4MZOA 2GFOA 4A5UA 4BOQA 3PRMA 4IUMA 4K7CA 4REZA 4W5CA 1PXVA 2E00A 1Q6KA 3ZNHA 4PP1A 5EZQA 4PP2E 1MS6A 5EF4A 2DCDA 1SP4B 5CVNB 4OVZA 3W31A 2C0YA 3AI8A 4OW0A 4CDDB 2ATOA 5K16A 2FTDA 2R9NA 1PIPA 2Y5BA 5A24A 4DMYA 3K9MA 3MTNA 1FH0A 1O0EA 2R6NA 4HXDB 2JQFR 1NLJA 4R3DA 3BCNA 1VJVA 2FRQA 1NB5A 3RVVA 4OEMA 3IFUA 3M99A 1NB3A 3RVWA 2O6XA 1X9YA 4OVZB 3BPMA 1PPDA 2XU5A 3F5VA 3PHWA 4M0WA 1KFUL 3O0UA 2UZJA 2NQGA 1BP4A 2CB5A 3IMAA 3MJ5A 3C9EA 2JRIA 2G8JA 1KXRA 2GHUA 2PNSA 4HWYA 2IPPB 3I06A 4CDEB 2HHNA 4RF0A 1CS8A 4CDCB 4I07A 1JQPA 3IEJA 3H7DA 2R9FA 5EGWA 1EWLA 4BOSA 1BGOA 2OZ2A 1U9QX 5F02A 3MHHA 4RF1A 1F2AA 1GMYA 1Y4HA 1TLOA 2P7UA 4MSXA 3TRKA 4FK5A 2AS8A 3IUTA 2CIOA 2E01A 1AU3A 1EWMA 3QT4A 4I05A 4D8BA 1ME4A 3BB7A 2E03A 3CBJA 4MI7A 4BS5A 2FE8A 3CH3X 4RKXA 4Q8HA 1A6RA 2BDZA 1EF7A 3N3KA 4BOPA 1EWOA 3DF0A 4BSQA 1BY8A 2P86A 1BQIA 3B21A 3H8CA 2BU3A 3TMPA 3KWZA 4AXMA 4P6GA 1U9XA 4WA6A 3BWKA 3O65A 2DCCA 3V6CA 4QH6A 3IV2A 1STFE 2YJBA 3ERVA 1QMYA 3P5VA 3CH2X 1ZCMA 3CBKA 2B1NA 2Y6EA 1AU2A 4BOZA 3H6SA 9PAPA 3F75A 2AUZA 2PADA 3PBHA 2DC9A 1AYWA 3PDFA 3HHIA 2Z84A 3PRPA 1TL9A 1GECE 1GLOA 5CVOB 4P16A 3MP2A 1AYUA 5CVMA 4ZTBA 3P5XA 2OULA 4X6JA 3I3TA 3PHUA 2H7JA 3KSEA 1F2CA 4GUAA 2YJ2A 2VHFA 1IWDA 2AUXA 2FYEA 4YYRA 1CTEA 4MM3B 1CVZA 3OISA 4FIPA 3MHSA 5JA7A 1DF0A 3KWBX 1AU4A 2XU4A 2ARYA 1DKIA 1ZIVA 3BC3A 6PADA 2FRAA 1U5IA 1AECA 1HUCB 3BBAA 4DMXA 1ICFA 3PSEA 2DC8A 1MHWA 1SNKA 1CB5A 3KFQA 4QRGA 2XU1A 4PT5A 3WXEA 4YV8A 4BQVA 4IP3A 3C0RA 2JQGR 2AGAA 3HWNA 2OP3A 3N4CA 5CHTA 2YJCA 4PI3A 2HD5A 1ATKA 2R9MA 4D8IA 2J7QA 4W4UA 1K3BB 4N8WA 2DC7A 4W5BA 1F2BA 2R9OA 4BPVA 1YK7A 2DCBA 1MEMA 3OF9A 3K8UA 1CPJA 1PPNA 1U9WA 4G54A 1EWPA 3LXSA 3OQCA 4P6EA 1CSBB 2NQIA 1THEA 1PPPA 2G8EA 3N3GA 3PNRA 4FJCA 2DJFB 3D6SA 2VHSA 2ACTA 1KHQA 2NQDB 1ME3A 3OVXA 1YALA 4D8EA 1KFXL 3H8BA 3E9SA 1CV8A 2DC6A 3P5WA 4RY2A 1PVJA 1AYVA 4RNAA 1MDWA 1NL6A 3PHXA 1CQDA 1CJLA 5E6JA 2BDLA 2NQAA 3USVA 2PREA 3IOQA 4YYWA 1AU0A 3HHAA 1S4VA 3TNXA 4XUIA 3H89A 3LFYA 7PCKA 1M6DA 3S3QA 1ITOA 2P0RA 1PADA 2G7YA 1PE6A 4AXLA 3PT2A 2HH5A 1YZBA 1NPZA 2DJGB 8PCHA 2DZYA 1PBHA 3BPFA 3BOWA 1YK8A 2DZZA 1PCIA 1QOLA 3B79A 3P5UA 1F29A 2HWKA 2AYOA 1XKGA 4WURA 2DCAA 2FQ9A 4XZXA 2YJ8A 1GCBA 1TU6A 3IHPA 3ZUAA 2IBIA 1QDQA 1AIMA 2AVWA 3QSDA 2F7DA 5CHVA 5J94A 4Q8GA 1UKFA 1MEGA 2AU1A 1VSNA 1MIRA 4QBBA 2BTWA 4X6IA 3WXFA 3NHEA 3MTVA 4MZSA 4CDFB 2J7QC 3KW9A 4OELA 2E02A 4PADA 1Y08A 5PADA 3K24A 2WBFX 1U9VA 5KO3A 1YVBA 4N4ZA 3PW3A 5JZEA 2F1GA 3O1GA 3BY4A 1YT7A 3W30A 4I04A 4YYSA 4QRVA 5EZSA 3RVXA 2JTCA 4ZUXU 3OF8A 1NQCA 1QXPA 2R9CA 3KX1A 5FPWA 3V6EA 3MORA 4YVAA 4YYUA 3HD3A 2YJ9A 1POPA 4BS6A 2BTWB 2XU3A 4YYVA 5JH3A 3U8EA 2FO5A 2PBHA 3WXGA 4XR7A 1KHPA 2AIMA 2HXZA 4N79A 3S3RA 4CZWA 1DEUA 2DOSA 4KLBA
chains in the Genus database with same CATH topology
2FT2A 2B1MA 1PPOA 3GCBA 4QRXA 2FUDA 3KKUA 3E1ZB 3QJ3A 2AYNA 2G6DA 4X6HA 4YYQA 3OVZA 4MZOA 2GFOA 4K7CA 4W5CA 1PXVA 1W4TA 2E00A 1Q6KA 4PP1A 4PP2E 1MS6A 5EF4A 2DCDA 1SP4B 5CVNB 2C0YA 3AI8A 4CDDB 2ATOA 5K16A 2FTDA 2R9NA 1PIPA 2Y5BA 5A24A 4DMYA 3K9MA 3MTNA 1FH0A 1O0EA 2R6NA 2JQFR 1NLJA 3BCNA 4NV7A 1VJVA 2FRQA 1NB5A 3RVVA 1W6FA 4OEMA 3M99A 1NB3A 3RVWA 2O6XA 1X9YA 3BPMA 1PPDA 2XU5A 3F5VA 1KFUL 3O0UA 2NQGA 1BP4A 2CB5A 3IMAA 3C9EA 2G8JA 1KXRA 2GHUA 2PNSA 4HWYA 1E2TA 2IPPB 3I06A 4CDEB 2HHNA 1CS8A 4CDCB 4I07A 1JQPA 3IEJA 3H7DA 2R9FA 5EGWA 1EWLA 1BGOA 2OZ2A 1U9QX 5F02A 3MHHA 1F2AA 1GMYA 1Y4HA 1TLOA 2P7UA 4MSXA 4FK5A 2AS8A 3IUTA 2CIOA 2E01A 1AU3A 1EWMA 3QT4A 4I05A 1ME4A 2E03A 3CBJA 4BS5A 3CH3X 4Q8HA 1A6RA 2BDZA 1EF7A 3N3KA 1EWOA 3DF0A 2VFCA 4BSQA 1BY8A 2P86A 1BQIA 3H8CA 2VFBA 3KWZA 4AXMA 4P6GA 1U9XA 4WA6A 3BWKA 3V6CA 4QH6A 3IV2A 1STFE 2YJBA 3ERVA 1QMYA 3P5VA 3CH2X 1W5RA 1ZCMA 3CBKA 2B1NA 2Y6EA 1AU2A 3H6SA 9PAPA 3F75A 2AUZA 2PADA 3PBHA 2DC9A 1AYWA 3PDFA 3HHIA 1TL9A 1GECE 1GLOA 5CVOB 1AYUA 5CVMA 3P5XA 2OULA 4X6JA 3I3TA 2H7JA 3KSEA 1F2CA 2YJ2A 2VHFA 1IWDA 2AUXA 2FYEA 4YYRA 1CTEA 1CVZA 3OISA 4FIPA 3MHSA 5JA7A 1DF0A 3KWBX 1AU4A 2XU4A 2ARYA 1ZIVA 3BC3A 6PADA 2FRAA 1U5IA 1AECA 1HUCB 4DMXA 1ICFA 2DC8A 1MHWA 1SNKA 1CB5A 3KFQA 4QRGA 2XU1A 3WXEA 4YV8A 4BQVA 2BSZA 2JQGR 3HWNA 2OP3A 3N4CA 5CHTA 2YJCA 4PI3A 2HD5A 1ATKA 2R9MA 4W4UA 3LTWA 1K3BB 4N8WA 2DC7A 4W5BA 1F2BA 2R9OA 4BPVA 1YK7A 4B55A 2DCBA 1MEMA 3OF9A 3K8UA 1CPJA 1PPNA 1U9WA 4G54A 1EWPA 3LXSA 4P6EA 1CSBB 2NQIA 1THEA 1PPPA 2G8EA 3N3GA 3PNRA 4FJCA 2DJFB 3D6SA 2VHSA 2ACTA 1KHQA 2NQDB 1ME3A 3OVXA 1YALA 1KFXL 3H8BA 4C5PA 1CV8A 2DC6A 3P5WA 4RY2A 1AYVA 1MDWA 1NL6A 1CQDA 1CJLA 2BDLA 2NQAA 3USVA 2PREA 3IOQA 4YYWA 1AU0A 3HHAA 1S4VA 3TNXA 4XUIA 3H89A 3LFYA 7PCKA 1M6DA 3S3QA 1ITOA 2P0RA 1PADA 2G7YA 1PE6A 4AXLA 2HH5A 1NPZA 2DJGB 8PCHA 2DZYA 1PBHA 3BPFA 3BOWA 1YK8A 2DZZA 1PCIA 1QOLA 3B79A 3P5UA 1F29A 2AYOA 1XKGA 2DCAA 2FQ9A 2YJ8A 1GCBA 1TU6A 3IHPA 3ZUAA 1GX3A 2IBIA 4BGFA 1QDQA 1AIMA 2AVWA 3QSDA 2F7DA 5CHVA 5J94A 4Q8GA 1MEGA 2AU1A 1VSNA 1MIRA 4QBBA 4X6IA 3WXFA 3NHEA 4MZSA 4CDFB 3KW9A 4OELA 2E02A 4PADA 1Y08A 5PADA 3K24A 2WBFX 1U9VA 1YVBA 4N4ZA 3PW3A 2F1GA 3O1GA 1YT7A 4I04A 4YYSA 4QRVA 3RVXA 3D9WA 4ZUXU 3OF8A 1NQCA 1QXPA 2R9CA 3KX1A 5FPWA 3V6EA 3MORA 4NV8A 4YVAA 4YYUA 3HD3A 2YJ9A 1POPA 4BS6A 4GUZA 2XU3A 4YYVA 5JH3A 3U8EA 2FO5A 2PBHA 3WXGA 4XR7A 1KHPA 2AIMA 2HXZA 4N79A 3S3RA 4CZWA 1DEUA 2DCCA 4KLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FT2 A;  2B1M A;  1PPO A;  3GCB A;  4QRX A;  2FUD A;  3KKU A;  3E1Z B;  3QJ3 A;  2AYN A;  2G6D A;  4X6H A;  4YYQ A;  3OVZ A;  4MZO A;  2GFO A;  4K7C A;  4W5C A;  1PXV A;  2E00 A;  1Q6K A;  4PP1 A;  4PP2 E;  1MS6 A;  5EF4 A;  2DCD A;  1SP4 B;  5CVN B;  2C0Y A;  3AI8 A;  4CDD B;  2ATO A;  5K16 A;  2FTD A;  2R9N A;  1PIP A;  2Y5B A;  5A24 A;  4DMY A;  3K9M A;  3MTN A;  1FH0 A;  1O0E A;  2R6N A;  2JQF R;  1NLJ A;  3BCN A;  1VJV A;  2FRQ A;  1NB5 A;  3RVV A;  4OEM A;  3M99 A;  1NB3 A;  3RVW A;  2O6X A;  1X9Y A;  3BPM A;  1PPD A;  2XU5 A;  3F5V A;  1KFU L;  3O0U A;  2NQG A;  1BP4 A;  2CB5 A;  3IMA A;  3C9E A;  2G8J A;  1KXR A;  2GHU A;  2PNS A;  4HWY A;  2IPP B;  3I06 A;  4CDE B;  2HHN A;  1CS8 A;  4CDC B;  4I07 A;  1JQP A;  3IEJ A;  3H7D A;  2R9F A;  5EGW A;  1EWL A;  1BGO A;  2OZ2 A;  1U9Q X;  5F02 A;  3MHH A;  1F2A A;  1GMY A;  1Y4H A;  1TLO A;  2P7U A;  4MSX A;  4FK5 A;  2AS8 A;  3IUT A;  2CIO A;  2E01 A;  1AU3 A;  1EWM A;  3QT4 A;  4I05 A;  1ME4 A;  2E03 A;  3CBJ A;  4BS5 A;  3CH3 X;  4Q8H A;  1A6R A;  2BDZ A;  1EF7 A;  3N3K A;  1EWO A;  3DF0 A;  4BSQ A;  1BY8 A;  2P86 A;  1BQI A;  3H8C A;  3KWZ A;  4AXM A;  4P6G A;  1U9X A;  4WA6 A;  3BWK A;  3V6C A;  4QH6 A;  3IV2 A;  1STF E;  2YJB A;  3ERV A;  1QMY A;  3P5V A;  3CH2 X;  1ZCM A;  3CBK A;  2B1N A;  2Y6E A;  1AU2 A;  3H6S A;  9PAP A;  3F75 A;  2AUZ A;  2PAD A;  3PBH A;  2DC9 A;  1AYW A;  3PDF A;  3HHI A;  1TL9 A;  1GEC E;  1GLO A;  5CVO B;  1AYU A;  5CVM A;  3P5X A;  2OUL A;  4X6J A;  3I3T A;  2H7J A;  3KSE A;  1F2C A;  2YJ2 A;  2VHF A;  1IWD A;  2AUX A;  2FYE A;  4YYR A;  1CTE A;  1CVZ A;  3OIS A;  4FIP A;  3MHS A;  5JA7 A;  1DF0 A;  3KWB X;  1AU4 A;  2XU4 A;  2ARY A;  1ZIV A;  3BC3 A;  6PAD A;  2FRA A;  1U5I A;  1AEC A;  1HUC B;  4DMX A;  1ICF A;  2DC8 A;  1MHW A;  1SNK A;  1CB5 A;  3KFQ A;  4QRG A;  2XU1 A;  3WXE A;  4YV8 A;  4BQV A;  2JQG R;  3HWN A;  2OP3 A;  3N4C A;  5CHT A;  2YJC A;  4PI3 A;  2HD5 A;  1ATK A;  2R9M A;  4W4U A;  1K3B B;  4N8W A;  2DC7 A;  4W5B A;  1F2B A;  2R9O A;  4BPV A;  1YK7 A;  2DCB A;  1MEM A;  3OF9 A;  3K8U A;  1CPJ A;  1PPN A;  1U9W A;  4G54 A;  1EWP A;  3LXS A;  4P6E A;  1CSB B;  2NQI A;  1THE A;  1PPP A;  2G8E A;  3N3G A;  3PNR A;  4FJC A;  2DJF B;  3D6S A;  2VHS A;  2ACT A;  1KHQ A;  2NQD B;  1ME3 A;  3OVX A;  1YAL A;  1KFX L;  3H8B A;  1CV8 A;  2DC6 A;  3P5W A;  4RY2 A;  1AYV A;  1MDW A;  1NL6 A;  1CQD A;  1CJL A;  2BDL A;  2NQA A;  3USV A;  2PRE A;  3IOQ A;  4YYW A;  1AU0 A;  3HHA A;  1S4V A;  3TNX A;  4XUI A;  3H89 A;  3LFY A;  7PCK A;  1M6D A;  3S3Q A;  1ITO A;  2P0R A;  1PAD A;  2G7Y A;  1PE6 A;  4AXL A;  2HH5 A;  1NPZ A;  2DJG B;  8PCH A;  2DZY A;  1PBH A;  3BPF A;  3BOW A;  1YK8 A;  2DZZ A;  1PCI A;  1QOL A;  3B79 A;  3P5U A;  1F29 A;  2AYO A;  1XKG A;  2DCA A;  2FQ9 A;  2YJ8 A;  1GCB A;  1TU6 A;  3IHP A;  3ZUA A;  2IBI A;  1QDQ A;  1AIM A;  2AVW A;  3QSD A;  2F7D A;  5CHV A;  5J94 A;  4Q8G A;  1MEG A;  2AU1 A;  1VSN A;  1MIR A;  4QBB A;  4X6I A;  3WXF A;  3NHE A;  4MZS A;  4CDF B;  3KW9 A;  4OEL A;  2E02 A;  4PAD A;  1Y08 A;  5PAD A;  3K24 A;  2WBF X;  1U9V A;  1YVB A;  4N4Z A;  3PW3 A;  2F1G A;  3O1G A;  1YT7 A;  4I04 A;  4YYS A;  4QRV A;  3RVX A;  4ZUX U;  3OF8 A;  1NQC A;  1QXP A;  2R9C A;  3KX1 A;  5FPW A;  3V6E A;  3MOR A;  4YVA A;  4YYU A;  3HD3 A;  2YJ9 A;  1POP A;  4BS6 A;  2XU3 A;  4YYV A;  5JH3 A;  3U8E A;  2FO5 A;  2PBH A;  3WXG A;  4XR7 A;  1KHP A;  2AIM A;  2HXZ A;  4N79 A;  3S3R A;  4CZW A;  1DEU A;  2DCC A;  4KLB A; 
#chains in the Genus database with same CATH topology
 2FT2 A;  2B1M A;  1PPO A;  3GCB A;  4BOU A;  4QRX A;  3RNV A;  2FUD A;  3KKU A;  3E1Z B;  3QJ3 A;  2AYN A;  2G6D A;  4X6H A;  4YYQ A;  3OVZ A;  4MZO A;  2GFO A;  4A5U A;  4BOQ A;  3PRM A;  4IUM A;  4K7C A;  4REZ A;  4W5C A;  1PXV A;  2E00 A;  1Q6K A;  3ZNH A;  4PP1 A;  5EZQ A;  4PP2 E;  1MS6 A;  5EF4 A;  2DCD A;  1SP4 B;  5CVN B;  4OVZ A;  3W31 A;  2C0Y A;  3AI8 A;  4OW0 A;  4CDD B;  2ATO A;  5K16 A;  2FTD A;  2R9N A;  1PIP A;  2Y5B A;  5A24 A;  4DMY A;  3K9M A;  3MTN A;  1FH0 A;  1O0E A;  2R6N A;  4HXD B;  2JQF R;  1NLJ A;  4R3D A;  3BCN A;  1VJV A;  2FRQ A;  1NB5 A;  3RVV A;  4OEM A;  3IFU A;  3M99 A;  1NB3 A;  3RVW A;  2O6X A;  1X9Y A;  4OVZ B;  3BPM A;  1PPD A;  2XU5 A;  3F5V A;  3PHW A;  4M0W A;  1KFU L;  3O0U A;  2UZJ A;  2NQG A;  1BP4 A;  2CB5 A;  3IMA A;  3MJ5 A;  3C9E A;  2JRI A;  2G8J A;  1KXR A;  2GHU A;  2PNS A;  4HWY A;  2IPP B;  3I06 A;  4CDE B;  2HHN A;  4RF0 A;  1CS8 A;  4CDC B;  4I07 A;  1JQP A;  3IEJ A;  3H7D A;  2R9F A;  5EGW A;  1EWL A;  4BOS A;  1BGO A;  2OZ2 A;  1U9Q X;  5F02 A;  3MHH A;  4RF1 A;  1F2A A;  1GMY A;  1Y4H A;  1TLO A;  2P7U A;  4MSX A;  3TRK A;  4FK5 A;  2AS8 A;  3IUT A;  2CIO A;  2E01 A;  1AU3 A;  1EWM A;  3QT4 A;  4I05 A;  4D8B A;  1ME4 A;  3BB7 A;  2E03 A;  3CBJ A;  4MI7 A;  4BS5 A;  2FE8 A;  3CH3 X;  4RKX A;  4Q8H A;  1A6R A;  2BDZ A;  1EF7 A;  3N3K A;  4BOP A;  1EWO A;  3DF0 A;  4BSQ A;  1BY8 A;  2P86 A;  1BQI A;  3B21 A;  3H8C A;  2BU3 A;  3TMP A;  3KWZ A;  4AXM A;  4P6G A;  1U9X A;  4WA6 A;  3BWK A;  3O65 A;  2DCC A;  3V6C A;  4QH6 A;  3IV2 A;  1STF E;  2YJB A;  3ERV A;  1QMY A;  3P5V A;  3CH2 X;  1ZCM A;  3CBK A;  2B1N A;  2Y6E A;  1AU2 A;  4BOZ A;  3H6S A;  9PAP A;  3F75 A;  2AUZ A;  2PAD A;  3PBH A;  2DC9 A;  1AYW A;  3PDF A;  3HHI A;  2Z84 A;  3PRP A;  1TL9 A;  1GEC E;  1GLO A;  5CVO B;  4P16 A;  3MP2 A;  1AYU A;  5CVM A;  4ZTB A;  3P5X A;  2OUL A;  4X6J A;  3I3T A;  3PHU A;  2H7J A;  3KSE A;  1F2C A;  4GUA A;  2YJ2 A;  2VHF A;  1IWD A;  2AUX A;  2FYE A;  4YYR A;  1CTE A;  4MM3 B;  1CVZ A;  3OIS A;  4FIP A;  3MHS A;  5JA7 A;  1DF0 A;  3KWB X;  1AU4 A;  2XU4 A;  2ARY A;  1DKI A;  1ZIV A;  3BC3 A;  6PAD A;  2FRA A;  1U5I A;  1AEC A;  1HUC B;  3BBA A;  4DMX A;  1ICF A;  3PSE A;  2DC8 A;  1MHW A;  1SNK A;  1CB5 A;  3KFQ A;  4QRG A;  2XU1 A;  4PT5 A;  3WXE A;  4YV8 A;  4BQV A;  4IP3 A;  3C0R A;  2JQG R;  2AGA A;  3HWN A;  2OP3 A;  3N4C A;  5CHT A;  2YJC A;  4PI3 A;  2HD5 A;  1ATK A;  2R9M A;  4D8I A;  2J7Q A;  4W4U A;  1K3B B;  4N8W A;  2DC7 A;  4W5B A;  1F2B A;  2R9O A;  4BPV A;  1YK7 A;  2DCB A;  1MEM A;  3OF9 A;  3K8U A;  1CPJ A;  1PPN A;  1U9W A;  4G54 A;  1EWP A;  3LXS A;  3OQC A;  4P6E A;  1CSB B;  2NQI A;  1THE A;  1PPP A;  2G8E A;  3N3G A;  3PNR A;  4FJC A;  2DJF B;  3D6S A;  2VHS A;  2ACT A;  1KHQ A;  2NQD B;  1ME3 A;  3OVX A;  1YAL A;  4D8E A;  1KFX L;  3H8B A;  3E9S A;  1CV8 A;  2DC6 A;  3P5W A;  4RY2 A;  1PVJ A;  1AYV A;  4RNA A;  1MDW A;  1NL6 A;  3PHX A;  1CQD A;  1CJL A;  5E6J A;  2BDL A;  2NQA A;  3USV A;  2PRE A;  3IOQ A;  4YYW A;  1AU0 A;  3HHA A;  1S4V A;  3TNX A;  4XUI A;  3H89 A;  3LFY A;  7PCK A;  1M6D A;  3S3Q A;  1ITO A;  2P0R A;  1PAD A;  2G7Y A;  1PE6 A;  4AXL A;  3PT2 A;  2HH5 A;  1YZB A;  1NPZ A;  2DJG B;  8PCH A;  2DZY A;  1PBH A;  3BPF A;  3BOW A;  1YK8 A;  2DZZ A;  1PCI A;  1QOL A;  3B79 A;  3P5U A;  1F29 A;  2HWK A;  2AYO A;  1XKG A;  4WUR A;  2DCA A;  2FQ9 A;  4XZX A;  2YJ8 A;  1GCB A;  1TU6 A;  3IHP A;  3ZUA A;  2IBI A;  1QDQ A;  1AIM A;  2AVW A;  3QSD A;  2F7D A;  5CHV A;  5J94 A;  4Q8G A;  1UKF A;  1MEG A;  2AU1 A;  1VSN A;  1MIR A;  4QBB A;  2BTW A;  4X6I A;  3WXF A;  3NHE A;  3MTV A;  4MZS A;  4CDF B;  2J7Q C;  3KW9 A;  4OEL A;  2E02 A;  4PAD A;  1Y08 A;  5PAD A;  3K24 A;  2WBF X;  1U9V A;  5KO3 A;  1YVB A;  4N4Z A;  3PW3 A;  5JZE A;  2F1G A;  3O1G A;  3BY4 A;  1YT7 A;  3W30 A;  4I04 A;  4YYS A;  4QRV A;  5EZS A;  3RVX A;  2JTC A;  4ZUX U;  3OF8 A;  1NQC A;  1QXP A;  2R9C A;  3KX1 A;  5FPW A;  3V6E A;  3MOR A;  4YVA A;  4YYU A;  3HD3 A;  2YJ9 A;  1POP A;  4BS6 A;  2BTW B;  2XU3 A;  4YYV A;  5JH3 A;  3U8E A;  2FO5 A;  2PBH A;  3WXG A;  4XR7 A;  1KHP A;  2AIM A;  2HXZ A;  4N79 A;  3S3R A;  4CZW A;  1DEU A;  2DOS A;  4KLB A; 
#chains in the Genus database with same CATH homology
 2FT2 A;  2B1M A;  1PPO A;  3GCB A;  4QRX A;  2FUD A;  3KKU A;  3E1Z B;  3QJ3 A;  2AYN A;  2G6D A;  4X6H A;  4YYQ A;  3OVZ A;  4MZO A;  2GFO A;  4K7C A;  4W5C A;  1PXV A;  1W4T A;  2E00 A;  1Q6K A;  4PP1 A;  4PP2 E;  1MS6 A;  5EF4 A;  2DCD A;  1SP4 B;  5CVN B;  2C0Y A;  3AI8 A;  4CDD B;  2ATO A;  5K16 A;  2FTD A;  2R9N A;  1PIP A;  2Y5B A;  5A24 A;  4DMY A;  3K9M A;  3MTN A;  1FH0 A;  1O0E A;  2R6N A;  2JQF R;  1NLJ A;  3BCN A;  4NV7 A;  1VJV A;  2FRQ A;  1NB5 A;  3RVV A;  1W6F A;  4OEM A;  3M99 A;  1NB3 A;  3RVW A;  2O6X A;  1X9Y A;  3BPM A;  1PPD A;  2XU5 A;  3F5V A;  1KFU L;  3O0U A;  2NQG A;  1BP4 A;  2CB5 A;  3IMA A;  3C9E A;  2G8J A;  1KXR A;  2GHU A;  2PNS A;  4HWY A;  1E2T A;  2IPP B;  3I06 A;  4CDE B;  2HHN A;  1CS8 A;  4CDC B;  4I07 A;  1JQP A;  3IEJ A;  3H7D A;  2R9F A;  5EGW A;  1EWL A;  1BGO A;  2OZ2 A;  1U9Q X;  5F02 A;  3MHH A;  1F2A A;  1GMY A;  1Y4H A;  1TLO A;  2P7U A;  4MSX A;  4FK5 A;  2AS8 A;  3IUT A;  2CIO A;  2E01 A;  1AU3 A;  1EWM A;  3QT4 A;  4I05 A;  1ME4 A;  2E03 A;  3CBJ A;  4BS5 A;  3CH3 X;  4Q8H A;  1A6R A;  2BDZ A;  1EF7 A;  3N3K A;  1EWO A;  3DF0 A;  2VFC A;  4BSQ A;  1BY8 A;  2P86 A;  1BQI A;  3H8C A;  2VFB A;  3KWZ A;  4AXM A;  4P6G A;  1U9X A;  4WA6 A;  3BWK A;  3V6C A;  4QH6 A;  3IV2 A;  1STF E;  2YJB A;  3ERV A;  1QMY A;  3P5V A;  3CH2 X;  1W5R A;  1ZCM A;  3CBK A;  2B1N A;  2Y6E A;  1AU2 A;  3H6S A;  9PAP A;  3F75 A;  2AUZ A;  2PAD A;  3PBH A;  2DC9 A;  1AYW A;  3PDF A;  3HHI A;  1TL9 A;  1GEC E;  1GLO A;  5CVO B;  1AYU A;  5CVM A;  3P5X A;  2OUL A;  4X6J A;  3I3T A;  2H7J A;  3KSE A;  1F2C A;  2YJ2 A;  2VHF A;  1IWD A;  2AUX A;  2FYE A;  4YYR A;  1CTE A;  1CVZ A;  3OIS A;  4FIP A;  3MHS A;  5JA7 A;  1DF0 A;  3KWB X;  1AU4 A;  2XU4 A;  2ARY A;  1ZIV A;  3BC3 A;  6PAD A;  2FRA A;  1U5I A;  1AEC A;  1HUC B;  4DMX A;  1ICF A;  2DC8 A;  1MHW A;  1SNK A;  1CB5 A;  3KFQ A;  4QRG A;  2XU1 A;  3WXE A;  4YV8 A;  4BQV A;  2BSZ A;  2JQG R;  3HWN A;  2OP3 A;  3N4C A;  5CHT A;  2YJC A;  4PI3 A;  2HD5 A;  1ATK A;  2R9M A;  4W4U A;  3LTW A;  1K3B B;  4N8W A;  2DC7 A;  4W5B A;  1F2B A;  2R9O A;  4BPV A;  1YK7 A;  4B55 A;  2DCB A;  1MEM A;  3OF9 A;  3K8U A;  1CPJ A;  1PPN A;  1U9W A;  4G54 A;  1EWP A;  3LXS A;  4P6E A;  1CSB B;  2NQI A;  1THE A;  1PPP A;  2G8E A;  3N3G A;  3PNR A;  4FJC A;  2DJF B;  3D6S A;  2VHS A;  2ACT A;  1KHQ A;  2NQD B;  1ME3 A;  3OVX A;  1YAL A;  1KFX L;  3H8B A;  4C5P A;  1CV8 A;  2DC6 A;  3P5W A;  4RY2 A;  1AYV A;  1MDW A;  1NL6 A;  1CQD A;  1CJL A;  2BDL A;  2NQA A;  3USV A;  2PRE A;  3IOQ A;  4YYW A;  1AU0 A;  3HHA A;  1S4V A;  3TNX A;  4XUI A;  3H89 A;  3LFY A;  7PCK A;  1M6D A;  3S3Q A;  1ITO A;  2P0R A;  1PAD A;  2G7Y A;  1PE6 A;  4AXL A;  2HH5 A;  1NPZ A;  2DJG B;  8PCH A;  2DZY A;  1PBH A;  3BPF A;  3BOW A;  1YK8 A;  2DZZ A;  1PCI A;  1QOL A;  3B79 A;  3P5U A;  1F29 A;  2AYO A;  1XKG A;  2DCA A;  2FQ9 A;  2YJ8 A;  1GCB A;  1TU6 A;  3IHP A;  3ZUA A;  1GX3 A;  2IBI A;  4BGF A;  1QDQ A;  1AIM A;  2AVW A;  3QSD A;  2F7D A;  5CHV A;  5J94 A;  4Q8G A;  1MEG A;  2AU1 A;  1VSN A;  1MIR A;  4QBB A;  4X6I A;  3WXF A;  3NHE A;  4MZS A;  4CDF B;  3KW9 A;  4OEL A;  2E02 A;  4PAD A;  1Y08 A;  5PAD A;  3K24 A;  2WBF X;  1U9V A;  1YVB A;  4N4Z A;  3PW3 A;  2F1G A;  3O1G A;  1YT7 A;  4I04 A;  4YYS A;  4QRV A;  3RVX A;  3D9W A;  4ZUX U;  3OF8 A;  1NQC A;  1QXP A;  2R9C A;  3KX1 A;  5FPW A;  3V6E A;  3MOR A;  4NV8 A;  4YVA A;  4YYU A;  3HD3 A;  2YJ9 A;  1POP A;  4BS6 A;  4GUZ A;  2XU3 A;  4YYV A;  5JH3 A;  3U8E A;  2FO5 A;  2PBH A;  3WXG A;  4XR7 A;  1KHP A;  2AIM A;  2HXZ A;  4N79 A;  3S3R A;  4CZW A;  1DEU A;  2DCC A;  4KLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...