4BS5A

Mouse cathepsin s with covalent ligand
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
219
structure length
219
Chain Sequence
TLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKAMDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of Potent and Selective Cathepsin S (Cats) Inhibitors Containing Different Central Cyclic Scaffolds.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords CATHEPSIN S
total genus 63
structure length 219
sequence length 219
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2013-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4bs5A00
3USVA 1ZIVA 3BWKA 5CHVA 5CHTA 3LXSA 1EWPA 1CPJA 4YYSA 1GECE 4MSXA 2AUZA 2XU4A 1PCIA 3KSEA 3V6CA 4YYWA 1FH0A 2OULA 3KFQA 3IOQA 3B79A 3D6SA 4W5BA 2FRQA 3PNRA 3MTNA 2ARYA 1MEMA 5CVMA 4MZSA 5K16A 4CDCB 4ZUXU 2FQ9A 1ZCMA 2FO5A 3IEJA 5A24A 3MHSA 2IBIA 3WXGA 4QH6A 4DMYA 3WXEA 3OF8A 4N79A 1MEGA 2DCDA 4OEMA 3PDFA 1ICFA 3LFYA 3TNXA 3QT4A 1DF0A 2R9OA 2E01A 5EF4A 3BPFA 1F2AA 1YK8A 1PPOA 1CS8A 2DZZA 3O1GA 2YJ2A 1U9WA 3BC3A 3I3TA 4PADA 4DMXA 1PE6A 4K7CA 2PADA 1MDWA 2NQIA 1STFE 1TU6A 3NHEA 4BQVA 4X6JA 2Y5BA 3C9EA 3H8CA 1EF7A 3H7DA 3P5XA 3HHIA 2NQAA 2BDLA 2DC9A 1KFUL 4OELA 1AU3A 1CVZA 2FT2A 3KWZA 4BS6A 4KLBA 2CB5A 2R9CA 1EWOA 2G8JA 1KHPA 4PI3A 4P6GA 1DEUA 7PCKA 4CZWA 2YJCA 1NPZA 3HD3A 1NLJA 1Y08A 3N3KA 3PBHA 1GMYA 4YV8A 1NB3A 1PPDA 4MZOA 2DCAA 1K3BB 3V6EA 4Q8GA 2JQFR 3K9MA 1CQDA 2WBFX 2YJ9A 4HWYA 1YK7A 1AIMA 9PAPA 2PNSA 3E1ZB 1PXVA 1F2CA 2B1NA 4X6IA 1GCBA 3MORA 2P86A 4W4UA 3M99A 1BY8A 2C0YA 1VSNA 1TLOA 3RVXA 2OP3A 2NQGA 2YJ8A 5FPWA 4YYQA 1CV8A 4I07A 2FUDA 3OVZA 1AU4A 2XU3A 4PP1A 3P5UA 2E00A 1F2BA 3OF9A 2AUXA 3ERVA 2DJFB 2HH5A 4BS5A 3S3RA 1Q6KA 1MIRA 1O0EA 2OZ2A 1AYWA 5JA7A 5JH3A 2PBHA 2XU1A 3MHHA 4I05A 1VJVA 2PREA 4BPVA 1Y4HA 2AU1A 1U9QX 2O6XA 3I06A 3N3GA 3K24A 1AECA 1PBHA 1POPA 3O0UA 3BPMA 1AU2A 1EWLA 1X9YA 1F29A 3H89A 2YJBA 4CDFB 4CDDB 3CH2X 4N4ZA 1NB5A 3CBJA 2DCBA 3IMAA 3OISA 3P5WA 1A6RA 4FJCA 3OVXA 3QJ3A 3BOWA 4YVAA 1IWDA 4YYUA 1PIPA 3S3QA 3RVVA 2FTDA 2G8EA 2F7DA 4QRVA 3DF0A 2AIMA 8PCHA 1SP4B 1JQPA 4G54A 3F75A 2AYOA 1BQIA 2AS8A 4YYRA 1SNKA 2G7YA 1GLOA 4Q8HA 1ITOA 2BDZA 2NQDB 4RY2A 5J94A 1KXRA 1U5IA 4AXLA 1AYUA 4CDEB 2P0RA 2XU5A 5CVOB 4FIPA 3QSDA 2DC6A 2ACTA 1XKGA 3IUTA 1YT7A 1BP4A 3AI8A 2DJGB 6PADA 3KWBX 4BSQA 3PW3A 2HD5A 2R9MA 3GCBA 3F5VA 1QMYA 1S4VA 4I04A 1YVBA 4YYVA 3KX1A 1AU0A 3WXFA 3H6SA 1QOLA 4XR7A 2DCCA 2GFOA 2E02A 1ATKA 2G6DA 4N8WA 5PADA 2F1GA 2ATOA 5EGWA 4PP2E 1HUCB 1MS6A 1THEA 4FK5A 1U9VA 1EWMA 2R9NA 2IPPB 1NQCA 2AYNA 2CIOA 1PPNA 1U9XA 2GHUA 1BGOA 4QRXA 3IHPA 1M6DA 2DC8A 1TL9A 4X6HA 2VHSA 2JQGR 1AYVA 2HHNA 2FYEA 4AXMA 2H7JA 2DZYA 2HXZA 1QDQA 3U8EA 2E03A 3KKUA 4QBBA 1CB5A 4W5CA 3IV2A 1YALA 2VHFA 5F02A 2Y6EA 3RVWA 1ME3A 3HWNA 1CTEA 3N4CA 1KFXL 1CJLA 2R9FA 1PPPA 4QRGA 4XUIA 3H8BA 1NL6A 1KHQA 1ME4A 2B1MA 4P6EA 3CBKA 3ZUAA 3HHAA 4WA6A 2FRAA 2AVWA 3CH3X 2R6NA 1QXPA 1MHWA 1PADA 1CSBB 2DC7A 2P7UA 3KW9A 3K8UA 5CVNB 3P5VA 3BCNA
chains in the Genus database with same CATH superfamily
3USVA 1ZIVA 3BWKA 4IP3A 5CHVA 5CHTA 3LXSA 1EWPA 1CPJA 4YYSA 1GECE 4MSXA 2AUZA 2XU4A 1PCIA 3KSEA 3V6CA 4YYWA 1FH0A 2OULA 3KFQA 4BOSA 3IOQA 3B79A 3D6SA 4P16A 2BU3A 4W5BA 2FRQA 3PNRA 3MTNA 2ARYA 1MEMA 5CVMA 4A5UA 4MZSA 3PRPA 5K16A 4CDCB 4XZXA 4ZUXU 2FQ9A 1ZCMA 3ZNHA 2FO5A 3IEJA 5A24A 3MHSA 2IBIA 3WXGA 4QH6A 3PHWA 4DMYA 3WXEA 3OF8A 4N79A 1MEGA 2DCDA 4OEMA 3PDFA 1ICFA 3LFYA 3TNXA 3QT4A 1DF0A 2R9OA 2E01A 3BY4A 5EF4A 3BPFA 5KO3A 4RF0A 3TRKA 1F2AA 1YK8A 1PPOA 1CS8A 2DZZA 3O1GA 2YJ2A 1U9WA 3BC3A 3I3TA 4PADA 4DMXA 1PE6A 4K7CA 2PADA 1MDWA 2NQIA 1STFE 1TU6A 3NHEA 4M0WA 4BQVA 4X6JA 2Y5BA 3C9EA 3H8CA 1EF7A 4BOZA 3H7DA 3P5XA 3HHIA 2NQAA 4OW0A 2BDLA 2DC9A 3W30A 1KFUL 4OELA 3B21A 1AU3A 1CVZA 4BOQA 2FT2A 3KWZA 4BS6A 4KLBA 2CB5A 2R9CA 1EWOA 2G8JA 1KHPA 4PI3A 4P6GA 1DEUA 7PCKA 4CZWA 2YJCA 1NPZA 3HD3A 1NLJA 1Y08A 3N3KA 3PBHA 1GMYA 4YV8A 1NB3A 1PPDA 4MZOA 2DCAA 1K3BB 3V6EA 4Q8GA 2JQFR 3K9MA 3PRMA 4RKXA 1CQDA 2WBFX 2YJ9A 4HWYA 1YK7A 1AIMA 4OVZA 5E6JA 9PAPA 2PNSA 3E1ZB 1PXVA 1F2CA 1PVJA 2HWKA 2B1NA 4X6IA 1GCBA 3MORA 2P86A 4MM3B 4W4UA 2AGAA 3M99A 1BY8A 2C0YA 1VSNA 4GUAA 1TLOA 3RVXA 2OP3A 3E9SA 3BB7A 2NQGA 2YJ8A 4OVZB 5FPWA 2JTCA 4YYQA 1CV8A 4I07A 2FUDA 3OVZA 1AU4A 4BOPA 2XU3A 4PP1A 3P5UA 2E00A 1F2BA 3OF9A 2J7QA 2AUXA 3ERVA 2DJFB 2HH5A 4BS5A 3S3RA 1Q6KA 1MIRA 1O0EA 2OZ2A 4HXDB 1AYWA 5JA7A 5JH3A 2PBHA 2XU1A 2FE8A 3MHHA 4I05A 1VJVA 2PREA 4BPVA 1Y4HA 2AU1A 1U9QX 2O6XA 3I06A 2BTWB 3N3GA 3K24A 1AECA 1PBHA 1POPA 3O0UA 3BPMA 1AU2A 3W31A 1EWLA 1X9YA 1F29A 3H89A 2YJBA 4CDFB 4CDDB 3CH2X 5EZQA 3IFUA 4N4ZA 1NB5A 3CBJA 2DOSA 2DCBA 3IMAA 3PT2A 3OISA 3P5WA 1A6RA 4FJCA 3OVXA 3QJ3A 3BOWA 4YVAA 1IWDA 4YYUA 1PIPA 3S3QA 3RVVA 2FTDA 2BTWA 2G8EA 2F7DA 3DF0A 4QRVA 2AIMA 8PCHA 1SP4B 1JQPA 4G54A 3F75A 2AYOA 1BQIA 2AS8A 4YYRA 3BBAA 1SNKA 2G7YA 1GLOA 4Q8HA 1ITOA 2BDZA 2NQDB 4RY2A 2Z84A 5J94A 1KXRA 1U5IA 4AXLA 1AYUA 4CDEB 2P0RA 2XU5A 5CVOB 4FIPA 3OQCA 4REZA 3QSDA 3RNVA 2DC6A 4D8BA 3TMPA 2ACTA 3PSEA 1XKGA 3IUTA 1DKIA 2JRIA 5JZEA 1YT7A 1BP4A 3AI8A 2DJGB 6PADA 4D8IA 3KWBX 3MP2A 4BSQA 3PW3A 2HD5A 2R9MA 3GCBA 3F5VA 1QMYA 1S4VA 5EZSA 4I04A 1YVBA 4YYVA 3KX1A 1AU0A 3MTVA 3WXFA 3H6SA 4ZTBA 1QOLA 4XR7A 2DCCA 2GFOA 2E02A 1ATKA 2G6DA 4N8WA 5PADA 2F1GA 2ATOA 5EGWA 2UZJA 4PP2E 1HUCB 1MS6A 1THEA 4RNAA 4FK5A 1U9VA 1EWMA 2R9NA 2IPPB 1NQCA 2AYNA 2CIOA 1PPNA 1U9XA 2GHUA 1BGOA 4QRXA 3IHPA 1M6DA 4PT5A 2DC8A 1TL9A 4X6HA 2VHSA 2JQGR 1AYVA 2HHNA 2FYEA 3PHXA 4AXMA 1UKFA 2H7JA 2DZYA 2HXZA 1QDQA 3U8EA 2E03A 3KKUA 4QBBA 1CB5A 4W5CA 3IV2A 1YALA 2VHFA 4IUMA 4WURA 5F02A 2Y6EA 3RVWA 1ME3A 3HWNA 1CTEA 3N4CA 1KFXL 4RF1A 1CJLA 2R9FA 3O65A 1PPPA 4QRGA 4XUIA 3C0RA 3H8BA 1NL6A 1KHQA 1ME4A 2B1MA 2J7QC 4P6EA 3CBKA 4D8EA 3ZUAA 1YZBA 3HHAA 4R3DA 4WA6A 2FRAA 2AVWA 3CH3X 4BOUA 2R6NA 1QXPA 1MHWA 1PADA 3MJ5A 1CSBB 3PHUA 4MI7A 2DC7A 2P7UA 3KW9A 3K8UA 5CVNB 3P5VA 3BCNA
chains in the Genus database with same CATH topology
3USVA 1ZIVA 3BWKA 5CHVA 5CHTA 3LXSA 1EWPA 1CPJA 4YYSA 1GECE 4MSXA 2AUZA 2XU4A 1PCIA 3KSEA 3V6CA 4YYWA 1FH0A 2OULA 3KFQA 3IOQA 3B79A 3D6SA 4W5BA 2FRQA 3PNRA 3MTNA 2ARYA 1MEMA 5CVMA 4MZSA 5K16A 4CDCB 4ZUXU 1GX3A 2FQ9A 1ZCMA 2FO5A 3IEJA 5A24A 3MHSA 2IBIA 3WXGA 4QH6A 4DMYA 3WXEA 3OF8A 4N79A 1MEGA 2DCDA 4OEMA 3LTWA 3PDFA 1ICFA 3LFYA 3TNXA 3QT4A 1W5RA 1DF0A 2R9OA 2E01A 5EF4A 3BPFA 1F2AA 1YK8A 1PPOA 1CS8A 2DZZA 3O1GA 2YJ2A 1U9WA 3BC3A 3I3TA 4PADA 4DMXA 1PE6A 4K7CA 2PADA 1MDWA 2NQIA 1STFE 1TU6A 3NHEA 4BQVA 4X6JA 2Y5BA 3C9EA 3H8CA 1EF7A 4NV7A 3H7DA 3P5XA 3HHIA 2NQAA 2BDLA 2DC9A 4NV8A 1KFUL 4OELA 1AU3A 1CVZA 2FT2A 3KWZA 4BS6A 4KLBA 2CB5A 2R9CA 1EWOA 2G8JA 1KHPA 4PI3A 4P6GA 1DEUA 7PCKA 4CZWA 2YJCA 1NPZA 3HD3A 1NLJA 1Y08A 3PBHA 3N3KA 1GMYA 4YV8A 1NB3A 1PPDA 4MZOA 2DCAA 1K3BB 3V6EA 4Q8GA 2JQFR 3K9MA 1CQDA 2WBFX 2YJ9A 4HWYA 1YK7A 1AIMA 3D9WA 9PAPA 2PNSA 3E1ZB 1PXVA 1F2CA 2B1NA 4X6IA 1GCBA 3MORA 2P86A 4W4UA 3M99A 1BY8A 2C0YA 1VSNA 1TLOA 3RVXA 2OP3A 2NQGA 2YJ8A 5FPWA 4YYQA 1CV8A 4I07A 2FUDA 3OVZA 1AU4A 2XU3A 4PP1A 3P5UA 2E00A 1F2BA 3OF9A 2AUXA 3ERVA 2DJFB 2HH5A 4BS5A 3S3RA 1Q6KA 1MIRA 1O0EA 2OZ2A 1AYWA 5JA7A 5JH3A 2PBHA 2XU1A 3MHHA 4I05A 1VJVA 2PREA 4BPVA 1Y4HA 2AU1A 1U9QX 2O6XA 1E2TA 3I06A 3N3GA 3K24A 1AECA 1PBHA 1POPA 3O0UA 3BPMA 1AU2A 1EWLA 1X9YA 1F29A 3H89A 2YJBA 4CDFB 4CDDB 3CH2X 4N4ZA 1NB5A 3CBJA 2DCBA 3IMAA 1W4TA 3OISA 3P5WA 1A6RA 4FJCA 3OVXA 3QJ3A 3BOWA 4YVAA 1IWDA 4YYUA 1PIPA 3S3QA 3RVVA 2FTDA 2G8EA 2F7DA 4QRVA 3DF0A 2AIMA 8PCHA 1SP4B 1JQPA 4G54A 3F75A 2AYOA 1BQIA 4BGFA 2AS8A 1W6FA 4YYRA 1SNKA 2G7YA 1GLOA 4Q8HA 1ITOA 2BDZA 2NQDB 4RY2A 5J94A 1KXRA 1U5IA 4AXLA 1AYUA 4CDEB 2P0RA 2XU5A 5CVOB 4FIPA 4B55A 3QSDA 2DC6A 2ACTA 1XKGA 3IUTA 1YT7A 1BP4A 3AI8A 2DJGB 6PADA 3KWBX 4BSQA 3PW3A 2HD5A 2R9MA 3GCBA 3F5VA 1QMYA 1S4VA 4I04A 1YVBA 4YYVA 3KX1A 2BSZA 1AU0A 3WXFA 3H6SA 4GUZA 1QOLA 4XR7A 2DCCA 2GFOA 2E02A 1ATKA 2G6DA 4N8WA 5PADA 2F1GA 2ATOA 5EGWA 4PP2E 1HUCB 1MS6A 1THEA 4FK5A 1U9VA 1EWMA 2R9NA 2IPPB 1NQCA 2AYNA 2CIOA 1PPNA 1U9XA 2GHUA 1BGOA 4QRXA 3IHPA 1M6DA 2DC8A 1TL9A 4X6HA 2VHSA 2JQGR 1AYVA 2HHNA 2FYEA 4AXMA 2H7JA 2DZYA 2HXZA 1QDQA 3U8EA 2E03A 3KKUA 2VFCA 4QBBA 1CB5A 4W5CA 3IV2A 1YALA 2VHFA 5F02A 2Y6EA 3RVWA 1ME3A 3HWNA 1CTEA 3N4CA 1KFXL 1CJLA 2R9FA 1PPPA 4QRGA 4XUIA 3H8BA 1NL6A 1KHQA 1ME4A 2VFBA 2B1MA 4P6EA 3CBKA 3ZUAA 3HHAA 4WA6A 2FRAA 2AVWA 4C5PA 3CH3X 2R6NA 1QXPA 1MHWA 1PADA 1CSBB 2DC7A 2P7UA 3KW9A 3K8UA 5CVNB 3P5VA 3BCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3USV A;  1ZIV A;  3BWK A;  5CHV A;  5CHT A;  3LXS A;  1EWP A;  1CPJ A;  4YYS A;  1GEC E;  4MSX A;  2AUZ A;  2XU4 A;  1PCI A;  3KSE A;  3V6C A;  4YYW A;  1FH0 A;  2OUL A;  3KFQ A;  3IOQ A;  3B79 A;  3D6S A;  4W5B A;  2FRQ A;  3PNR A;  3MTN A;  2ARY A;  1MEM A;  5CVM A;  4MZS A;  5K16 A;  4CDC B;  4ZUX U;  2FQ9 A;  1ZCM A;  2FO5 A;  3IEJ A;  5A24 A;  3MHS A;  2IBI A;  3WXG A;  4QH6 A;  4DMY A;  3WXE A;  3OF8 A;  4N79 A;  1MEG A;  2DCD A;  4OEM A;  3PDF A;  1ICF A;  3LFY A;  3TNX A;  3QT4 A;  1DF0 A;  2R9O A;  2E01 A;  5EF4 A;  3BPF A;  1F2A A;  1YK8 A;  1PPO A;  1CS8 A;  2DZZ A;  3O1G A;  2YJ2 A;  1U9W A;  3BC3 A;  3I3T A;  4PAD A;  4DMX A;  1PE6 A;  4K7C A;  2PAD A;  1MDW A;  2NQI A;  1STF E;  1TU6 A;  3NHE A;  4BQV A;  4X6J A;  2Y5B A;  3C9E A;  3H8C A;  1EF7 A;  3H7D A;  3P5X A;  3HHI A;  2NQA A;  2BDL A;  2DC9 A;  1KFU L;  4OEL A;  1AU3 A;  1CVZ A;  2FT2 A;  3KWZ A;  4BS6 A;  4KLB A;  2CB5 A;  2R9C A;  1EWO A;  2G8J A;  1KHP A;  4PI3 A;  4P6G A;  1DEU A;  7PCK A;  4CZW A;  2YJC A;  1NPZ A;  3HD3 A;  1NLJ A;  1Y08 A;  3N3K A;  3PBH A;  1GMY A;  4YV8 A;  1NB3 A;  1PPD A;  4MZO A;  2DCA A;  1K3B B;  3V6E A;  4Q8G A;  2JQF R;  3K9M A;  1CQD A;  2WBF X;  2YJ9 A;  4HWY A;  1YK7 A;  1AIM A;  9PAP A;  2PNS A;  3E1Z B;  1PXV A;  1F2C A;  2B1N A;  4X6I A;  1GCB A;  3MOR A;  2P86 A;  4W4U A;  3M99 A;  1BY8 A;  2C0Y A;  1VSN A;  1TLO A;  3RVX A;  2OP3 A;  2NQG A;  2YJ8 A;  5FPW A;  4YYQ A;  1CV8 A;  4I07 A;  2FUD A;  3OVZ A;  1AU4 A;  2XU3 A;  4PP1 A;  3P5U A;  2E00 A;  1F2B A;  3OF9 A;  2AUX A;  3ERV A;  2DJF B;  2HH5 A;  4BS5 A;  3S3R A;  1Q6K A;  1MIR A;  1O0E A;  2OZ2 A;  1AYW A;  5JA7 A;  5JH3 A;  2PBH A;  2XU1 A;  3MHH A;  4I05 A;  1VJV A;  2PRE A;  4BPV A;  1Y4H A;  2AU1 A;  1U9Q X;  2O6X A;  3I06 A;  3N3G A;  3K24 A;  1AEC A;  1PBH A;  1POP A;  3O0U A;  3BPM A;  1AU2 A;  1EWL A;  1X9Y A;  1F29 A;  3H89 A;  2YJB A;  4CDF B;  4CDD B;  3CH2 X;  4N4Z A;  1NB5 A;  3CBJ A;  2DCB A;  3IMA A;  3OIS A;  3P5W A;  1A6R A;  4FJC A;  3OVX A;  3QJ3 A;  3BOW A;  4YVA A;  1IWD A;  4YYU A;  1PIP A;  3S3Q A;  3RVV A;  2FTD A;  2G8E A;  2F7D A;  4QRV A;  3DF0 A;  2AIM A;  8PCH A;  1SP4 B;  1JQP A;  4G54 A;  3F75 A;  2AYO A;  1BQI A;  2AS8 A;  4YYR A;  1SNK A;  2G7Y A;  1GLO A;  4Q8H A;  1ITO A;  2BDZ A;  2NQD B;  4RY2 A;  5J94 A;  1KXR A;  1U5I A;  4AXL A;  1AYU A;  4CDE B;  2P0R A;  2XU5 A;  5CVO B;  4FIP A;  3QSD A;  2DC6 A;  2ACT A;  1XKG A;  3IUT A;  1YT7 A;  1BP4 A;  3AI8 A;  2DJG B;  6PAD A;  3KWB X;  4BSQ A;  3PW3 A;  2HD5 A;  2R9M A;  3GCB A;  3F5V A;  1QMY A;  1S4V A;  4I04 A;  1YVB A;  4YYV A;  3KX1 A;  1AU0 A;  3WXF A;  3H6S A;  1QOL A;  4XR7 A;  2DCC A;  2GFO A;  2E02 A;  1ATK A;  2G6D A;  4N8W A;  5PAD A;  2F1G A;  2ATO A;  5EGW A;  4PP2 E;  1HUC B;  1MS6 A;  1THE A;  4FK5 A;  1U9V A;  1EWM A;  2R9N A;  2IPP B;  1NQC A;  2AYN A;  2CIO A;  1PPN A;  1U9X A;  2GHU A;  1BGO A;  4QRX A;  3IHP A;  1M6D A;  2DC8 A;  1TL9 A;  4X6H A;  2VHS A;  2JQG R;  1AYV A;  2HHN A;  2FYE A;  4AXM A;  2H7J A;  2DZY A;  2HXZ A;  1QDQ A;  3U8E A;  2E03 A;  3KKU A;  4QBB A;  1CB5 A;  4W5C A;  3IV2 A;  1YAL A;  2VHF A;  5F02 A;  2Y6E A;  3RVW A;  1ME3 A;  3HWN A;  1CTE A;  3N4C A;  1KFX L;  1CJL A;  2R9F A;  1PPP A;  4QRG A;  4XUI A;  3H8B A;  1NL6 A;  1KHQ A;  1ME4 A;  2B1M A;  4P6E A;  3CBK A;  3ZUA A;  3HHA A;  4WA6 A;  2FRA A;  2AVW A;  3CH3 X;  2R6N A;  1QXP A;  1MHW A;  1PAD A;  1CSB B;  2DC7 A;  2P7U A;  3KW9 A;  3K8U A;  5CVN B;  3P5V A;  3BCN A; 
#chains in the Genus database with same CATH topology
 3USV A;  1ZIV A;  3BWK A;  4IP3 A;  5CHV A;  5CHT A;  3LXS A;  1EWP A;  1CPJ A;  4YYS A;  1GEC E;  4MSX A;  2AUZ A;  2XU4 A;  1PCI A;  3KSE A;  3V6C A;  4YYW A;  1FH0 A;  2OUL A;  3KFQ A;  4BOS A;  3IOQ A;  3B79 A;  3D6S A;  4P16 A;  2BU3 A;  4W5B A;  2FRQ A;  3PNR A;  3MTN A;  2ARY A;  1MEM A;  5CVM A;  4A5U A;  4MZS A;  3PRP A;  5K16 A;  4CDC B;  4XZX A;  4ZUX U;  2FQ9 A;  1ZCM A;  3ZNH A;  2FO5 A;  3IEJ A;  5A24 A;  3MHS A;  2IBI A;  3WXG A;  4QH6 A;  3PHW A;  4DMY A;  3WXE A;  3OF8 A;  4N79 A;  1MEG A;  2DCD A;  4OEM A;  3PDF A;  1ICF A;  3LFY A;  3TNX A;  3QT4 A;  1DF0 A;  2R9O A;  2E01 A;  3BY4 A;  5EF4 A;  3BPF A;  5KO3 A;  4RF0 A;  3TRK A;  1F2A A;  1YK8 A;  1PPO A;  1CS8 A;  2DZZ A;  3O1G A;  2YJ2 A;  1U9W A;  3BC3 A;  3I3T A;  4PAD A;  4DMX A;  1PE6 A;  4K7C A;  2PAD A;  1MDW A;  2NQI A;  1STF E;  1TU6 A;  3NHE A;  4M0W A;  4BQV A;  4X6J A;  2Y5B A;  3C9E A;  3H8C A;  1EF7 A;  4BOZ A;  3H7D A;  3P5X A;  3HHI A;  2NQA A;  4OW0 A;  2BDL A;  2DC9 A;  3W30 A;  1KFU L;  4OEL A;  3B21 A;  1AU3 A;  1CVZ A;  4BOQ A;  2FT2 A;  3KWZ A;  4BS6 A;  4KLB A;  2CB5 A;  2R9C A;  1EWO A;  2G8J A;  1KHP A;  4PI3 A;  4P6G A;  1DEU A;  7PCK A;  4CZW A;  2YJC A;  1NPZ A;  3HD3 A;  1NLJ A;  1Y08 A;  3N3K A;  3PBH A;  1GMY A;  4YV8 A;  1NB3 A;  1PPD A;  4MZO A;  2DCA A;  1K3B B;  3V6E A;  4Q8G A;  2JQF R;  3K9M A;  3PRM A;  4RKX A;  1CQD A;  2WBF X;  2YJ9 A;  4HWY A;  1YK7 A;  1AIM A;  4OVZ A;  5E6J A;  9PAP A;  2PNS A;  3E1Z B;  1PXV A;  1F2C A;  1PVJ A;  2HWK A;  2B1N A;  4X6I A;  1GCB A;  3MOR A;  2P86 A;  4MM3 B;  4W4U A;  2AGA A;  3M99 A;  1BY8 A;  2C0Y A;  1VSN A;  4GUA A;  1TLO A;  3RVX A;  2OP3 A;  3E9S A;  3BB7 A;  2NQG A;  2YJ8 A;  4OVZ B;  5FPW A;  2JTC A;  4YYQ A;  1CV8 A;  4I07 A;  2FUD A;  3OVZ A;  1AU4 A;  4BOP A;  2XU3 A;  4PP1 A;  3P5U A;  2E00 A;  1F2B A;  3OF9 A;  2J7Q A;  2AUX A;  3ERV A;  2DJF B;  2HH5 A;  4BS5 A;  3S3R A;  1Q6K A;  1MIR A;  1O0E A;  2OZ2 A;  4HXD B;  1AYW A;  5JA7 A;  5JH3 A;  2PBH A;  2XU1 A;  2FE8 A;  3MHH A;  4I05 A;  1VJV A;  2PRE A;  4BPV A;  1Y4H A;  2AU1 A;  1U9Q X;  2O6X A;  3I06 A;  2BTW B;  3N3G A;  3K24 A;  1AEC A;  1PBH A;  1POP A;  3O0U A;  3BPM A;  1AU2 A;  3W31 A;  1EWL A;  1X9Y A;  1F29 A;  3H89 A;  2YJB A;  4CDF B;  4CDD B;  3CH2 X;  5EZQ A;  3IFU A;  4N4Z A;  1NB5 A;  3CBJ A;  2DOS A;  2DCB A;  3IMA A;  3PT2 A;  3OIS A;  3P5W A;  1A6R A;  4FJC A;  3OVX A;  3QJ3 A;  3BOW A;  4YVA A;  1IWD A;  4YYU A;  1PIP A;  3S3Q A;  3RVV A;  2FTD A;  2BTW A;  2G8E A;  2F7D A;  3DF0 A;  4QRV A;  2AIM A;  8PCH A;  1SP4 B;  1JQP A;  4G54 A;  3F75 A;  2AYO A;  1BQI A;  2AS8 A;  4YYR A;  3BBA A;  1SNK A;  2G7Y A;  1GLO A;  4Q8H A;  1ITO A;  2BDZ A;  2NQD B;  4RY2 A;  2Z84 A;  5J94 A;  1KXR A;  1U5I A;  4AXL A;  1AYU A;  4CDE B;  2P0R A;  2XU5 A;  5CVO B;  4FIP A;  3OQC A;  4REZ A;  3QSD A;  3RNV A;  2DC6 A;  4D8B A;  3TMP A;  2ACT A;  3PSE A;  1XKG A;  3IUT A;  1DKI A;  2JRI A;  5JZE A;  1YT7 A;  1BP4 A;  3AI8 A;  2DJG B;  6PAD A;  4D8I A;  3KWB X;  3MP2 A;  4BSQ A;  3PW3 A;  2HD5 A;  2R9M A;  3GCB A;  3F5V A;  1QMY A;  1S4V A;  5EZS A;  4I04 A;  1YVB A;  4YYV A;  3KX1 A;  1AU0 A;  3MTV A;  3WXF A;  3H6S A;  4ZTB A;  1QOL A;  4XR7 A;  2DCC A;  2GFO A;  2E02 A;  1ATK A;  2G6D A;  4N8W A;  5PAD A;  2F1G A;  2ATO A;  5EGW A;  2UZJ A;  4PP2 E;  1HUC B;  1MS6 A;  1THE A;  4RNA A;  4FK5 A;  1U9V A;  1EWM A;  2R9N A;  2IPP B;  1NQC A;  2AYN A;  2CIO A;  1PPN A;  1U9X A;  2GHU A;  1BGO A;  4QRX A;  3IHP A;  1M6D A;  4PT5 A;  2DC8 A;  1TL9 A;  4X6H A;  2VHS A;  2JQG R;  1AYV A;  2HHN A;  2FYE A;  3PHX A;  4AXM A;  1UKF A;  2H7J A;  2DZY A;  2HXZ A;  1QDQ A;  3U8E A;  2E03 A;  3KKU A;  4QBB A;  1CB5 A;  4W5C A;  3IV2 A;  1YAL A;  2VHF A;  4IUM A;  4WUR A;  5F02 A;  2Y6E A;  3RVW A;  1ME3 A;  3HWN A;  1CTE A;  3N4C A;  1KFX L;  4RF1 A;  1CJL A;  2R9F A;  3O65 A;  1PPP A;  4QRG A;  4XUI A;  3C0R A;  3H8B A;  1NL6 A;  1KHQ A;  1ME4 A;  2B1M A;  2J7Q C;  4P6E A;  3CBK A;  4D8E A;  3ZUA A;  1YZB A;  3HHA A;  4R3D A;  4WA6 A;  2FRA A;  2AVW A;  3CH3 X;  4BOU A;  2R6N A;  1QXP A;  1MHW A;  1PAD A;  3MJ5 A;  1CSB B;  3PHU A;  4MI7 A;  2DC7 A;  2P7U A;  3KW9 A;  3K8U A;  5CVN B;  3P5V A;  3BCN A; 
#chains in the Genus database with same CATH homology
 3USV A;  1ZIV A;  3BWK A;  5CHV A;  5CHT A;  3LXS A;  1EWP A;  1CPJ A;  4YYS A;  1GEC E;  4MSX A;  2AUZ A;  2XU4 A;  1PCI A;  3KSE A;  3V6C A;  4YYW A;  1FH0 A;  2OUL A;  3KFQ A;  3IOQ A;  3B79 A;  3D6S A;  4W5B A;  2FRQ A;  3PNR A;  3MTN A;  2ARY A;  1MEM A;  5CVM A;  4MZS A;  5K16 A;  4CDC B;  4ZUX U;  1GX3 A;  2FQ9 A;  1ZCM A;  2FO5 A;  3IEJ A;  5A24 A;  3MHS A;  2IBI A;  3WXG A;  4QH6 A;  4DMY A;  3WXE A;  3OF8 A;  4N79 A;  1MEG A;  2DCD A;  4OEM A;  3LTW A;  3PDF A;  1ICF A;  3LFY A;  3TNX A;  3QT4 A;  1W5R A;  1DF0 A;  2R9O A;  2E01 A;  5EF4 A;  3BPF A;  1F2A A;  1YK8 A;  1PPO A;  1CS8 A;  2DZZ A;  3O1G A;  2YJ2 A;  1U9W A;  3BC3 A;  3I3T A;  4PAD A;  4DMX A;  1PE6 A;  4K7C A;  2PAD A;  1MDW A;  2NQI A;  1STF E;  1TU6 A;  3NHE A;  4BQV A;  4X6J A;  2Y5B A;  3C9E A;  3H8C A;  1EF7 A;  4NV7 A;  3H7D A;  3P5X A;  3HHI A;  2NQA A;  2BDL A;  2DC9 A;  4NV8 A;  1KFU L;  4OEL A;  1AU3 A;  1CVZ A;  2FT2 A;  3KWZ A;  4BS6 A;  4KLB A;  2CB5 A;  2R9C A;  1EWO A;  2G8J A;  1KHP A;  4PI3 A;  4P6G A;  1DEU A;  7PCK A;  4CZW A;  2YJC A;  1NPZ A;  3HD3 A;  1NLJ A;  1Y08 A;  3PBH A;  3N3K A;  1GMY A;  4YV8 A;  1NB3 A;  1PPD A;  4MZO A;  2DCA A;  1K3B B;  3V6E A;  4Q8G A;  2JQF R;  3K9M A;  1CQD A;  2WBF X;  2YJ9 A;  4HWY A;  1YK7 A;  1AIM A;  3D9W A;  9PAP A;  2PNS A;  3E1Z B;  1PXV A;  1F2C A;  2B1N A;  4X6I A;  1GCB A;  3MOR A;  2P86 A;  4W4U A;  3M99 A;  1BY8 A;  2C0Y A;  1VSN A;  1TLO A;  3RVX A;  2OP3 A;  2NQG A;  2YJ8 A;  5FPW A;  4YYQ A;  1CV8 A;  4I07 A;  2FUD A;  3OVZ A;  1AU4 A;  2XU3 A;  4PP1 A;  3P5U A;  2E00 A;  1F2B A;  3OF9 A;  2AUX A;  3ERV A;  2DJF B;  2HH5 A;  4BS5 A;  3S3R A;  1Q6K A;  1MIR A;  1O0E A;  2OZ2 A;  1AYW A;  5JA7 A;  5JH3 A;  2PBH A;  2XU1 A;  3MHH A;  4I05 A;  1VJV A;  2PRE A;  4BPV A;  1Y4H A;  2AU1 A;  1U9Q X;  2O6X A;  1E2T A;  3I06 A;  3N3G A;  3K24 A;  1AEC A;  1PBH A;  1POP A;  3O0U A;  3BPM A;  1AU2 A;  1EWL A;  1X9Y A;  1F29 A;  3H89 A;  2YJB A;  4CDF B;  4CDD B;  3CH2 X;  4N4Z A;  1NB5 A;  3CBJ A;  2DCB A;  3IMA A;  1W4T A;  3OIS A;  3P5W A;  1A6R A;  4FJC A;  3OVX A;  3QJ3 A;  3BOW A;  4YVA A;  1IWD A;  4YYU A;  1PIP A;  3S3Q A;  3RVV A;  2FTD A;  2G8E A;  2F7D A;  4QRV A;  3DF0 A;  2AIM A;  8PCH A;  1SP4 B;  1JQP A;  4G54 A;  3F75 A;  2AYO A;  1BQI A;  4BGF A;  2AS8 A;  1W6F A;  4YYR A;  1SNK A;  2G7Y A;  1GLO A;  4Q8H A;  1ITO A;  2BDZ A;  2NQD B;  4RY2 A;  5J94 A;  1KXR A;  1U5I A;  4AXL A;  1AYU A;  4CDE B;  2P0R A;  2XU5 A;  5CVO B;  4FIP A;  4B55 A;  3QSD A;  2DC6 A;  2ACT A;  1XKG A;  3IUT A;  1YT7 A;  1BP4 A;  3AI8 A;  2DJG B;  6PAD A;  3KWB X;  4BSQ A;  3PW3 A;  2HD5 A;  2R9M A;  3GCB A;  3F5V A;  1QMY A;  1S4V A;  4I04 A;  1YVB A;  4YYV A;  3KX1 A;  2BSZ A;  1AU0 A;  3WXF A;  3H6S A;  4GUZ A;  1QOL A;  4XR7 A;  2DCC A;  2GFO A;  2E02 A;  1ATK A;  2G6D A;  4N8W A;  5PAD A;  2F1G A;  2ATO A;  5EGW A;  4PP2 E;  1HUC B;  1MS6 A;  1THE A;  4FK5 A;  1U9V A;  1EWM A;  2R9N A;  2IPP B;  1NQC A;  2AYN A;  2CIO A;  1PPN A;  1U9X A;  2GHU A;  1BGO A;  4QRX A;  3IHP A;  1M6D A;  2DC8 A;  1TL9 A;  4X6H A;  2VHS A;  2JQG R;  1AYV A;  2HHN A;  2FYE A;  4AXM A;  2H7J A;  2DZY A;  2HXZ A;  1QDQ A;  3U8E A;  2E03 A;  3KKU A;  2VFC A;  4QBB A;  1CB5 A;  4W5C A;  3IV2 A;  1YAL A;  2VHF A;  5F02 A;  2Y6E A;  3RVW A;  1ME3 A;  3HWN A;  1CTE A;  3N4C A;  1KFX L;  1CJL A;  2R9F A;  1PPP A;  4QRG A;  4XUI A;  3H8B A;  1NL6 A;  1KHQ A;  1ME4 A;  2VFB A;  2B1M A;  4P6E A;  3CBK A;  3ZUA A;  3HHA A;  4WA6 A;  2FRA A;  2AVW A;  4C5P A;  3CH3 X;  2R6N A;  1QXP A;  1MHW A;  1PAD A;  1CSB B;  2DC7 A;  2P7U A;  3KW9 A;  3K8U A;  5CVN B;  3P5V A;  3BCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...