4N8WA

Cathepsin k - chondroitin sulfate complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
213
structure length
213
Chain Sequence
DSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title Structural basis of collagen fiber degradation by cathepsin K.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 66
structure length 213
sequence length 213
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2013-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4n8wA00
2YJCA 4K7CA 3N3GA 2OP3A 3RVWA 3K8UA 3KWBX 1AU2A 5JA7A 1ME4A 3V6EA 1O0EA 1AIMA 1DEUA 1CQDA 2B1MA 1YK8A 1FH0A 3M99A 5F02A 1PPPA 1PBHA 4MZSA 3C9EA 4HWYA 3WXFA 3OVZA 1U5IA 4PP2E 4BSQA 4CDEB 9PAPA 2WBFX 3S3QA 2DC7A 1XKGA 2FYEA 3CBKA 3HD3A 5A24A 1NLJA 4QBBA 1EWLA 2DJGB 2DC6A 5CVMA 2NQIA 1TU6A 5CVOB 3BPFA 5J94A 3MORA 2FT2A 2IPPB 2OULA 3HHIA 1ICFA 3USVA 5EF4A 3U8EA 3S3RA 3F75A 2BDLA 2YJ8A 2JQFR 1PIPA 3PBHA 2G7YA 4I07A 4PADA 3LFYA 2DCCA 2DCAA 3K24A 4PI3A 4BS5A 4Q8GA 3WXEA 4QRXA 1AU3A 2YJ9A 3CH3X 4BPVA 4AXMA 1STFE 1K3BB 1X9YA 3N4CA 2PNSA 1PPNA 1BY8A 2NQDB 2VHSA 2AYOA 2DC9A 2FQ9A 2AS8A 3KWZA 3O1GA 1CB5A 3P5UA 2GFOA 4YYSA 3IV2A 3HWNA 3PNRA 8PCHA 3MHSA 2F1GA 1KFUL 1KHPA 4W5BA 1Y08A 3MTNA 1KHQA 5CVNB 2E03A 4BQVA 1CV8A 2DC8A 4ZUXU 1PCIA 2DZZA 1EWOA 1TLOA 6PADA 4YYVA 1PPOA 2H7JA 3O0UA 1EWPA 1CS8A 1AYWA 4QRGA 1CTEA 1IWDA 1SNKA 4YYUA 3BWKA 3DF0A 3KSEA 4G54A 1Q6KA 1Y4HA 2FO5A 4DMXA 1QXPA 1AYUA 1BGOA 1NB5A 3H8BA 1YT7A 1NPZA 4AXLA 2XU5A 4CDFB 3B79A 2HHNA 3BC3A 2HXZA 3V6CA 3I06A 3KW9A 4YVAA 1MS6A 2GHUA 1ATKA 4N79A 1PXVA 3IHPA 3IOQA 2Y6EA 1BQIA 5CHVA 1U9QX 1U9WA 5PADA 5CHTA 2FUDA 2E01A 1PADA 2AU1A 1CPJA 3KKUA 4FJCA 3QT4A 3H6SA 4X6JA 2R6NA 4PP1A 4Q8HA 1EWMA 1THEA 3OF8A 4QH6A 1BP4A 2FTDA 1QMYA 2HH5A 3KFQA 3BCNA 1NL6A 4XUIA 1DF0A 1VJVA 4I04A 2E00A 1PPDA 3WXGA 2ATOA 2R9CA 3PW3A 4YYRA 3P5VA 4OEMA 3BPMA 4OELA 1KXRA 4KLBA 3N3KA 4YYWA 4CDCB 1GECE 1ZCMA 5FPWA 3RVVA 2R9NA 3MHHA 2P0RA 1MHWA 2FRAA 2DJFB 2CIOA 2P7UA 3CH2X 4BS6A 2R9MA 3D6SA 1NB3A 2VHFA 2DCDA 4P6EA 3NHEA 2Y5BA 4DMYA 1AYVA 2FRQA 2F7DA 7PCKA 4QRVA 3P5WA 5K16A 1VSNA 3IUTA 2B1NA 4MZOA 2ACTA 1YALA 3LXSA 2AYNA 3I3TA 4P6GA 2R9FA 2XU3A 3K9MA 2JQGR 1AU0A 4W5CA 1QOLA 5JH3A 2E02A 2HD5A 2DZYA 3KX1A 3H89A 1GMYA 4W4UA 1AECA 1F2AA 2XU4A 3PDFA 4YYQA 2P86A 3IMAA 2CB5A 4YV8A 3P5XA 2DCBA 1TL9A 1MEGA 4CZWA 2YJ2A 2YJBA 3TNXA 2ARYA 2PREA 1KFXL 3CBJA 2PADA 1ZIVA 2G8JA 4FIPA 1GCBA 2OZ2A 3GCBA 3HHAA 3QSDA 1AU4A 4I05A 1QDQA 5EGWA 4X6HA 4FK5A 4N8WA 3RVXA 3ERVA 1CVZA 4XR7A 3OF9A 1F29A 3BOWA 1F2CA 2G6DA 1HUCB 1M6DA 1POPA 4CDDB 1YK7A 3OISA 1ME3A 4WA6A 1ITOA 2AIMA 2AVWA 1MDWA 3H7DA 3F5VA 2AUZA 3IEJA 1PE6A 3H8CA 1JQPA 4MSXA 1SP4B 3E1ZB 2AUXA 2BDZA 1NQCA 2NQAA 1YVBA 2IBIA 4N4ZA 1A6RA 3QJ3A 2C0YA 1U9VA 2G8EA 2R9OA 3ZUAA 1EF7A 1GLOA 2O6XA 2XU1A 2PBHA 1CSBB 2NQGA 4X6IA 1MIRA 1S4VA 1CJLA 3AI8A 4RY2A 1MEMA 3OVXA 1F2BA 1U9XA
chains in the Genus database with same CATH superfamily
1PVJA 2YJCA 4K7CA 3N3GA 2OP3A 2JTCA 3RVWA 3K8UA 3KWBX 1AU2A 5JA7A 3PT2A 1ME4A 3V6EA 1O0EA 4D8EA 1AIMA 1DEUA 1CQDA 4P16A 2B1MA 3RNVA 1YK8A 1FH0A 3M99A 5F02A 1PPPA 1PBHA 4MZSA 3C9EA 4HWYA 1DKIA 3WXFA 3OVZA 4A5UA 1U5IA 4PP2E 4BSQA 4CDEB 9PAPA 2WBFX 3S3QA 4BOSA 2DC7A 1XKGA 2FYEA 3B21A 3CBKA 3HD3A 5A24A 1NLJA 4QBBA 1EWLA 2DJGB 2DC6A 5CVMA 2NQIA 1TU6A 5CVOB 4BOZA 3BPFA 5JZEA 5J94A 3MORA 2FT2A 2IPPB 3MJ5A 2OULA 3BY4A 3HHIA 4RNAA 1ICFA 2J7QC 3USVA 5EF4A 3U8EA 3S3RA 3F75A 2BDLA 2AGAA 2YJ8A 2JQFR 1PIPA 3PBHA 2G7YA 4I07A 4PADA 3LFYA 2DCCA 2DCAA 3K24A 3TRKA 4PI3A 4BS5A 3MTVA 4Q8GA 3WXEA 4QRXA 1AU3A 2YJ9A 2FE8A 3CH3X 4BPVA 4AXMA 1STFE 1K3BB 3TMPA 2JRIA 4PT5A 1X9YA 3N4CA 2PNSA 3BBAA 1PPNA 1BY8A 3PHUA 2NQDB 2VHSA 2AYOA 5EZSA 2DC9A 2FQ9A 2AS8A 3KWZA 3O1GA 1CB5A 3P5UA 2GFOA 4MI7A 4YYSA 3IV2A 3HWNA 3PNRA 8PCHA 3MHSA 2F1GA 1KFUL 1KHPA 1UKFA 3IFUA 4W5BA 2Z84A 1Y08A 3MTNA 1KHQA 5CVNB 2E03A 4BQVA 1CV8A 2DC8A 4ZUXU 1PCIA 2DZZA 1EWOA 1TLOA 6PADA 4YYVA 1PPOA 2H7JA 3O0UA 2BTWA 1EWPA 1CS8A 1AYWA 4QRGA 1CTEA 1IWDA 1SNKA 4YYUA 3BWKA 3DF0A 3KSEA 4G54A 1Q6KA 1Y4HA 2FO5A 4DMXA 1QXPA 1AYUA 3E9SA 1BGOA 2BTWB 1NB5A 3H8BA 1YT7A 1NPZA 4AXLA 2XU5A 4CDFB 3B79A 2HHNA 3BC3A 2HXZA 3V6CA 3W30A 3I06A 3KW9A 4YVAA 1MS6A 2GHUA 1ATKA 4WURA 4N79A 1PXVA 3IHPA 3IOQA 2Y6EA 1BQIA 5CHVA 1U9QX 1U9WA 5PADA 5CHTA 2FUDA 2E01A 1PADA 3PRMA 3OQCA 2AU1A 1CPJA 3KKUA 4ZTBA 4FJCA 3QT4A 3H6SA 4X6JA 2R6NA 4PP1A 4Q8HA 1EWMA 1THEA 3OF8A 4QH6A 1BP4A 2FTDA 1QMYA 2HH5A 4BOQA 3KFQA 3BCNA 1NL6A 4XUIA 1DF0A 1VJVA 4I04A 2E00A 1PPDA 3WXGA 2ATOA 4REZA 2R9CA 3PW3A 4YYRA 3P5VA 4OEMA 3BPMA 4OELA 1KXRA 4KLBA 3N3KA 4YYWA 4RF0A 4CDCB 1GECE 1ZCMA 5FPWA 2HWKA 3RVVA 2R9NA 3MHHA 5E6JA 3O65A 2P0RA 1MHWA 2FRAA 2DJFB 2CIOA 2P7UA 3CH2X 4D8BA 4BS6A 2R9MA 3D6SA 1NB3A 5EZQA 3ZNHA 2VHFA 3PHXA 4IP3A 2DCDA 4P6EA 3NHEA 2Y5BA 4DMYA 1AYVA 1YZBA 3C0RA 2FRQA 2F7DA 7PCKA 4QRVA 3P5WA 5K16A 1VSNA 3IUTA 2B1NA 4MZOA 3W31A 2ACTA 1YALA 3LXSA 2AYNA 3I3TA 4P6GA 2R9FA 2XU3A 3K9MA 2JQGR 1AU0A 4W5CA 1QOLA 2BU3A 5JH3A 2E02A 2HD5A 2DZYA 3KX1A 3H89A 4OVZB 1GMYA 4W4UA 1AECA 1F2AA 2J7QA 2XU4A 4IUMA 3PDFA 4YYQA 2P86A 3IMAA 2CB5A 4YV8A 4BOUA 3P5XA 2DCBA 1TL9A 1MEGA 4CZWA 2YJ2A 2YJBA 3TNXA 2ARYA 2PREA 3PSEA 1KFXL 3CBJA 3BB7A 2PADA 1ZIVA 4M0WA 2G8JA 4FIPA 1GCBA 2OZ2A 3GCBA 3HHAA 3QSDA 1AU4A 4I05A 1QDQA 5EGWA 4X6HA 4FK5A 4N8WA 3RVXA 3ERVA 1CVZA 4GUAA 3MP2A 4XR7A 3OF9A 4MM3B 1F29A 2UZJA 3PHWA 3BOWA 1F2CA 2G6DA 4D8IA 5KO3A 1HUCB 1M6DA 1POPA 4CDDB 1YK7A 3OISA 1ME3A 4WA6A 1ITOA 2AIMA 2AVWA 1MDWA 3H7DA 3F5VA 2AUZA 3IEJA 1PE6A 3H8CA 3PRPA 1JQPA 4MSXA 1SP4B 3E1ZB 2AUXA 2BDZA 1NQCA 2NQAA 1YVBA 2IBIA 4N4ZA 1A6RA 3QJ3A 2C0YA 1U9VA 4RKXA 4BOPA 2G8EA 2R9OA 3ZUAA 1EF7A 4XZXA 1GLOA 2O6XA 2XU1A 2PBHA 1CSBB 2NQGA 4X6IA 1MIRA 4R3DA 1S4VA 1CJLA 3AI8A 4RY2A 1MEMA 4RF1A 3OVXA 1F2BA 4OW0A 1U9XA 4HXDB 4OVZA 2DOSA
chains in the Genus database with same CATH topology
2YJCA 4K7CA 3N3GA 2OP3A 3RVWA 3K8UA 3KWBX 1AU2A 5JA7A 1ME4A 3V6EA 1O0EA 4GUZA 1AIMA 1DEUA 1CQDA 2B1MA 1YK8A 1FH0A 3M99A 5F02A 1PPPA 1PBHA 4MZSA 3C9EA 4HWYA 3WXFA 3OVZA 1U5IA 4PP2E 4BSQA 4CDEB 9PAPA 2WBFX 3S3QA 2DC7A 1XKGA 2FYEA 3CBKA 3HD3A 5A24A 1NLJA 4QBBA 1EWLA 2DJGB 2DC6A 5CVMA 2NQIA 1TU6A 5CVOB 3BPFA 5J94A 3MORA 2FT2A 2IPPB 2OULA 3HHIA 1ICFA 3USVA 5EF4A 3U8EA 3S3RA 3F75A 2BDLA 2YJ8A 2JQFR 1PIPA 2VFCA 3PBHA 4NV7A 2G7YA 4I07A 4PADA 3LFYA 2DCCA 2DCAA 3K24A 4PI3A 4BS5A 4Q8GA 3WXEA 4QRXA 1AU3A 2YJ9A 3CH3X 4BPVA 4AXMA 1STFE 1K3BB 1W6FA 1X9YA 3N4CA 2PNSA 1PPNA 1BY8A 2NQDB 2VHSA 2AYOA 2DC9A 2FQ9A 2AS8A 3KWZA 3O1GA 1CB5A 3P5UA 2GFOA 4YYSA 3IV2A 3HWNA 3PNRA 8PCHA 3MHSA 2F1GA 1KFUL 1KHPA 4W5BA 1Y08A 3MTNA 1KHQA 5CVNB 2E03A 4BQVA 1CV8A 2DC8A 4ZUXU 4B55A 1PCIA 2DZZA 1EWOA 1TLOA 6PADA 4YYVA 1PPOA 2H7JA 3O0UA 1EWPA 1CS8A 1AYWA 4QRGA 1CTEA 1IWDA 1SNKA 4YYUA 3BWKA 3DF0A 3KSEA 4G54A 1Q6KA 1Y4HA 2FO5A 4DMXA 1QXPA 1AYUA 4C5PA 1BGOA 1NB5A 3H8BA 1YT7A 1NPZA 4AXLA 2XU5A 2VFBA 4CDFB 3B79A 2HHNA 3BC3A 2HXZA 3V6CA 3I06A 3KW9A 4YVAA 1MS6A 2GHUA 1ATKA 4N79A 1PXVA 3IHPA 3IOQA 2Y6EA 1BQIA 5CHVA 3LTWA 1U9QX 1U9WA 5PADA 5CHTA 2FUDA 2E01A 1PADA 2AU1A 1CPJA 3KKUA 4FJCA 3QT4A 3H6SA 4X6JA 2R6NA 4PP1A 4Q8HA 1EWMA 1THEA 3OF8A 4QH6A 1BP4A 2FTDA 1QMYA 2HH5A 3KFQA 3BCNA 1NL6A 4XUIA 1DF0A 1VJVA 4I04A 2E00A 1PPDA 3WXGA 2ATOA 2R9CA 3PW3A 4YYRA 3P5VA 4OEMA 3BPMA 4OELA 1KXRA 4KLBA 3N3KA 4YYWA 4CDCB 1GECE 1ZCMA 5FPWA 3RVVA 2R9NA 3MHHA 2P0RA 3D9WA 1MHWA 2FRAA 2DJFB 2CIOA 2P7UA 3CH2X 4BS6A 2R9MA 3D6SA 1NB3A 2VHFA 2DCDA 4P6EA 3NHEA 2Y5BA 4DMYA 1AYVA 2FRQA 2F7DA 7PCKA 4QRVA 3P5WA 5K16A 1VSNA 3IUTA 2B1NA 4MZOA 2ACTA 1YALA 1E2TA 3LXSA 2AYNA 3I3TA 4P6GA 4BGFA 2R9FA 2XU3A 3K9MA 2JQGR 1AU0A 4W5CA 1QOLA 5JH3A 2E02A 2HD5A 2DZYA 3KX1A 3H89A 1GMYA 4W4UA 1AECA 1F2AA 2XU4A 3PDFA 4YYQA 2P86A 3IMAA 2CB5A 4YV8A 3P5XA 2DCBA 1TL9A 1MEGA 4CZWA 2YJ2A 2YJBA 3TNXA 2ARYA 2PREA 1KFXL 3CBJA 2PADA 1ZIVA 2G8JA 4FIPA 1GCBA 2OZ2A 3GCBA 3HHAA 3QSDA 1AU4A 4I05A 1QDQA 5EGWA 2BSZA 4X6HA 4FK5A 4N8WA 3RVXA 3ERVA 1CVZA 4XR7A 3OF9A 1F29A 3BOWA 1F2CA 2G6DA 1HUCB 1M6DA 1POPA 4CDDB 1YK7A 3OISA 1ME3A 4WA6A 1ITOA 2AIMA 2AVWA 1MDWA 3H7DA 3F5VA 2AUZA 3IEJA 1PE6A 3H8CA 1JQPA 4MSXA 1SP4B 3E1ZB 2AUXA 1GX3A 2BDZA 1NQCA 2NQAA 1YVBA 2IBIA 4N4ZA 1A6RA 3QJ3A 2C0YA 1U9VA 1W5RA 2G8EA 2R9OA 3ZUAA 4NV8A 1EF7A 1GLOA 2O6XA 2XU1A 2PBHA 1CSBB 1W4TA 2NQGA 4X6IA 1MIRA 1S4VA 1CJLA 3AI8A 4RY2A 1MEMA 3OVXA 1F2BA 1U9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YJC A;  4K7C A;  3N3G A;  2OP3 A;  3RVW A;  3K8U A;  3KWB X;  1AU2 A;  5JA7 A;  1ME4 A;  3V6E A;  1O0E A;  1AIM A;  1DEU A;  1CQD A;  2B1M A;  1YK8 A;  1FH0 A;  3M99 A;  5F02 A;  1PPP A;  1PBH A;  4MZS A;  3C9E A;  4HWY A;  3WXF A;  3OVZ A;  1U5I A;  4PP2 E;  4BSQ A;  4CDE B;  9PAP A;  2WBF X;  3S3Q A;  2DC7 A;  1XKG A;  2FYE A;  3CBK A;  3HD3 A;  5A24 A;  1NLJ A;  4QBB A;  1EWL A;  2DJG B;  2DC6 A;  5CVM A;  2NQI A;  1TU6 A;  5CVO B;  3BPF A;  5J94 A;  3MOR A;  2FT2 A;  2IPP B;  2OUL A;  3HHI A;  1ICF A;  3USV A;  5EF4 A;  3U8E A;  3S3R A;  3F75 A;  2BDL A;  2YJ8 A;  2JQF R;  1PIP A;  3PBH A;  2G7Y A;  4I07 A;  4PAD A;  3LFY A;  2DCC A;  2DCA A;  3K24 A;  4PI3 A;  4BS5 A;  4Q8G A;  3WXE A;  4QRX A;  1AU3 A;  2YJ9 A;  3CH3 X;  4BPV A;  4AXM A;  1STF E;  1K3B B;  1X9Y A;  3N4C A;  2PNS A;  1PPN A;  1BY8 A;  2NQD B;  2VHS A;  2AYO A;  2DC9 A;  2FQ9 A;  2AS8 A;  3KWZ A;  3O1G A;  1CB5 A;  3P5U A;  2GFO A;  4YYS A;  3IV2 A;  3HWN A;  3PNR A;  8PCH A;  3MHS A;  2F1G A;  1KFU L;  1KHP A;  4W5B A;  1Y08 A;  3MTN A;  1KHQ A;  5CVN B;  2E03 A;  4BQV A;  1CV8 A;  2DC8 A;  4ZUX U;  1PCI A;  2DZZ A;  1EWO A;  1TLO A;  6PAD A;  4YYV A;  1PPO A;  2H7J A;  3O0U A;  1EWP A;  1CS8 A;  1AYW A;  4QRG A;  1CTE A;  1IWD A;  1SNK A;  4YYU A;  3BWK A;  3DF0 A;  3KSE A;  4G54 A;  1Q6K A;  1Y4H A;  2FO5 A;  4DMX A;  1QXP A;  1AYU A;  1BGO A;  1NB5 A;  3H8B A;  1YT7 A;  1NPZ A;  4AXL A;  2XU5 A;  4CDF B;  3B79 A;  2HHN A;  3BC3 A;  2HXZ A;  3V6C A;  3I06 A;  3KW9 A;  4YVA A;  1MS6 A;  2GHU A;  1ATK A;  4N79 A;  1PXV A;  3IHP A;  3IOQ A;  2Y6E A;  1BQI A;  5CHV A;  1U9Q X;  1U9W A;  5PAD A;  5CHT A;  2FUD A;  2E01 A;  1PAD A;  2AU1 A;  1CPJ A;  3KKU A;  4FJC A;  3QT4 A;  3H6S A;  4X6J A;  2R6N A;  4PP1 A;  4Q8H A;  1EWM A;  1THE A;  3OF8 A;  4QH6 A;  1BP4 A;  2FTD A;  1QMY A;  2HH5 A;  3KFQ A;  3BCN A;  1NL6 A;  4XUI A;  1DF0 A;  1VJV A;  4I04 A;  2E00 A;  1PPD A;  3WXG A;  2ATO A;  2R9C A;  3PW3 A;  4YYR A;  3P5V A;  4OEM A;  3BPM A;  4OEL A;  1KXR A;  4KLB A;  3N3K A;  4YYW A;  4CDC B;  1GEC E;  1ZCM A;  5FPW A;  3RVV A;  2R9N A;  3MHH A;  2P0R A;  1MHW A;  2FRA A;  2DJF B;  2CIO A;  2P7U A;  3CH2 X;  4BS6 A;  2R9M A;  3D6S A;  1NB3 A;  2VHF A;  2DCD A;  4P6E A;  3NHE A;  2Y5B A;  4DMY A;  1AYV A;  2FRQ A;  2F7D A;  7PCK A;  4QRV A;  3P5W A;  5K16 A;  1VSN A;  3IUT A;  2B1N A;  4MZO A;  2ACT A;  1YAL A;  3LXS A;  2AYN A;  3I3T A;  4P6G A;  2R9F A;  2XU3 A;  3K9M A;  2JQG R;  1AU0 A;  4W5C A;  1QOL A;  5JH3 A;  2E02 A;  2HD5 A;  2DZY A;  3KX1 A;  3H89 A;  1GMY A;  4W4U A;  1AEC A;  1F2A A;  2XU4 A;  3PDF A;  4YYQ A;  2P86 A;  3IMA A;  2CB5 A;  4YV8 A;  3P5X A;  2DCB A;  1TL9 A;  1MEG A;  4CZW A;  2YJ2 A;  2YJB A;  3TNX A;  2ARY A;  2PRE A;  1KFX L;  3CBJ A;  2PAD A;  1ZIV A;  2G8J A;  4FIP A;  1GCB A;  2OZ2 A;  3GCB A;  3HHA A;  3QSD A;  1AU4 A;  4I05 A;  1QDQ A;  5EGW A;  4X6H A;  4FK5 A;  4N8W A;  3RVX A;  3ERV A;  1CVZ A;  4XR7 A;  3OF9 A;  1F29 A;  3BOW A;  1F2C A;  2G6D A;  1HUC B;  1M6D A;  1POP A;  4CDD B;  1YK7 A;  3OIS A;  1ME3 A;  4WA6 A;  1ITO A;  2AIM A;  2AVW A;  1MDW A;  3H7D A;  3F5V A;  2AUZ A;  3IEJ A;  1PE6 A;  3H8C A;  1JQP A;  4MSX A;  1SP4 B;  3E1Z B;  2AUX A;  2BDZ A;  1NQC A;  2NQA A;  1YVB A;  2IBI A;  4N4Z A;  1A6R A;  3QJ3 A;  2C0Y A;  1U9V A;  2G8E A;  2R9O A;  3ZUA A;  1EF7 A;  1GLO A;  2O6X A;  2XU1 A;  2PBH A;  1CSB B;  2NQG A;  4X6I A;  1MIR A;  1S4V A;  1CJL A;  3AI8 A;  4RY2 A;  1MEM A;  3OVX A;  1F2B A;  1U9X A; 
#chains in the Genus database with same CATH topology
 1PVJ A;  2YJC A;  4K7C A;  3N3G A;  2OP3 A;  2JTC A;  3RVW A;  3K8U A;  3KWB X;  1AU2 A;  5JA7 A;  3PT2 A;  1ME4 A;  3V6E A;  1O0E A;  4D8E A;  1AIM A;  1DEU A;  1CQD A;  4P16 A;  2B1M A;  3RNV A;  1YK8 A;  1FH0 A;  3M99 A;  5F02 A;  1PPP A;  1PBH A;  4MZS A;  3C9E A;  4HWY A;  1DKI A;  3WXF A;  3OVZ A;  4A5U A;  1U5I A;  4PP2 E;  4BSQ A;  4CDE B;  9PAP A;  2WBF X;  3S3Q A;  4BOS A;  2DC7 A;  1XKG A;  2FYE A;  3B21 A;  3CBK A;  3HD3 A;  5A24 A;  1NLJ A;  4QBB A;  1EWL A;  2DJG B;  2DC6 A;  5CVM A;  2NQI A;  1TU6 A;  5CVO B;  4BOZ A;  3BPF A;  5JZE A;  5J94 A;  3MOR A;  2FT2 A;  2IPP B;  3MJ5 A;  2OUL A;  3BY4 A;  3HHI A;  4RNA A;  1ICF A;  2J7Q C;  3USV A;  5EF4 A;  3U8E A;  3S3R A;  3F75 A;  2BDL A;  2AGA A;  2YJ8 A;  2JQF R;  1PIP A;  3PBH A;  2G7Y A;  4I07 A;  4PAD A;  3LFY A;  2DCC A;  2DCA A;  3K24 A;  3TRK A;  4PI3 A;  4BS5 A;  3MTV A;  4Q8G A;  3WXE A;  4QRX A;  1AU3 A;  2YJ9 A;  2FE8 A;  3CH3 X;  4BPV A;  4AXM A;  1STF E;  1K3B B;  3TMP A;  2JRI A;  4PT5 A;  1X9Y A;  3N4C A;  2PNS A;  3BBA A;  1PPN A;  1BY8 A;  3PHU A;  2NQD B;  2VHS A;  2AYO A;  5EZS A;  2DC9 A;  2FQ9 A;  2AS8 A;  3KWZ A;  3O1G A;  1CB5 A;  3P5U A;  2GFO A;  4MI7 A;  4YYS A;  3IV2 A;  3HWN A;  3PNR A;  8PCH A;  3MHS A;  2F1G A;  1KFU L;  1KHP A;  1UKF A;  3IFU A;  4W5B A;  2Z84 A;  1Y08 A;  3MTN A;  1KHQ A;  5CVN B;  2E03 A;  4BQV A;  1CV8 A;  2DC8 A;  4ZUX U;  1PCI A;  2DZZ A;  1EWO A;  1TLO A;  6PAD A;  4YYV A;  1PPO A;  2H7J A;  3O0U A;  2BTW A;  1EWP A;  1CS8 A;  1AYW A;  4QRG A;  1CTE A;  1IWD A;  1SNK A;  4YYU A;  3BWK A;  3DF0 A;  3KSE A;  4G54 A;  1Q6K A;  1Y4H A;  2FO5 A;  4DMX A;  1QXP A;  1AYU A;  3E9S A;  1BGO A;  2BTW B;  1NB5 A;  3H8B A;  1YT7 A;  1NPZ A;  4AXL A;  2XU5 A;  4CDF B;  3B79 A;  2HHN A;  3BC3 A;  2HXZ A;  3V6C A;  3W30 A;  3I06 A;  3KW9 A;  4YVA A;  1MS6 A;  2GHU A;  1ATK A;  4WUR A;  4N79 A;  1PXV A;  3IHP A;  3IOQ A;  2Y6E A;  1BQI A;  5CHV A;  1U9Q X;  1U9W A;  5PAD A;  5CHT A;  2FUD A;  2E01 A;  1PAD A;  3PRM A;  3OQC A;  2AU1 A;  1CPJ A;  3KKU A;  4ZTB A;  4FJC A;  3QT4 A;  3H6S A;  4X6J A;  2R6N A;  4PP1 A;  4Q8H A;  1EWM A;  1THE A;  3OF8 A;  4QH6 A;  1BP4 A;  2FTD A;  1QMY A;  2HH5 A;  4BOQ A;  3KFQ A;  3BCN A;  1NL6 A;  4XUI A;  1DF0 A;  1VJV A;  4I04 A;  2E00 A;  1PPD A;  3WXG A;  2ATO A;  4REZ A;  2R9C A;  3PW3 A;  4YYR A;  3P5V A;  4OEM A;  3BPM A;  4OEL A;  1KXR A;  4KLB A;  3N3K A;  4YYW A;  4RF0 A;  4CDC B;  1GEC E;  1ZCM A;  5FPW A;  2HWK A;  3RVV A;  2R9N A;  3MHH A;  5E6J A;  3O65 A;  2P0R A;  1MHW A;  2FRA A;  2DJF B;  2CIO A;  2P7U A;  3CH2 X;  4D8B A;  4BS6 A;  2R9M A;  3D6S A;  1NB3 A;  5EZQ A;  3ZNH A;  2VHF A;  3PHX A;  4IP3 A;  2DCD A;  4P6E A;  3NHE A;  2Y5B A;  4DMY A;  1AYV A;  1YZB A;  3C0R A;  2FRQ A;  2F7D A;  7PCK A;  4QRV A;  3P5W A;  5K16 A;  1VSN A;  3IUT A;  2B1N A;  4MZO A;  3W31 A;  2ACT A;  1YAL A;  3LXS A;  2AYN A;  3I3T A;  4P6G A;  2R9F A;  2XU3 A;  3K9M A;  2JQG R;  1AU0 A;  4W5C A;  1QOL A;  2BU3 A;  5JH3 A;  2E02 A;  2HD5 A;  2DZY A;  3KX1 A;  3H89 A;  4OVZ B;  1GMY A;  4W4U A;  1AEC A;  1F2A A;  2J7Q A;  2XU4 A;  4IUM A;  3PDF A;  4YYQ A;  2P86 A;  3IMA A;  2CB5 A;  4YV8 A;  4BOU A;  3P5X A;  2DCB A;  1TL9 A;  1MEG A;  4CZW A;  2YJ2 A;  2YJB A;  3TNX A;  2ARY A;  2PRE A;  3PSE A;  1KFX L;  3CBJ A;  3BB7 A;  2PAD A;  1ZIV A;  4M0W A;  2G8J A;  4FIP A;  1GCB A;  2OZ2 A;  3GCB A;  3HHA A;  3QSD A;  1AU4 A;  4I05 A;  1QDQ A;  5EGW A;  4X6H A;  4FK5 A;  4N8W A;  3RVX A;  3ERV A;  1CVZ A;  4GUA A;  3MP2 A;  4XR7 A;  3OF9 A;  4MM3 B;  1F29 A;  2UZJ A;  3PHW A;  3BOW A;  1F2C A;  2G6D A;  4D8I A;  5KO3 A;  1HUC B;  1M6D A;  1POP A;  4CDD B;  1YK7 A;  3OIS A;  1ME3 A;  4WA6 A;  1ITO A;  2AIM A;  2AVW A;  1MDW A;  3H7D A;  3F5V A;  2AUZ A;  3IEJ A;  1PE6 A;  3H8C A;  3PRP A;  1JQP A;  4MSX A;  1SP4 B;  3E1Z B;  2AUX A;  2BDZ A;  1NQC A;  2NQA A;  1YVB A;  2IBI A;  4N4Z A;  1A6R A;  3QJ3 A;  2C0Y A;  1U9V A;  4RKX A;  4BOP A;  2G8E A;  2R9O A;  3ZUA A;  1EF7 A;  4XZX A;  1GLO A;  2O6X A;  2XU1 A;  2PBH A;  1CSB B;  2NQG A;  4X6I A;  1MIR A;  4R3D A;  1S4V A;  1CJL A;  3AI8 A;  4RY2 A;  1MEM A;  4RF1 A;  3OVX A;  1F2B A;  4OW0 A;  1U9X A;  4HXD B;  4OVZ A;  2DOS A; 
#chains in the Genus database with same CATH homology
 2YJC A;  4K7C A;  3N3G A;  2OP3 A;  3RVW A;  3K8U A;  3KWB X;  1AU2 A;  5JA7 A;  1ME4 A;  3V6E A;  1O0E A;  4GUZ A;  1AIM A;  1DEU A;  1CQD A;  2B1M A;  1YK8 A;  1FH0 A;  3M99 A;  5F02 A;  1PPP A;  1PBH A;  4MZS A;  3C9E A;  4HWY A;  3WXF A;  3OVZ A;  1U5I A;  4PP2 E;  4BSQ A;  4CDE B;  9PAP A;  2WBF X;  3S3Q A;  2DC7 A;  1XKG A;  2FYE A;  3CBK A;  3HD3 A;  5A24 A;  1NLJ A;  4QBB A;  1EWL A;  2DJG B;  2DC6 A;  5CVM A;  2NQI A;  1TU6 A;  5CVO B;  3BPF A;  5J94 A;  3MOR A;  2FT2 A;  2IPP B;  2OUL A;  3HHI A;  1ICF A;  3USV A;  5EF4 A;  3U8E A;  3S3R A;  3F75 A;  2BDL A;  2YJ8 A;  2JQF R;  1PIP A;  2VFC A;  3PBH A;  4NV7 A;  2G7Y A;  4I07 A;  4PAD A;  3LFY A;  2DCC A;  2DCA A;  3K24 A;  4PI3 A;  4BS5 A;  4Q8G A;  3WXE A;  4QRX A;  1AU3 A;  2YJ9 A;  3CH3 X;  4BPV A;  4AXM A;  1STF E;  1K3B B;  1W6F A;  1X9Y A;  3N4C A;  2PNS A;  1PPN A;  1BY8 A;  2NQD B;  2VHS A;  2AYO A;  2DC9 A;  2FQ9 A;  2AS8 A;  3KWZ A;  3O1G A;  1CB5 A;  3P5U A;  2GFO A;  4YYS A;  3IV2 A;  3HWN A;  3PNR A;  8PCH A;  3MHS A;  2F1G A;  1KFU L;  1KHP A;  4W5B A;  1Y08 A;  3MTN A;  1KHQ A;  5CVN B;  2E03 A;  4BQV A;  1CV8 A;  2DC8 A;  4ZUX U;  4B55 A;  1PCI A;  2DZZ A;  1EWO A;  1TLO A;  6PAD A;  4YYV A;  1PPO A;  2H7J A;  3O0U A;  1EWP A;  1CS8 A;  1AYW A;  4QRG A;  1CTE A;  1IWD A;  1SNK A;  4YYU A;  3BWK A;  3DF0 A;  3KSE A;  4G54 A;  1Q6K A;  1Y4H A;  2FO5 A;  4DMX A;  1QXP A;  1AYU A;  4C5P A;  1BGO A;  1NB5 A;  3H8B A;  1YT7 A;  1NPZ A;  4AXL A;  2XU5 A;  2VFB A;  4CDF B;  3B79 A;  2HHN A;  3BC3 A;  2HXZ A;  3V6C A;  3I06 A;  3KW9 A;  4YVA A;  1MS6 A;  2GHU A;  1ATK A;  4N79 A;  1PXV A;  3IHP A;  3IOQ A;  2Y6E A;  1BQI A;  5CHV A;  3LTW A;  1U9Q X;  1U9W A;  5PAD A;  5CHT A;  2FUD A;  2E01 A;  1PAD A;  2AU1 A;  1CPJ A;  3KKU A;  4FJC A;  3QT4 A;  3H6S A;  4X6J A;  2R6N A;  4PP1 A;  4Q8H A;  1EWM A;  1THE A;  3OF8 A;  4QH6 A;  1BP4 A;  2FTD A;  1QMY A;  2HH5 A;  3KFQ A;  3BCN A;  1NL6 A;  4XUI A;  1DF0 A;  1VJV A;  4I04 A;  2E00 A;  1PPD A;  3WXG A;  2ATO A;  2R9C A;  3PW3 A;  4YYR A;  3P5V A;  4OEM A;  3BPM A;  4OEL A;  1KXR A;  4KLB A;  3N3K A;  4YYW A;  4CDC B;  1GEC E;  1ZCM A;  5FPW A;  3RVV A;  2R9N A;  3MHH A;  2P0R A;  3D9W A;  1MHW A;  2FRA A;  2DJF B;  2CIO A;  2P7U A;  3CH2 X;  4BS6 A;  2R9M A;  3D6S A;  1NB3 A;  2VHF A;  2DCD A;  4P6E A;  3NHE A;  2Y5B A;  4DMY A;  1AYV A;  2FRQ A;  2F7D A;  7PCK A;  4QRV A;  3P5W A;  5K16 A;  1VSN A;  3IUT A;  2B1N A;  4MZO A;  2ACT A;  1YAL A;  1E2T A;  3LXS A;  2AYN A;  3I3T A;  4P6G A;  4BGF A;  2R9F A;  2XU3 A;  3K9M A;  2JQG R;  1AU0 A;  4W5C A;  1QOL A;  5JH3 A;  2E02 A;  2HD5 A;  2DZY A;  3KX1 A;  3H89 A;  1GMY A;  4W4U A;  1AEC A;  1F2A A;  2XU4 A;  3PDF A;  4YYQ A;  2P86 A;  3IMA A;  2CB5 A;  4YV8 A;  3P5X A;  2DCB A;  1TL9 A;  1MEG A;  4CZW A;  2YJ2 A;  2YJB A;  3TNX A;  2ARY A;  2PRE A;  1KFX L;  3CBJ A;  2PAD A;  1ZIV A;  2G8J A;  4FIP A;  1GCB A;  2OZ2 A;  3GCB A;  3HHA A;  3QSD A;  1AU4 A;  4I05 A;  1QDQ A;  5EGW A;  2BSZ A;  4X6H A;  4FK5 A;  4N8W A;  3RVX A;  3ERV A;  1CVZ A;  4XR7 A;  3OF9 A;  1F29 A;  3BOW A;  1F2C A;  2G6D A;  1HUC B;  1M6D A;  1POP A;  4CDD B;  1YK7 A;  3OIS A;  1ME3 A;  4WA6 A;  1ITO A;  2AIM A;  2AVW A;  1MDW A;  3H7D A;  3F5V A;  2AUZ A;  3IEJ A;  1PE6 A;  3H8C A;  1JQP A;  4MSX A;  1SP4 B;  3E1Z B;  2AUX A;  1GX3 A;  2BDZ A;  1NQC A;  2NQA A;  1YVB A;  2IBI A;  4N4Z A;  1A6R A;  3QJ3 A;  2C0Y A;  1U9V A;  1W5R A;  2G8E A;  2R9O A;  3ZUA A;  4NV8 A;  1EF7 A;  1GLO A;  2O6X A;  2XU1 A;  2PBH A;  1CSB B;  1W4T A;  2NQG A;  4X6I A;  1MIR A;  1S4V A;  1CJL A;  3AI8 A;  4RY2 A;  1MEM A;  3OVX A;  1F2B A;  1U9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...