4N8WA

Cathepsin k - chondroitin sulfate complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
213
structure length
213
Chain Sequence
b'DSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title Structural basis of collagen fiber degradation by cathepsin K.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 66
structure length 213
sequence length 213
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2013-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4n8wA00
3H8CA 2FUDA 4QBBA 3S3QA 4AXLA 6PADA 1X9YA 1YVBA 3S3RA 2AUXA 1NL6A 1M6DA 1TLOA 1AECA 1CS8A 4W5CA 4G54A 3BPMA 1F29A 4PADA 2B1NA 4BSQA 1PPDA 3USVA 2YJ8A 4YYQA 2DCAA 1EWLA 1DF0A 5EF4A 1KXRA 2XU1A 2PADA 1BP4A 3E1ZB 1MHWA 4FIPA 1EWPA 4BQVA 1PPOA 1PBHA 1U9XA 2ATOA 3QT4A 5A24A 2FYEA 4DMXA 1GCBA 2NQAA 4N79A 2DJGB 4XUIA 4I07A 1MEMA 3BC3A 4X6JA 3P5UA 2PBHA 1CB5A 1JQPA 2FT2A 5J94A 3OISA 4CDEB 1POPA 3AI8A 3KSEA 1ZCMA 3K24A 2NQIA 1HUCB 1CTEA 2HH5A 1VJVA 3ZUAA 3LFYA 4BPVA 1F2BA 2H7JA 4CDDB 1GMYA 3V6EA 1PCIA 2DZZA 2CB5A 1ZIVA 3OF8A 3C9EA 1KHQA 4W4UA 1CJLA 4X6HA 3KX1A 2NQDB 2R9CA 2XU3A 2DCCA 2G8JA 3MHSA 1PPNA 1MS6A 4MZSA 3KWBX 1FH0A 3K9MA 1O0EA 3N3GA 9PAPA 1ICFA 1DEUA 1SNKA 2AYOA 4YV8A 3PNRA 4P6GA 3OF9A 4QRVA 2FRAA 1AU3A 3H8BA 1QMYA 4YYSA 1AU0A 3HD3A 3IV2A 2NQGA 4W5BA 5FPWA 3M99A 3BPFA 4N4ZA 1XKGA 1CSBB 3IEJA 1THEA 3HHAA 1YT7A 2P0RA 1YK7A 1Y4HA 3RVVA 2VHFA 1TL9A 5PADA 4FJCA 4X6IA 1K3BB 4BS5A 4QH6A 1PE6A 1IWDA 1YK8A 3MHHA 2G8EA 3BOWA 1F2CA 2HD5A 3DF0A 3H6SA 1U9WA 4CDFB 4WA6A 1AYUA 3RVXA 3WXGA 2BDLA 2E02A 5EGWA 4K7CA 2F7DA 3P5WA 4Q8HA 3P5VA 4P6EA 1AU2A 1NLJA 2E01A 1F2AA 3MORA 2YJBA 4OEMA 8PCHA 4HWYA 4PP1A 1CVZA 2AIMA 2XU4A 2E03A 4YYUA 4DMYA 2OULA 4BS6A 3PW3A 3HWNA 1VSNA 4I05A 3TNXA 5JH3A 3CH2X 2G6DA 3BCNA 3N3KA 4N8WA 3F5VA 1NPZA 2FRQA 4YYVA 5CHTA 1KHPA 3RVWA 3IUTA 1NB3A 4Q8GA 1ITOA 3KWZA 1EWMA 3WXEA 1ME3A 4KLBA 2AU1A 1BGOA 1KFUL 2VHSA 2Y5BA 3NHEA 3KFQA 1QDQA 2BDZA 1AYVA 2GFOA 3K8UA 2E00A 1QOLA 2CIOA 3CBKA 5CVNB 5CVMA 2DC9A 2R9NA 3CH3X 4YVAA 5JA7A 4MZOA 3H89A 2DZYA 3ERVA 1ATKA 4QRGA 2JQFR 1ME4A 2YJ9A 3I3TA 2ARYA 3H7DA 1GECE 1STFE 1GLOA 2DC6A 4AXMA 5CHVA 3O0UA 2HHNA 3WXFA 5F02A 1PADA 3P5XA 3QSDA 4QRXA 4YYRA 4CZWA 4ZUXU 1NQCA 2IBIA 2AVWA 4OELA 3MTNA 2YJCA 2B1MA 2G7YA 2OZ2A 3V6CA 1TU6A 1MEGA 1U5IA 2FQ9A 3D6SA 1PXVA 3KKUA 4YYWA 3F75A 2C0YA 1PPPA 3HHIA 2HXZA 4MSXA 3IOQA 3PDFA 2FTDA 1CV8A 1EF7A 3GCBA 1U9QX 2DJFB 2XU5A 2FO5A 1CQDA 4I04A 4CDCB 3LXSA 1KFXL 1MDWA 3PBHA 3B79A 1BQIA 1AU4A 4PI3A 1EWOA 1Q6KA 4FK5A 1MIRA 1AYWA 2GHUA 2ACTA 4XR7A 1AIMA 2DCDA 3O1GA 2YJ2A 2IPPB 2DC8A 2OP3A 3KW9A 4PP2E 2AYNA 2PNSA 1S4VA 3I06A 1QXPA 2JQGR 3CBJA 3OVZA 2R6NA 2DC7A 2DCBA 3OVXA 2F1GA 1PIPA 1CPJA 3BWKA 5K16A 7PCKA 1Y08A 3N4CA 1BY8A 3QJ3A 1SP4B 1A6RA 2R9FA 2P86A 2R9OA 1YALA 4RY2A 5CVOB 2AS8A 2PREA 2R9MA 2Y6EA 3IHPA 3IMAA 2P7UA 3U8EA 1NB5A 1U9VA 2WBFX 2AUZA 2O6XA
chains in the Genus database with same CATH superfamily
2AGAA 3H8CA 2FUDA 4QBBA 3S3QA 4AXLA 6PADA 1X9YA 1YVBA 3S3RA 2AUXA 2Z84A 1NL6A 1M6DA 1TLOA 2HWKA 1AECA 1CS8A 3PHXA 4W5CA 4G54A 4MI7A 3BPMA 1F29A 4PADA 2B1NA 4BSQA 1PPDA 3USVA 2YJ8A 3ZNHA 4YYQA 4PT5A 2DCAA 1EWLA 1DF0A 5EF4A 3PHUA 1KXRA 4D8BA 2XU1A 2PADA 1BP4A 4REZA 3E1ZB 2J7QC 4D8IA 1MHWA 4FIPA 1EWPA 4BQVA 1PPOA 1PBHA 1U9XA 2ATOA 3QT4A 5A24A 2FYEA 4DMXA 1GCBA 2NQAA 4N79A 2DJGB 4XUIA 4I07A 4OVZA 3PRMA 1MEMA 3BC3A 4X6JA 3P5UA 2PBHA 1CB5A 1JQPA 2FT2A 4BOQA 5J94A 3OISA 4CDEB 1POPA 3AI8A 3KSEA 1ZCMA 3K24A 2NQIA 1HUCB 1CTEA 2HH5A 1VJVA 3ZUAA 3LFYA 3B21A 2BTWB 4BPVA 1F2BA 2H7JA 4A5UA 3RNVA 4CDDB 1GMYA 3V6EA 1PCIA 2DZZA 2CB5A 1ZIVA 3OF8A 3BB7A 3C9EA 1KHQA 4W4UA 1CJLA 4X6HA 3KX1A 2NQDB 2R9CA 2XU3A 2DCCA 3PT2A 2G8JA 3MHSA 1PPNA 1MS6A 4RF0A 4MZSA 3KWBX 1FH0A 3K9MA 1O0EA 3N3GA 9PAPA 4OW0A 1ICFA 1DEUA 1SNKA 2AYOA 4YV8A 3PNRA 4P6GA 3OF9A 4QRVA 1DKIA 2FRAA 1AU3A 3H8BA 4BOZA 1QMYA 4YYSA 1UKFA 1AU0A 3HD3A 3IV2A 2NQGA 4W5BA 2J7QA 5FPWA 3M99A 3BPFA 4N4ZA 1XKGA 1CSBB 3IEJA 1THEA 3HHAA 1YT7A 2P0RA 1YK7A 1Y4HA 3RVVA 3TMPA 2VHFA 1TL9A 5PADA 4FJCA 4X6IA 1K3BB 4BS5A 4QH6A 1PE6A 5E6JA 1IWDA 1YK8A 3TRKA 3MHHA 3MP2A 2G8EA 4ZTBA 3BOWA 1F2CA 2HD5A 4IUMA 3DF0A 3H6SA 1U9WA 4CDFB 4WA6A 1AYUA 3RVXA 3WXGA 2BDLA 2E02A 2JRIA 5EGWA 4K7CA 4RF1A 2F7DA 3P5WA 3PSEA 4Q8HA 5EZSA 3P5VA 4P6EA 1AU2A 1NLJA 2E01A 4R3DA 1F2AA 3MORA 2YJBA 4OEMA 8PCHA 4HWYA 4PP1A 1CVZA 2AIMA 2XU4A 2E03A 4YYUA 3MJ5A 4BOUA 4DMYA 2OULA 3W30A 4BS6A 3PW3A 4M0WA 3HWNA 1VSNA 4I05A 3TNXA 4HXDB 5JH3A 3CH2X 2G6DA 3BCNA 3N3KA 4N8WA 3F5VA 1NPZA 2FRQA 4YYVA 5CHTA 1KHPA 3RVWA 3IUTA 3E9SA 1PVJA 1NB3A 2DOSA 4Q8GA 1ITOA 3KWZA 1EWMA 3WXEA 1ME3A 4KLBA 2AU1A 3BY4A 2BTWA 1BGOA 1KFUL 2VHSA 2Y5BA 5JZEA 3NHEA 3KFQA 1QDQA 2BDZA 3C0RA 1AYVA 2GFOA 3K8UA 3IFUA 2E00A 1QOLA 2CIOA 3CBKA 5CVNB 5CVMA 2DC9A 2R9NA 2UZJA 3CH3X 4BOSA 4YVAA 5JA7A 4MZOA 3H89A 2DZYA 3ERVA 3BBAA 1ATKA 4QRGA 4P16A 2JQFR 1ME4A 2YJ9A 3I3TA 4RKXA 2BU3A 2ARYA 3H7DA 1GECE 1STFE 1GLOA 2DC6A 4AXMA 5CHVA 3O0UA 2HHNA 3WXFA 5F02A 1PADA 3P5XA 3QSDA 4QRXA 4YYRA 4CZWA 4OVZB 4ZUXU 1NQCA 2IBIA 1YZBA 3PHWA 2AVWA 3PRPA 4OELA 3MTNA 2YJCA 2B1MA 2G7YA 2OZ2A 3V6CA 1TU6A 1MEGA 1U5IA 2FQ9A 4D8EA 3W31A 3D6SA 1PXVA 3MTVA 2FE8A 5EZQA 3KKUA 4YYWA 3F75A 2C0YA 1PPPA 3HHIA 4XZXA 2HXZA 4MSXA 3IOQA 3PDFA 2FTDA 1CV8A 1EF7A 4IP3A 3GCBA 1U9QX 2DJFB 2XU5A 2FO5A 1CQDA 4I04A 4CDCB 3LXSA 1KFXL 1MDWA 3PBHA 3B79A 1BQIA 1AU4A 4WURA 4PI3A 1EWOA 1Q6KA 4FK5A 1MIRA 1AYWA 2GHUA 2ACTA 4XR7A 5KO3A 1AIMA 3O65A 3O1GA 2DCDA 2YJ2A 2IPPB 2DC8A 2OP3A 3KW9A 4GUAA 4PP2E 2AYNA 2PNSA 1S4VA 2JTCA 3I06A 4RNAA 1QXPA 2JQGR 3CBJA 3OVZA 2R6NA 2DC7A 2DCBA 3OQCA 3OVXA 2F1GA 4MM3B 1PIPA 1CPJA 3BWKA 5K16A 7PCKA 1Y08A 3N4CA 1BY8A 3QJ3A 1SP4B 1A6RA 2R9FA 2P86A 2R9OA 1YALA 4RY2A 4BOPA 5CVOB 2AS8A 2PREA 2R9MA 2Y6EA 3IHPA 3IMAA 2P7UA 3U8EA 1NB5A 1U9VA 2WBFX 2AUZA 2O6XA
chains in the Genus database with same CATH topology
3H8CA 2FUDA 4QBBA 3S3QA 4AXLA 6PADA 1X9YA 1YVBA 3S3RA 2AUXA 1NL6A 1M6DA 1TLOA 1AECA 1CS8A 4W5CA 4G54A 3BPMA 1F29A 4PADA 2B1NA 4BSQA 1PPDA 3USVA 2YJ8A 4YYQA 2DCAA 1E2TA 1EWLA 1DF0A 5EF4A 1KXRA 2XU1A 2PADA 1BP4A 3E1ZB 1MHWA 4FIPA 1EWPA 4BQVA 1PPOA 1PBHA 1U9XA 2ATOA 3QT4A 5A24A 2FYEA 4DMXA 1GCBA 2NQAA 4N79A 2DJGB 4XUIA 4I07A 1MEMA 3BC3A 4X6JA 3P5UA 1W4TA 2PBHA 3LTWA 1CB5A 1JQPA 2FT2A 5J94A 3OISA 4CDEB 1POPA 3AI8A 3KSEA 1ZCMA 3K24A 2NQIA 1HUCB 1CTEA 2HH5A 1VJVA 3ZUAA 3LFYA 4BPVA 1F2BA 2H7JA 4CDDB 1GMYA 3V6EA 1PCIA 2DZZA 2CB5A 1ZIVA 3OF8A 3C9EA 1KHQA 4W4UA 1CJLA 4X6HA 3KX1A 2NQDB 2R9CA 2XU3A 2DCCA 2G8JA 3MHSA 1PPNA 1MS6A 4MZSA 3KWBX 1FH0A 3K9MA 1O0EA 3N3GA 9PAPA 1ICFA 1DEUA 1SNKA 2AYOA 4YV8A 4C5PA 3PNRA 4P6GA 3OF9A 4QRVA 2FRAA 1AU3A 3H8BA 1QMYA 4YYSA 1AU0A 3HD3A 3IV2A 2NQGA 4W5BA 5FPWA 3D9WA 3M99A 3BPFA 4N4ZA 1XKGA 1CSBB 3IEJA 1THEA 3HHAA 1YT7A 2BSZA 1YK7A 2P0RA 1Y4HA 3RVVA 2VHFA 1TL9A 5PADA 4GUZA 4FJCA 4X6IA 1K3BB 4BS5A 4QH6A 1PE6A 1IWDA 1YK8A 3MHHA 2VFBA 2G8EA 3BOWA 1F2CA 2HD5A 3DF0A 3H6SA 1U9WA 4CDFB 4WA6A 1AYUA 3RVXA 3WXGA 2BDLA 2E02A 2VFCA 5EGWA 4K7CA 2F7DA 3P5WA 4Q8HA 3P5VA 4P6EA 1AU2A 1NLJA 2E01A 1F2AA 3MORA 1W6FA 2YJBA 4OEMA 8PCHA 4HWYA 4PP1A 1CVZA 2AIMA 2XU4A 2E03A 4YYUA 4DMYA 2OULA 4BS6A 3PW3A 3HWNA 1VSNA 4I05A 3TNXA 5JH3A 3CH2X 2G6DA 3BCNA 3N3KA 4N8WA 3F5VA 1NPZA 2FRQA 4YYVA 4B55A 5CHTA 1KHPA 3RVWA 3IUTA 1NB3A 4Q8GA 1ITOA 3KWZA 4NV8A 1EWMA 3WXEA 1ME3A 4KLBA 2AU1A 1BGOA 1KFUL 2VHSA 2Y5BA 3NHEA 3KFQA 1QDQA 2BDZA 1AYVA 2GFOA 3K8UA 2E00A 1QOLA 2CIOA 3CBKA 5CVNB 5CVMA 2DC9A 2R9NA 3CH3X 4YVAA 5JA7A 4MZOA 3H89A 2DZYA 3ERVA 1ATKA 4QRGA 2JQFR 1ME4A 2YJ9A 3I3TA 2ARYA 3H7DA 1GECE 1STFE 1GLOA 2DC6A 4AXMA 5CHVA 3O0UA 2HHNA 3WXFA 4NV7A 5F02A 1PADA 3P5XA 3QSDA 4QRXA 4YYRA 4CZWA 4ZUXU 1NQCA 1W5RA 2IBIA 2AVWA 4OELA 3MTNA 2YJCA 2B1MA 2G7YA 2OZ2A 3V6CA 1TU6A 1MEGA 1U5IA 2FQ9A 3D6SA 1PXVA 3KKUA 4YYWA 3F75A 2C0YA 4BGFA 1PPPA 3HHIA 2HXZA 4MSXA 3IOQA 3PDFA 2FTDA 1CV8A 1EF7A 3GCBA 1U9QX 2DJFB 2XU5A 2FO5A 1CQDA 4I04A 4CDCB 3LXSA 1KFXL 1MDWA 3PBHA 3B79A 1BQIA 1AU4A 4PI3A 1EWOA 1Q6KA 4FK5A 1MIRA 1AYWA 2GHUA 2ACTA 4XR7A 1AIMA 2DCDA 3O1GA 2YJ2A 2IPPB 2DC8A 2OP3A 3KW9A 4PP2E 2AYNA 1GX3A 2PNSA 1S4VA 3I06A 1QXPA 2JQGR 3CBJA 3OVZA 2R6NA 2DC7A 2DCBA 3OVXA 2F1GA 1PIPA 1CPJA 3BWKA 5K16A 7PCKA 1Y08A 3N4CA 1BY8A 3QJ3A 1SP4B 1A6RA 2R9FA 2P86A 2R9OA 1YALA 4RY2A 5CVOB 2AS8A 2PREA 2R9MA 2Y6EA 3IHPA 3IMAA 2P7UA 3U8EA 1NB5A 1U9VA 2WBFX 2AUZA 2O6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H8C A;  2FUD A;  4QBB A;  3S3Q A;  4AXL A;  6PAD A;  1X9Y A;  1YVB A;  3S3R A;  2AUX A;  1NL6 A;  1M6D A;  1TLO A;  1AEC A;  1CS8 A;  4W5C A;  4G54 A;  3BPM A;  1F29 A;  4PAD A;  2B1N A;  4BSQ A;  1PPD A;  3USV A;  2YJ8 A;  4YYQ A;  2DCA A;  1EWL A;  1DF0 A;  5EF4 A;  1KXR A;  2XU1 A;  2PAD A;  1BP4 A;  3E1Z B;  1MHW A;  4FIP A;  1EWP A;  4BQV A;  1PPO A;  1PBH A;  1U9X A;  2ATO A;  3QT4 A;  5A24 A;  2FYE A;  4DMX A;  1GCB A;  2NQA A;  4N79 A;  2DJG B;  4XUI A;  4I07 A;  1MEM A;  3BC3 A;  4X6J A;  3P5U A;  2PBH A;  1CB5 A;  1JQP A;  2FT2 A;  5J94 A;  3OIS A;  4CDE B;  1POP A;  3AI8 A;  3KSE A;  1ZCM A;  3K24 A;  2NQI A;  1HUC B;  1CTE A;  2HH5 A;  1VJV A;  3ZUA A;  3LFY A;  4BPV A;  1F2B A;  2H7J A;  4CDD B;  1GMY A;  3V6E A;  1PCI A;  2DZZ A;  2CB5 A;  1ZIV A;  3OF8 A;  3C9E A;  1KHQ A;  4W4U A;  1CJL A;  4X6H A;  3KX1 A;  2NQD B;  2R9C A;  2XU3 A;  2DCC A;  2G8J A;  3MHS A;  1PPN A;  1MS6 A;  4MZS A;  3KWB X;  1FH0 A;  3K9M A;  1O0E A;  3N3G A;  9PAP A;  1ICF A;  1DEU A;  1SNK A;  2AYO A;  4YV8 A;  3PNR A;  4P6G A;  3OF9 A;  4QRV A;  2FRA A;  1AU3 A;  3H8B A;  1QMY A;  4YYS A;  1AU0 A;  3HD3 A;  3IV2 A;  2NQG A;  4W5B A;  5FPW A;  3M99 A;  3BPF A;  4N4Z A;  1XKG A;  1CSB B;  3IEJ A;  1THE A;  3HHA A;  1YT7 A;  2P0R A;  1YK7 A;  1Y4H A;  3RVV A;  2VHF A;  1TL9 A;  5PAD A;  4FJC A;  4X6I A;  1K3B B;  4BS5 A;  4QH6 A;  1PE6 A;  1IWD A;  1YK8 A;  3MHH A;  2G8E A;  3BOW A;  1F2C A;  2HD5 A;  3DF0 A;  3H6S A;  1U9W A;  4CDF B;  4WA6 A;  1AYU A;  3RVX A;  3WXG A;  2BDL A;  2E02 A;  5EGW A;  4K7C A;  2F7D A;  3P5W A;  4Q8H A;  3P5V A;  4P6E A;  1AU2 A;  1NLJ A;  2E01 A;  1F2A A;  3MOR A;  2YJB A;  4OEM A;  8PCH A;  4HWY A;  4PP1 A;  1CVZ A;  2AIM A;  2XU4 A;  2E03 A;  4YYU A;  4DMY A;  2OUL A;  4BS6 A;  3PW3 A;  3HWN A;  1VSN A;  4I05 A;  3TNX A;  5JH3 A;  3CH2 X;  2G6D A;  3BCN A;  3N3K A;  4N8W A;  3F5V A;  1NPZ A;  2FRQ A;  4YYV A;  5CHT A;  1KHP A;  3RVW A;  3IUT A;  1NB3 A;  4Q8G A;  1ITO A;  3KWZ A;  1EWM A;  3WXE A;  1ME3 A;  4KLB A;  2AU1 A;  1BGO A;  1KFU L;  2VHS A;  2Y5B A;  3NHE A;  3KFQ A;  1QDQ A;  2BDZ A;  1AYV A;  2GFO A;  3K8U A;  2E00 A;  1QOL A;  2CIO A;  3CBK A;  5CVN B;  5CVM A;  2DC9 A;  2R9N A;  3CH3 X;  4YVA A;  5JA7 A;  4MZO A;  3H89 A;  2DZY A;  3ERV A;  1ATK A;  4QRG A;  2JQF R;  1ME4 A;  2YJ9 A;  3I3T A;  2ARY A;  3H7D A;  1GEC E;  1STF E;  1GLO A;  2DC6 A;  4AXM A;  5CHV A;  3O0U A;  2HHN A;  3WXF A;  5F02 A;  1PAD A;  3P5X A;  3QSD A;  4QRX A;  4YYR A;  4CZW A;  4ZUX U;  1NQC A;  2IBI A;  2AVW A;  4OEL A;  3MTN A;  2YJC A;  2B1M A;  2G7Y A;  2OZ2 A;  3V6C A;  1TU6 A;  1MEG A;  1U5I A;  2FQ9 A;  3D6S A;  1PXV A;  3KKU A;  4YYW A;  3F75 A;  2C0Y A;  1PPP A;  3HHI A;  2HXZ A;  4MSX A;  3IOQ A;  3PDF A;  2FTD A;  1CV8 A;  1EF7 A;  3GCB A;  1U9Q X;  2DJF B;  2XU5 A;  2FO5 A;  1CQD A;  4I04 A;  4CDC B;  3LXS A;  1KFX L;  1MDW A;  3PBH A;  3B79 A;  1BQI A;  1AU4 A;  4PI3 A;  1EWO A;  1Q6K A;  4FK5 A;  1MIR A;  1AYW A;  2GHU A;  2ACT A;  4XR7 A;  1AIM A;  2DCD A;  3O1G A;  2YJ2 A;  2IPP B;  2DC8 A;  2OP3 A;  3KW9 A;  4PP2 E;  2AYN A;  2PNS A;  1S4V A;  3I06 A;  1QXP A;  2JQG R;  3CBJ A;  3OVZ A;  2R6N A;  2DC7 A;  2DCB A;  3OVX A;  2F1G A;  1PIP A;  1CPJ A;  3BWK A;  5K16 A;  7PCK A;  1Y08 A;  3N4C A;  1BY8 A;  3QJ3 A;  1SP4 B;  1A6R A;  2R9F A;  2P86 A;  2R9O A;  1YAL A;  4RY2 A;  5CVO B;  2AS8 A;  2PRE A;  2R9M A;  2Y6E A;  3IHP A;  3IMA A;  2P7U A;  3U8E A;  1NB5 A;  1U9V A;  2WBF X;  2AUZ A;  2O6X A; 
#chains in the Genus database with same CATH topology
 2AGA A;  3H8C A;  2FUD A;  4QBB A;  3S3Q A;  4AXL A;  6PAD A;  1X9Y A;  1YVB A;  3S3R A;  2AUX A;  2Z84 A;  1NL6 A;  1M6D A;  1TLO A;  2HWK A;  1AEC A;  1CS8 A;  3PHX A;  4W5C A;  4G54 A;  4MI7 A;  3BPM A;  1F29 A;  4PAD A;  2B1N A;  4BSQ A;  1PPD A;  3USV A;  2YJ8 A;  3ZNH A;  4YYQ A;  4PT5 A;  2DCA A;  1EWL A;  1DF0 A;  5EF4 A;  3PHU A;  1KXR A;  4D8B A;  2XU1 A;  2PAD A;  1BP4 A;  4REZ A;  3E1Z B;  2J7Q C;  4D8I A;  1MHW A;  4FIP A;  1EWP A;  4BQV A;  1PPO A;  1PBH A;  1U9X A;  2ATO A;  3QT4 A;  5A24 A;  2FYE A;  4DMX A;  1GCB A;  2NQA A;  4N79 A;  2DJG B;  4XUI A;  4I07 A;  4OVZ A;  3PRM A;  1MEM A;  3BC3 A;  4X6J A;  3P5U A;  2PBH A;  1CB5 A;  1JQP A;  2FT2 A;  4BOQ A;  5J94 A;  3OIS A;  4CDE B;  1POP A;  3AI8 A;  3KSE A;  1ZCM A;  3K24 A;  2NQI A;  1HUC B;  1CTE A;  2HH5 A;  1VJV A;  3ZUA A;  3LFY A;  3B21 A;  2BTW B;  4BPV A;  1F2B A;  2H7J A;  4A5U A;  3RNV A;  4CDD B;  1GMY A;  3V6E A;  1PCI A;  2DZZ A;  2CB5 A;  1ZIV A;  3OF8 A;  3BB7 A;  3C9E A;  1KHQ A;  4W4U A;  1CJL A;  4X6H A;  3KX1 A;  2NQD B;  2R9C A;  2XU3 A;  2DCC A;  3PT2 A;  2G8J A;  3MHS A;  1PPN A;  1MS6 A;  4RF0 A;  4MZS A;  3KWB X;  1FH0 A;  3K9M A;  1O0E A;  3N3G A;  9PAP A;  4OW0 A;  1ICF A;  1DEU A;  1SNK A;  2AYO A;  4YV8 A;  3PNR A;  4P6G A;  3OF9 A;  4QRV A;  1DKI A;  2FRA A;  1AU3 A;  3H8B A;  4BOZ A;  1QMY A;  4YYS A;  1UKF A;  1AU0 A;  3HD3 A;  3IV2 A;  2NQG A;  4W5B A;  2J7Q A;  5FPW A;  3M99 A;  3BPF A;  4N4Z A;  1XKG A;  1CSB B;  3IEJ A;  1THE A;  3HHA A;  1YT7 A;  2P0R A;  1YK7 A;  1Y4H A;  3RVV A;  3TMP A;  2VHF A;  1TL9 A;  5PAD A;  4FJC A;  4X6I A;  1K3B B;  4BS5 A;  4QH6 A;  1PE6 A;  5E6J A;  1IWD A;  1YK8 A;  3TRK A;  3MHH A;  3MP2 A;  2G8E A;  4ZTB A;  3BOW A;  1F2C A;  2HD5 A;  4IUM A;  3DF0 A;  3H6S A;  1U9W A;  4CDF B;  4WA6 A;  1AYU A;  3RVX A;  3WXG A;  2BDL A;  2E02 A;  2JRI A;  5EGW A;  4K7C A;  4RF1 A;  2F7D A;  3P5W A;  3PSE A;  4Q8H A;  5EZS A;  3P5V A;  4P6E A;  1AU2 A;  1NLJ A;  2E01 A;  4R3D A;  1F2A A;  3MOR A;  2YJB A;  4OEM A;  8PCH A;  4HWY A;  4PP1 A;  1CVZ A;  2AIM A;  2XU4 A;  2E03 A;  4YYU A;  3MJ5 A;  4BOU A;  4DMY A;  2OUL A;  3W30 A;  4BS6 A;  3PW3 A;  4M0W A;  3HWN A;  1VSN A;  4I05 A;  3TNX A;  4HXD B;  5JH3 A;  3CH2 X;  2G6D A;  3BCN A;  3N3K A;  4N8W A;  3F5V A;  1NPZ A;  2FRQ A;  4YYV A;  5CHT A;  1KHP A;  3RVW A;  3IUT A;  3E9S A;  1PVJ A;  1NB3 A;  2DOS A;  4Q8G A;  1ITO A;  3KWZ A;  1EWM A;  3WXE A;  1ME3 A;  4KLB A;  2AU1 A;  3BY4 A;  2BTW A;  1BGO A;  1KFU L;  2VHS A;  2Y5B A;  5JZE A;  3NHE A;  3KFQ A;  1QDQ A;  2BDZ A;  3C0R A;  1AYV A;  2GFO A;  3K8U A;  3IFU A;  2E00 A;  1QOL A;  2CIO A;  3CBK A;  5CVN B;  5CVM A;  2DC9 A;  2R9N A;  2UZJ A;  3CH3 X;  4BOS A;  4YVA A;  5JA7 A;  4MZO A;  3H89 A;  2DZY A;  3ERV A;  3BBA A;  1ATK A;  4QRG A;  4P16 A;  2JQF R;  1ME4 A;  2YJ9 A;  3I3T A;  4RKX A;  2BU3 A;  2ARY A;  3H7D A;  1GEC E;  1STF E;  1GLO A;  2DC6 A;  4AXM A;  5CHV A;  3O0U A;  2HHN A;  3WXF A;  5F02 A;  1PAD A;  3P5X A;  3QSD A;  4QRX A;  4YYR A;  4CZW A;  4OVZ B;  4ZUX U;  1NQC A;  2IBI A;  1YZB A;  3PHW A;  2AVW A;  3PRP A;  4OEL A;  3MTN A;  2YJC A;  2B1M A;  2G7Y A;  2OZ2 A;  3V6C A;  1TU6 A;  1MEG A;  1U5I A;  2FQ9 A;  4D8E A;  3W31 A;  3D6S A;  1PXV A;  3MTV A;  2FE8 A;  5EZQ A;  3KKU A;  4YYW A;  3F75 A;  2C0Y A;  1PPP A;  3HHI A;  4XZX A;  2HXZ A;  4MSX A;  3IOQ A;  3PDF A;  2FTD A;  1CV8 A;  1EF7 A;  4IP3 A;  3GCB A;  1U9Q X;  2DJF B;  2XU5 A;  2FO5 A;  1CQD A;  4I04 A;  4CDC B;  3LXS A;  1KFX L;  1MDW A;  3PBH A;  3B79 A;  1BQI A;  1AU4 A;  4WUR A;  4PI3 A;  1EWO A;  1Q6K A;  4FK5 A;  1MIR A;  1AYW A;  2GHU A;  2ACT A;  4XR7 A;  5KO3 A;  1AIM A;  3O65 A;  3O1G A;  2DCD A;  2YJ2 A;  2IPP B;  2DC8 A;  2OP3 A;  3KW9 A;  4GUA A;  4PP2 E;  2AYN A;  2PNS A;  1S4V A;  2JTC A;  3I06 A;  4RNA A;  1QXP A;  2JQG R;  3CBJ A;  3OVZ A;  2R6N A;  2DC7 A;  2DCB A;  3OQC A;  3OVX A;  2F1G A;  4MM3 B;  1PIP A;  1CPJ A;  3BWK A;  5K16 A;  7PCK A;  1Y08 A;  3N4C A;  1BY8 A;  3QJ3 A;  1SP4 B;  1A6R A;  2R9F A;  2P86 A;  2R9O A;  1YAL A;  4RY2 A;  4BOP A;  5CVO B;  2AS8 A;  2PRE A;  2R9M A;  2Y6E A;  3IHP A;  3IMA A;  2P7U A;  3U8E A;  1NB5 A;  1U9V A;  2WBF X;  2AUZ A;  2O6X A; 
#chains in the Genus database with same CATH homology
 3H8C A;  2FUD A;  4QBB A;  3S3Q A;  4AXL A;  6PAD A;  1X9Y A;  1YVB A;  3S3R A;  2AUX A;  1NL6 A;  1M6D A;  1TLO A;  1AEC A;  1CS8 A;  4W5C A;  4G54 A;  3BPM A;  1F29 A;  4PAD A;  2B1N A;  4BSQ A;  1PPD A;  3USV A;  2YJ8 A;  4YYQ A;  2DCA A;  1E2T A;  1EWL A;  1DF0 A;  5EF4 A;  1KXR A;  2XU1 A;  2PAD A;  1BP4 A;  3E1Z B;  1MHW A;  4FIP A;  1EWP A;  4BQV A;  1PPO A;  1PBH A;  1U9X A;  2ATO A;  3QT4 A;  5A24 A;  2FYE A;  4DMX A;  1GCB A;  2NQA A;  4N79 A;  2DJG B;  4XUI A;  4I07 A;  1MEM A;  3BC3 A;  4X6J A;  3P5U A;  1W4T A;  2PBH A;  3LTW A;  1CB5 A;  1JQP A;  2FT2 A;  5J94 A;  3OIS A;  4CDE B;  1POP A;  3AI8 A;  3KSE A;  1ZCM A;  3K24 A;  2NQI A;  1HUC B;  1CTE A;  2HH5 A;  1VJV A;  3ZUA A;  3LFY A;  4BPV A;  1F2B A;  2H7J A;  4CDD B;  1GMY A;  3V6E A;  1PCI A;  2DZZ A;  2CB5 A;  1ZIV A;  3OF8 A;  3C9E A;  1KHQ A;  4W4U A;  1CJL A;  4X6H A;  3KX1 A;  2NQD B;  2R9C A;  2XU3 A;  2DCC A;  2G8J A;  3MHS A;  1PPN A;  1MS6 A;  4MZS A;  3KWB X;  1FH0 A;  3K9M A;  1O0E A;  3N3G A;  9PAP A;  1ICF A;  1DEU A;  1SNK A;  2AYO A;  4YV8 A;  4C5P A;  3PNR A;  4P6G A;  3OF9 A;  4QRV A;  2FRA A;  1AU3 A;  3H8B A;  1QMY A;  4YYS A;  1AU0 A;  3HD3 A;  3IV2 A;  2NQG A;  4W5B A;  5FPW A;  3D9W A;  3M99 A;  3BPF A;  4N4Z A;  1XKG A;  1CSB B;  3IEJ A;  1THE A;  3HHA A;  1YT7 A;  2BSZ A;  1YK7 A;  2P0R A;  1Y4H A;  3RVV A;  2VHF A;  1TL9 A;  5PAD A;  4GUZ A;  4FJC A;  4X6I A;  1K3B B;  4BS5 A;  4QH6 A;  1PE6 A;  1IWD A;  1YK8 A;  3MHH A;  2VFB A;  2G8E A;  3BOW A;  1F2C A;  2HD5 A;  3DF0 A;  3H6S A;  1U9W A;  4CDF B;  4WA6 A;  1AYU A;  3RVX A;  3WXG A;  2BDL A;  2E02 A;  2VFC A;  5EGW A;  4K7C A;  2F7D A;  3P5W A;  4Q8H A;  3P5V A;  4P6E A;  1AU2 A;  1NLJ A;  2E01 A;  1F2A A;  3MOR A;  1W6F A;  2YJB A;  4OEM A;  8PCH A;  4HWY A;  4PP1 A;  1CVZ A;  2AIM A;  2XU4 A;  2E03 A;  4YYU A;  4DMY A;  2OUL A;  4BS6 A;  3PW3 A;  3HWN A;  1VSN A;  4I05 A;  3TNX A;  5JH3 A;  3CH2 X;  2G6D A;  3BCN A;  3N3K A;  4N8W A;  3F5V A;  1NPZ A;  2FRQ A;  4YYV A;  4B55 A;  5CHT A;  1KHP A;  3RVW A;  3IUT A;  1NB3 A;  4Q8G A;  1ITO A;  3KWZ A;  4NV8 A;  1EWM A;  3WXE A;  1ME3 A;  4KLB A;  2AU1 A;  1BGO A;  1KFU L;  2VHS A;  2Y5B A;  3NHE A;  3KFQ A;  1QDQ A;  2BDZ A;  1AYV A;  2GFO A;  3K8U A;  2E00 A;  1QOL A;  2CIO A;  3CBK A;  5CVN B;  5CVM A;  2DC9 A;  2R9N A;  3CH3 X;  4YVA A;  5JA7 A;  4MZO A;  3H89 A;  2DZY A;  3ERV A;  1ATK A;  4QRG A;  2JQF R;  1ME4 A;  2YJ9 A;  3I3T A;  2ARY A;  3H7D A;  1GEC E;  1STF E;  1GLO A;  2DC6 A;  4AXM A;  5CHV A;  3O0U A;  2HHN A;  3WXF A;  4NV7 A;  5F02 A;  1PAD A;  3P5X A;  3QSD A;  4QRX A;  4YYR A;  4CZW A;  4ZUX U;  1NQC A;  1W5R A;  2IBI A;  2AVW A;  4OEL A;  3MTN A;  2YJC A;  2B1M A;  2G7Y A;  2OZ2 A;  3V6C A;  1TU6 A;  1MEG A;  1U5I A;  2FQ9 A;  3D6S A;  1PXV A;  3KKU A;  4YYW A;  3F75 A;  2C0Y A;  4BGF A;  1PPP A;  3HHI A;  2HXZ A;  4MSX A;  3IOQ A;  3PDF A;  2FTD A;  1CV8 A;  1EF7 A;  3GCB A;  1U9Q X;  2DJF B;  2XU5 A;  2FO5 A;  1CQD A;  4I04 A;  4CDC B;  3LXS A;  1KFX L;  1MDW A;  3PBH A;  3B79 A;  1BQI A;  1AU4 A;  4PI3 A;  1EWO A;  1Q6K A;  4FK5 A;  1MIR A;  1AYW A;  2GHU A;  2ACT A;  4XR7 A;  1AIM A;  2DCD A;  3O1G A;  2YJ2 A;  2IPP B;  2DC8 A;  2OP3 A;  3KW9 A;  4PP2 E;  2AYN A;  1GX3 A;  2PNS A;  1S4V A;  3I06 A;  1QXP A;  2JQG R;  3CBJ A;  3OVZ A;  2R6N A;  2DC7 A;  2DCB A;  3OVX A;  2F1G A;  1PIP A;  1CPJ A;  3BWK A;  5K16 A;  7PCK A;  1Y08 A;  3N4C A;  1BY8 A;  3QJ3 A;  1SP4 B;  1A6R A;  2R9F A;  2P86 A;  2R9O A;  1YAL A;  4RY2 A;  5CVO B;  2AS8 A;  2PRE A;  2R9M A;  2Y6E A;  3IHP A;  3IMA A;  2P7U A;  3U8E A;  1NB5 A;  1U9V A;  2WBF X;  2AUZ A;  2O6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...