4BS5A

Mouse cathepsin s with covalent ligand
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
219
structure length
219
Chain Sequence
TLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKAMDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CATHEPSIN S
publication title Identification of Potent and Selective Cathepsin S (Cats) Inhibitors Containing Different Central Cyclic Scaffolds.
pubmed doi rcsb
source organism Mus musculus
total genus 63
structure length 219
sequence length 219
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2013-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4bs5A00
1IWDA 3IMAA 1BY8A 1PIPA 2BDLA 4QRXA 3K24A 3RVWA 3H6SA 1Y08A 3OVXA 5CHTA 2R9CA 2VHFA 2BDZA 3PNRA 2FT2A 2G7YA 3V6EA 1AIMA 4BQVA 2NQDB 4DMXA 4MZSA 2O6XA 1K3BB 3N4CA 5A24A 2DCBA 2DZYA 4PP2E 4WA6A 3KKUA 3ERVA 3IUTA 5JH3A 1EWLA 1M6DA 1NL6A 1U9XA 1AU3A 2YJBA 1CQDA 2IBIA 3WXEA 1CSBB 3LFYA 3QJ3A 1DEUA 1VJVA 3M99A 2R9OA 3MORA 2CB5A 3BC3A 1DF0A 3KWZA 2DC9A 1CTEA 3DF0A 4I07A 2ATOA 5J94A 4P6GA 3K8UA 3KSEA 4CDCB 4MSXA 2E02A 2OZ2A 1AU4A 9PAPA 8PCHA 1KHQA 3CBKA 3IV2A 3S3RA 1PXVA 5EGWA 3H89A 3CH3X 1ME3A 2C0YA 4K7CA 1X9YA 1ZIVA 1CVZA 2FRAA 2OULA 2OP3A 3I3TA 2JQGR 1CPJA 3MTNA 5PADA 2YJ2A 4XUIA 3P5WA 1KHPA 1TLOA 1KXRA 3HHIA 2WBFX 4BSQA 5CHVA 2P0RA 2XU1A 2AU1A 1MEMA 4XR7A 1NB3A 4PP1A 3P5VA 5F02A 2FRQA 3BWKA 1PADA 2Y6EA 1YALA 2PREA 2DC8A 2NQGA 2XU3A 1PBHA 2G6DA 4DMYA 3HWNA 2AYOA 3O0UA 2FUDA 2GHUA 4OEMA 3BOWA 1O0EA 3IEJA 2DC6A 3LXSA 4KLBA 1CB5A 1FH0A 2FTDA 2FO5A 1AECA 2AVWA 1PPNA 1SNKA 3RVXA 4FK5A 4W5BA 1PPPA 3F5VA 3CH2X 2DZZA 2CIOA 1SP4B 5CVMA 4YYSA 2E00A 2YJ8A 5FPWA 4W4UA 1NQCA 1ATKA 4BPVA 1AYUA 3F75A 1BQIA 3GCBA 3OF8A 1CJLA 2XU5A 1PCIA 1A6RA 1PPOA 1POPA 1GECE 2B1NA 1AU0A 2R9NA 3WXGA 1U9WA 4I04A 5K16A 2R6NA 4YYRA 3I06A 4P6EA 3BPFA 1F2CA 3MHHA 2DCAA 7PCKA 3USVA 1KFUL 1PE6A 1NB5A 3OVZA 3RVVA 3KWBX 2PNSA 2G8JA 2VHSA 3H7DA 4N79A 4PI3A 1EWOA 1BGOA 1MEGA 2YJCA 1PPDA 3WXFA 2AUZA 2XU4A 1TU6A 1Q6KA 2F1GA 3V6CA 4CDEB 2DCDA 5CVOB 4I05A 3QT4A 2E01A 4FIPA 3NHEA 3BPMA 4N4ZA 3O1GA 2R9FA 4CDFB 3IHPA 3QSDA 1CS8A 2AYNA 4CZWA 2E03A 3E1ZB 1GCBA 2ACTA 4Q8HA 1MDWA 2FYEA 1CV8A 3N3KA 1EWPA 1NLJA 2H7JA 2PADA 4X6JA 2P86A 2R9MA 4AXLA 3PBHA 3U8EA 1U9QX 1F2BA 4CDDB 1AYVA 3CBJA 1TL9A 3K9MA 1XKGA 4BS5A 3IOQA 4Q8GA 2HHNA 1STFE 2IPPB 1S4VA 4YVAA 2NQIA 4QRVA 2DC7A 3H8CA 1GMYA 2DCCA 3MHSA 3N3GA 1MHWA 4HWYA 2FQ9A 1Y4HA 3S3QA 5CVNB 1EWMA 3KW9A 2HXZA 2JQFR 4BS6A 3H8BA 1U5IA 4N8WA 5EF4A 3BCNA 1ME4A 1MS6A 3PDFA 2AUXA 3OISA 4RY2A 4PADA 2YJ9A 3OF9A 3HD3A 3D6SA 4AXMA 1QDQA 2F7DA 4G54A 4QH6A 3P5UA 4OELA 1AYWA 2HD5A 3P5XA 4YYWA 1EF7A 2AIMA 3TNXA 2AS8A 1F2AA 2P7UA 4YYUA 2B1MA 1VSNA 1QMYA 2Y5BA 1ZCMA 2ARYA 2PBHA 3B79A 3PW3A 1GLOA 4YYQA 3KX1A 3KFQA 1NPZA 4YV8A 2DJGB 1F29A 1ICFA 4FJCA 2GFOA 1MIRA 4W5CA 4X6HA 1ITOA 1YK7A 1YVBA 4QRGA 6PADA 3HHAA 3AI8A 4X6IA 1AU2A 1KFXL 4ZUXU 2HH5A 2G8EA 1JQPA 1THEA 1QOLA 4MZOA 4YYVA 1BP4A 3ZUAA 4QBBA 1YK8A 5JA7A 1HUCB 1QXPA 2DJFB 3C9EA 1YT7A 2NQAA 1U9VA
chains in the Genus database with same CATH superfamily
1IWDA 3IMAA 1BY8A 1PIPA 2BDLA 4QRXA 3K24A 3RVWA 3H6SA 5EZSA 1Y08A 3OVXA 5CHTA 4ZTBA 4MM3B 2R9CA 2VHFA 2BDZA 3RNVA 2BTWA 3PNRA 2FT2A 2G7YA 3V6EA 1AIMA 4BQVA 2NQDB 5JZEA 4DMXA 1YZBA 2DOSA 4MZSA 2O6XA 1K3BB 3N4CA 5A24A 2DCBA 4D8EA 2DZYA 4PP2E 4WA6A 3KKUA 3OQCA 3ERVA 3IUTA 5JH3A 1EWLA 1M6DA 1NL6A 1U9XA 2FE8A 1AU3A 5EZQA 2YJBA 1CQDA 2IBIA 3WXEA 1CSBB 3LFYA 4REZA 2JTCA 3QJ3A 1DEUA 1VJVA 3M99A 2R9OA 3MORA 2CB5A 3BC3A 1DF0A 3KWZA 4RNAA 3MP2A 2DC9A 1CTEA 3TRKA 3DF0A 4I07A 2Z84A 2ATOA 5J94A 4P6GA 2UZJA 3K8UA 3KSEA 4CDCB 4MSXA 2E02A 4OW0A 4RF1A 4IUMA 5E6JA 2J7QC 2OZ2A 1AU4A 9PAPA 8PCHA 4GUAA 1KHQA 3CBKA 3IV2A 3S3RA 1PXVA 5EGWA 3H89A 3CH3X 1ME3A 2C0YA 4K7CA 1X9YA 1ZIVA 1CVZA 2FRAA 2OULA 2OP3A 3I3TA 2JQGR 3PHUA 1CPJA 3MTNA 5PADA 4RF0A 2YJ2A 4XUIA 3P5WA 3PT2A 1KHPA 1TLOA 1KXRA 4XZXA 3HHIA 2WBFX 2JRIA 4BSQA 2J7QA 5CHVA 2P0RA 2XU1A 3MJ5A 2AU1A 1MEMA 4BOUA 4IP3A 4XR7A 1NB3A 4PP1A 3P5VA 5F02A 2FRQA 3BWKA 1PADA 2Y6EA 1YALA 2PREA 2DC8A 2NQGA 2XU3A 1PBHA 2G6DA 4DMYA 3HWNA 2AYOA 3O0UA 2FUDA 2GHUA 4OEMA 3BOWA 1O0EA 3IEJA 2DC6A 3LXSA 4KLBA 1CB5A 1FH0A 2FTDA 2FO5A 1AECA 2AVWA 1PPNA 1SNKA 3RVXA 4FK5A 4W5BA 1PPPA 3F5VA 4WURA 3CH2X 2DZZA 3BB7A 2CIOA 1SP4B 5CVMA 4YYSA 2E00A 1UKFA 4R3DA 2YJ8A 5FPWA 4W4UA 1NQCA 1ATKA 4BPVA 1AYUA 3F75A 1BQIA 3GCBA 3OF8A 1CJLA 2XU5A 1PCIA 2HWKA 1A6RA 3PSEA 1PPOA 1POPA 1GECE 2B1NA 1AU0A 4P16A 2BU3A 2R9NA 3W31A 4OVZB 3WXGA 1U9WA 4I04A 5K16A 2R6NA 4YYRA 3I06A 4HXDB 4P6EA 3BPFA 3W30A 1F2CA 3MHHA 2DCAA 7PCKA 3USVA 1KFUL 1PE6A 1NB5A 3OVZA 3RVVA 3KWBX 2PNSA 2G8JA 2VHSA 3H7DA 4N79A 4PI3A 3TMPA 1EWOA 3PRPA 1BGOA 1MEGA 2YJCA 3PHWA 1PPDA 3WXFA 3E9SA 2AUZA 2XU4A 1TU6A 1Q6KA 2F1GA 3V6CA 3IFUA 4CDEB 2DCDA 3B21A 5CVOB 4I05A 4RKXA 3QT4A 4D8IA 2E01A 4FIPA 3NHEA 3BPMA 4N4ZA 3O1GA 3C0RA 2R9FA 4CDFB 3IHPA 3QSDA 3BBAA 1CS8A 2AYNA 4PT5A 4CZWA 2E03A 3E1ZB 1GCBA 2ACTA 3BY4A 4D8BA 4Q8HA 1MDWA 3MTVA 2FYEA 1CV8A 3N3KA 1EWPA 1NLJA 2H7JA 2PADA 4X6JA 2P86A 2R9MA 4AXLA 3PBHA 3U8EA 1U9QX 1F2BA 4CDDB 1AYVA 3CBJA 1TL9A 3K9MA 3O65A 4OVZA 1XKGA 4A5UA 4BS5A 3IOQA 4Q8GA 4BOSA 1DKIA 2HHNA 1STFE 2IPPB 1S4VA 4YVAA 2NQIA 4QRVA 2DC7A 3H8CA 2AGAA 1GMYA 2DCCA 3MHSA 3N3GA 1MHWA 4HWYA 2FQ9A 1Y4HA 3S3QA 5KO3A 5CVNB 1EWMA 3KW9A 2HXZA 2JQFR 4BS6A 3H8BA 1U5IA 4N8WA 5EF4A 3BCNA 4BOZA 1ME4A 1MS6A 1PVJA 3PDFA 2AUXA 3OISA 4RY2A 4PADA 2YJ9A 3OF9A 3HD3A 3D6SA 4AXMA 1QDQA 2F7DA 4G54A 4QH6A 3P5UA 2BTWB 4OELA 1AYWA 2HD5A 3P5XA 4YYWA 1EF7A 2AIMA 3TNXA 2AS8A 1F2AA 2P7UA 4YYUA 3PHXA 2B1MA 1VSNA 1QMYA 3ZNHA 2Y5BA 1ZCMA 2ARYA 2PBHA 3B79A 3PW3A 1GLOA 4YYQA 3KX1A 3KFQA 1NPZA 4YV8A 4BOPA 2DJGB 1F29A 1ICFA 4FJCA 2GFOA 1MIRA 4W5CA 4X6HA 1ITOA 1YK7A 1YVBA 4QRGA 4M0WA 6PADA 4MI7A 3HHAA 3AI8A 4X6IA 1AU2A 1KFXL 4ZUXU 2HH5A 2G8EA 1JQPA 1THEA 1QOLA 4MZOA 4YYVA 1BP4A 3ZUAA 4QBBA 4BOQA 1YK8A 3PRMA 5JA7A 1HUCB 1QXPA 2DJFB 3C9EA 1YT7A 2NQAA 1U9VA
chains in the Genus database with same CATH topology
1IWDA 3IMAA 1BY8A 1PIPA 2BDLA 4QRXA 1W6FA 3K24A 3RVWA 3H6SA 1Y08A 3OVXA 5CHTA 2R9CA 2VHFA 2BDZA 3PNRA 2FT2A 2G7YA 3V6EA 1AIMA 4BQVA 2NQDB 4DMXA 4MZSA 2O6XA 1K3BB 3N4CA 5A24A 2DCBA 2DZYA 4NV8A 4PP2E 4WA6A 3KKUA 3ERVA 2VFCA 3IUTA 5JH3A 1EWLA 1W4TA 1M6DA 1NL6A 1U9XA 1GX3A 1AU3A 2YJBA 1CQDA 2IBIA 3WXEA 1CSBB 3LFYA 3QJ3A 1DEUA 1VJVA 3M99A 2R9OA 3MORA 2CB5A 3BC3A 1DF0A 3KWZA 2DC9A 1CTEA 3DF0A 4I07A 2ATOA 5J94A 4P6GA 3K8UA 3KSEA 4CDCB 4MSXA 2E02A 2OZ2A 1AU4A 9PAPA 8PCHA 1KHQA 3CBKA 3IV2A 3S3RA 1PXVA 5EGWA 3H89A 3CH3X 1ME3A 2C0YA 4K7CA 1X9YA 1ZIVA 1CVZA 2FRAA 2OULA 2OP3A 3I3TA 2JQGR 1CPJA 3MTNA 5PADA 2YJ2A 4XUIA 3P5WA 1KHPA 1TLOA 1KXRA 3HHIA 2WBFX 1W5RA 4BSQA 5CHVA 2P0RA 2XU1A 2AU1A 1MEMA 4XR7A 1NB3A 4PP1A 3P5VA 5F02A 2FRQA 3BWKA 1PADA 2Y6EA 1YALA 2PREA 2DC8A 2NQGA 2VFBA 2XU3A 1PBHA 2G6DA 4DMYA 3HWNA 2AYOA 3O0UA 2FUDA 2GHUA 4OEMA 3BOWA 1O0EA 3IEJA 2DC6A 3LXSA 4KLBA 1CB5A 1FH0A 2FTDA 2FO5A 1AECA 4BGFA 2AVWA 1PPNA 1SNKA 3RVXA 4FK5A 4W5BA 1PPPA 3F5VA 3CH2X 4NV7A 2DZZA 2CIOA 1SP4B 5CVMA 4YYSA 2E00A 2YJ8A 5FPWA 4W4UA 1NQCA 4GUZA 1ATKA 4BPVA 1AYUA 3F75A 1BQIA 3GCBA 3OF8A 1CJLA 2XU5A 1PCIA 1A6RA 1PPOA 1POPA 1GECE 2B1NA 1AU0A 2R9NA 3WXGA 1U9WA 4I04A 5K16A 2R6NA 4YYRA 3I06A 4P6EA 1E2TA 3BPFA 1F2CA 3MHHA 2DCAA 7PCKA 3USVA 1KFUL 1PE6A 1NB5A 3OVZA 3RVVA 3KWBX 2PNSA 2G8JA 2VHSA 3H7DA 4N79A 4PI3A 1EWOA 1BGOA 1MEGA 2YJCA 1PPDA 3WXFA 2AUZA 2XU4A 1TU6A 1Q6KA 4C5PA 2F1GA 3V6CA 4CDEB 2DCDA 5CVOB 4I05A 3QT4A 2E01A 4FIPA 3NHEA 3BPMA 4N4ZA 3O1GA 2R9FA 4CDFB 3IHPA 3QSDA 1CS8A 2AYNA 4CZWA 2E03A 3E1ZB 1GCBA 2ACTA 4Q8HA 1MDWA 2FYEA 1CV8A 3N3KA 1EWPA 2BSZA 1NLJA 2H7JA 2PADA 4X6JA 2P86A 2R9MA 4AXLA 3PBHA 3U8EA 1U9QX 1F2BA 4CDDB 1AYVA 3CBJA 1TL9A 3K9MA 1XKGA 4BS5A 3IOQA 4Q8GA 2HHNA 1STFE 2IPPB 3D9WA 1S4VA 4YVAA 2NQIA 4QRVA 2DC7A 3H8CA 1GMYA 2DCCA 3MHSA 3N3GA 1MHWA 4HWYA 2FQ9A 1Y4HA 3S3QA 5CVNB 1EWMA 3KW9A 2HXZA 2JQFR 4BS6A 3H8BA 1U5IA 4N8WA 5EF4A 3BCNA 1MS6A 1ME4A 3PDFA 2AUXA 3OISA 4RY2A 4PADA 2YJ9A 3OF9A 3HD3A 3D6SA 4AXMA 1QDQA 2F7DA 4G54A 4QH6A 3P5UA 4OELA 1AYWA 2HD5A 3LTWA 3P5XA 4YYWA 1EF7A 2AIMA 3TNXA 2AS8A 1F2AA 2P7UA 4YYUA 2B1MA 1VSNA 1QMYA 2Y5BA 1ZCMA 2ARYA 2PBHA 3B79A 3PW3A 1GLOA 4YYQA 3KX1A 3KFQA 1NPZA 4YV8A 2DJGB 1F29A 1ICFA 4FJCA 2GFOA 1MIRA 4W5CA 4X6HA 1ITOA 1YK7A 1YVBA 4QRGA 6PADA 3HHAA 3AI8A 4X6IA 1AU2A 1KFXL 4ZUXU 2HH5A 2G8EA 1JQPA 1THEA 1QOLA 4MZOA 4YYVA 1BP4A 3ZUAA 4QBBA 1YK8A 5JA7A 1HUCB 1QXPA 2DJFB 3C9EA 1YT7A 2NQAA 1U9VA 4B55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IWD A;  3IMA A;  1BY8 A;  1PIP A;  2BDL A;  4QRX A;  3K24 A;  3RVW A;  3H6S A;  1Y08 A;  3OVX A;  5CHT A;  2R9C A;  2VHF A;  2BDZ A;  3PNR A;  2FT2 A;  2G7Y A;  3V6E A;  1AIM A;  4BQV A;  2NQD B;  4DMX A;  4MZS A;  2O6X A;  1K3B B;  3N4C A;  5A24 A;  2DCB A;  2DZY A;  4PP2 E;  4WA6 A;  3KKU A;  3ERV A;  3IUT A;  5JH3 A;  1EWL A;  1M6D A;  1NL6 A;  1U9X A;  1AU3 A;  2YJB A;  1CQD A;  2IBI A;  3WXE A;  1CSB B;  3LFY A;  3QJ3 A;  1DEU A;  1VJV A;  3M99 A;  2R9O A;  3MOR A;  2CB5 A;  3BC3 A;  1DF0 A;  3KWZ A;  2DC9 A;  1CTE A;  3DF0 A;  4I07 A;  2ATO A;  5J94 A;  4P6G A;  3K8U A;  3KSE A;  4CDC B;  4MSX A;  2E02 A;  2OZ2 A;  1AU4 A;  9PAP A;  8PCH A;  1KHQ A;  3CBK A;  3IV2 A;  3S3R A;  1PXV A;  5EGW A;  3H89 A;  3CH3 X;  1ME3 A;  2C0Y A;  4K7C A;  1X9Y A;  1ZIV A;  1CVZ A;  2FRA A;  2OUL A;  2OP3 A;  3I3T A;  2JQG R;  1CPJ A;  3MTN A;  5PAD A;  2YJ2 A;  4XUI A;  3P5W A;  1KHP A;  1TLO A;  1KXR A;  3HHI A;  2WBF X;  4BSQ A;  5CHV A;  2P0R A;  2XU1 A;  2AU1 A;  1MEM A;  4XR7 A;  1NB3 A;  4PP1 A;  3P5V A;  5F02 A;  2FRQ A;  3BWK A;  1PAD A;  2Y6E A;  1YAL A;  2PRE A;  2DC8 A;  2NQG A;  2XU3 A;  1PBH A;  2G6D A;  4DMY A;  3HWN A;  2AYO A;  3O0U A;  2FUD A;  2GHU A;  4OEM A;  3BOW A;  1O0E A;  3IEJ A;  2DC6 A;  3LXS A;  4KLB A;  1CB5 A;  1FH0 A;  2FTD A;  2FO5 A;  1AEC A;  2AVW A;  1PPN A;  1SNK A;  3RVX A;  4FK5 A;  4W5B A;  1PPP A;  3F5V A;  3CH2 X;  2DZZ A;  2CIO A;  1SP4 B;  5CVM A;  4YYS A;  2E00 A;  2YJ8 A;  5FPW A;  4W4U A;  1NQC A;  1ATK A;  4BPV A;  1AYU A;  3F75 A;  1BQI A;  3GCB A;  3OF8 A;  1CJL A;  2XU5 A;  1PCI A;  1A6R A;  1PPO A;  1POP A;  1GEC E;  2B1N A;  1AU0 A;  2R9N A;  3WXG A;  1U9W A;  4I04 A;  5K16 A;  2R6N A;  4YYR A;  3I06 A;  4P6E A;  3BPF A;  1F2C A;  3MHH A;  2DCA A;  7PCK A;  3USV A;  1KFU L;  1PE6 A;  1NB5 A;  3OVZ A;  3RVV A;  3KWB X;  2PNS A;  2G8J A;  2VHS A;  3H7D A;  4N79 A;  4PI3 A;  1EWO A;  1BGO A;  1MEG A;  2YJC A;  1PPD A;  3WXF A;  2AUZ A;  2XU4 A;  1TU6 A;  1Q6K A;  2F1G A;  3V6C A;  4CDE B;  2DCD A;  5CVO B;  4I05 A;  3QT4 A;  2E01 A;  4FIP A;  3NHE A;  3BPM A;  4N4Z A;  3O1G A;  2R9F A;  4CDF B;  3IHP A;  3QSD A;  1CS8 A;  2AYN A;  4CZW A;  2E03 A;  3E1Z B;  1GCB A;  2ACT A;  4Q8H A;  1MDW A;  2FYE A;  1CV8 A;  3N3K A;  1EWP A;  1NLJ A;  2H7J A;  2PAD A;  4X6J A;  2P86 A;  2R9M A;  4AXL A;  3PBH A;  3U8E A;  1U9Q X;  1F2B A;  4CDD B;  1AYV A;  3CBJ A;  1TL9 A;  3K9M A;  1XKG A;  4BS5 A;  3IOQ A;  4Q8G A;  2HHN A;  1STF E;  2IPP B;  1S4V A;  4YVA A;  2NQI A;  4QRV A;  2DC7 A;  3H8C A;  1GMY A;  2DCC A;  3MHS A;  3N3G A;  1MHW A;  4HWY A;  2FQ9 A;  1Y4H A;  3S3Q A;  5CVN B;  1EWM A;  3KW9 A;  2HXZ A;  2JQF R;  4BS6 A;  3H8B A;  1U5I A;  4N8W A;  5EF4 A;  3BCN A;  1ME4 A;  1MS6 A;  3PDF A;  2AUX A;  3OIS A;  4RY2 A;  4PAD A;  2YJ9 A;  3OF9 A;  3HD3 A;  3D6S A;  4AXM A;  1QDQ A;  2F7D A;  4G54 A;  4QH6 A;  3P5U A;  4OEL A;  1AYW A;  2HD5 A;  3P5X A;  4YYW A;  1EF7 A;  2AIM A;  3TNX A;  2AS8 A;  1F2A A;  2P7U A;  4YYU A;  2B1M A;  1VSN A;  1QMY A;  2Y5B A;  1ZCM A;  2ARY A;  2PBH A;  3B79 A;  3PW3 A;  1GLO A;  4YYQ A;  3KX1 A;  3KFQ A;  1NPZ A;  4YV8 A;  2DJG B;  1F29 A;  1ICF A;  4FJC A;  2GFO A;  1MIR A;  4W5C A;  4X6H A;  1ITO A;  1YK7 A;  1YVB A;  4QRG A;  6PAD A;  3HHA A;  3AI8 A;  4X6I A;  1AU2 A;  1KFX L;  4ZUX U;  2HH5 A;  2G8E A;  1JQP A;  1THE A;  1QOL A;  4MZO A;  4YYV A;  1BP4 A;  3ZUA A;  4QBB A;  1YK8 A;  5JA7 A;  1HUC B;  1QXP A;  2DJF B;  3C9E A;  1YT7 A;  2NQA A;  1U9V A; 
#chains in the Genus database with same CATH topology
 1IWD A;  3IMA A;  1BY8 A;  1PIP A;  2BDL A;  4QRX A;  3K24 A;  3RVW A;  3H6S A;  5EZS A;  1Y08 A;  3OVX A;  5CHT A;  4ZTB A;  4MM3 B;  2R9C A;  2VHF A;  2BDZ A;  3RNV A;  2BTW A;  3PNR A;  2FT2 A;  2G7Y A;  3V6E A;  1AIM A;  4BQV A;  2NQD B;  5JZE A;  4DMX A;  1YZB A;  2DOS A;  4MZS A;  2O6X A;  1K3B B;  3N4C A;  5A24 A;  2DCB A;  4D8E A;  2DZY A;  4PP2 E;  4WA6 A;  3KKU A;  3OQC A;  3ERV A;  3IUT A;  5JH3 A;  1EWL A;  1M6D A;  1NL6 A;  1U9X A;  2FE8 A;  1AU3 A;  5EZQ A;  2YJB A;  1CQD A;  2IBI A;  3WXE A;  1CSB B;  3LFY A;  4REZ A;  2JTC A;  3QJ3 A;  1DEU A;  1VJV A;  3M99 A;  2R9O A;  3MOR A;  2CB5 A;  3BC3 A;  1DF0 A;  3KWZ A;  4RNA A;  3MP2 A;  2DC9 A;  1CTE A;  3TRK A;  3DF0 A;  4I07 A;  2Z84 A;  2ATO A;  5J94 A;  4P6G A;  2UZJ A;  3K8U A;  3KSE A;  4CDC B;  4MSX A;  2E02 A;  4OW0 A;  4RF1 A;  4IUM A;  5E6J A;  2J7Q C;  2OZ2 A;  1AU4 A;  9PAP A;  8PCH A;  4GUA A;  1KHQ A;  3CBK A;  3IV2 A;  3S3R A;  1PXV A;  5EGW A;  3H89 A;  3CH3 X;  1ME3 A;  2C0Y A;  4K7C A;  1X9Y A;  1ZIV A;  1CVZ A;  2FRA A;  2OUL A;  2OP3 A;  3I3T A;  2JQG R;  3PHU A;  1CPJ A;  3MTN A;  5PAD A;  4RF0 A;  2YJ2 A;  4XUI A;  3P5W A;  3PT2 A;  1KHP A;  1TLO A;  1KXR A;  4XZX A;  3HHI A;  2WBF X;  2JRI A;  4BSQ A;  2J7Q A;  5CHV A;  2P0R A;  2XU1 A;  3MJ5 A;  2AU1 A;  1MEM A;  4BOU A;  4IP3 A;  4XR7 A;  1NB3 A;  4PP1 A;  3P5V A;  5F02 A;  2FRQ A;  3BWK A;  1PAD A;  2Y6E A;  1YAL A;  2PRE A;  2DC8 A;  2NQG A;  2XU3 A;  1PBH A;  2G6D A;  4DMY A;  3HWN A;  2AYO A;  3O0U A;  2FUD A;  2GHU A;  4OEM A;  3BOW A;  1O0E A;  3IEJ A;  2DC6 A;  3LXS A;  4KLB A;  1CB5 A;  1FH0 A;  2FTD A;  2FO5 A;  1AEC A;  2AVW A;  1PPN A;  1SNK A;  3RVX A;  4FK5 A;  4W5B A;  1PPP A;  3F5V A;  4WUR A;  3CH2 X;  2DZZ A;  3BB7 A;  2CIO A;  1SP4 B;  5CVM A;  4YYS A;  2E00 A;  1UKF A;  4R3D A;  2YJ8 A;  5FPW A;  4W4U A;  1NQC A;  1ATK A;  4BPV A;  1AYU A;  3F75 A;  1BQI A;  3GCB A;  3OF8 A;  1CJL A;  2XU5 A;  1PCI A;  2HWK A;  1A6R A;  3PSE A;  1PPO A;  1POP A;  1GEC E;  2B1N A;  1AU0 A;  4P16 A;  2BU3 A;  2R9N A;  3W31 A;  4OVZ B;  3WXG A;  1U9W A;  4I04 A;  5K16 A;  2R6N A;  4YYR A;  3I06 A;  4HXD B;  4P6E A;  3BPF A;  3W30 A;  1F2C A;  3MHH A;  2DCA A;  7PCK A;  3USV A;  1KFU L;  1PE6 A;  1NB5 A;  3OVZ A;  3RVV A;  3KWB X;  2PNS A;  2G8J A;  2VHS A;  3H7D A;  4N79 A;  4PI3 A;  3TMP A;  1EWO A;  3PRP A;  1BGO A;  1MEG A;  2YJC A;  3PHW A;  1PPD A;  3WXF A;  3E9S A;  2AUZ A;  2XU4 A;  1TU6 A;  1Q6K A;  2F1G A;  3V6C A;  3IFU A;  4CDE B;  2DCD A;  3B21 A;  5CVO B;  4I05 A;  4RKX A;  3QT4 A;  4D8I A;  2E01 A;  4FIP A;  3NHE A;  3BPM A;  4N4Z A;  3O1G A;  3C0R A;  2R9F A;  4CDF B;  3IHP A;  3QSD A;  3BBA A;  1CS8 A;  2AYN A;  4PT5 A;  4CZW A;  2E03 A;  3E1Z B;  1GCB A;  2ACT A;  3BY4 A;  4D8B A;  4Q8H A;  1MDW A;  3MTV A;  2FYE A;  1CV8 A;  3N3K A;  1EWP A;  1NLJ A;  2H7J A;  2PAD A;  4X6J A;  2P86 A;  2R9M A;  4AXL A;  3PBH A;  3U8E A;  1U9Q X;  1F2B A;  4CDD B;  1AYV A;  3CBJ A;  1TL9 A;  3K9M A;  3O65 A;  4OVZ A;  1XKG A;  4A5U A;  4BS5 A;  3IOQ A;  4Q8G A;  4BOS A;  1DKI A;  2HHN A;  1STF E;  2IPP B;  1S4V A;  4YVA A;  2NQI A;  4QRV A;  2DC7 A;  3H8C A;  2AGA A;  1GMY A;  2DCC A;  3MHS A;  3N3G A;  1MHW A;  4HWY A;  2FQ9 A;  1Y4H A;  3S3Q A;  5KO3 A;  5CVN B;  1EWM A;  3KW9 A;  2HXZ A;  2JQF R;  4BS6 A;  3H8B A;  1U5I A;  4N8W A;  5EF4 A;  3BCN A;  4BOZ A;  1ME4 A;  1MS6 A;  1PVJ A;  3PDF A;  2AUX A;  3OIS A;  4RY2 A;  4PAD A;  2YJ9 A;  3OF9 A;  3HD3 A;  3D6S A;  4AXM A;  1QDQ A;  2F7D A;  4G54 A;  4QH6 A;  3P5U A;  2BTW B;  4OEL A;  1AYW A;  2HD5 A;  3P5X A;  4YYW A;  1EF7 A;  2AIM A;  3TNX A;  2AS8 A;  1F2A A;  2P7U A;  4YYU A;  3PHX A;  2B1M A;  1VSN A;  1QMY A;  3ZNH A;  2Y5B A;  1ZCM A;  2ARY A;  2PBH A;  3B79 A;  3PW3 A;  1GLO A;  4YYQ A;  3KX1 A;  3KFQ A;  1NPZ A;  4YV8 A;  4BOP A;  2DJG B;  1F29 A;  1ICF A;  4FJC A;  2GFO A;  1MIR A;  4W5C A;  4X6H A;  1ITO A;  1YK7 A;  1YVB A;  4QRG A;  4M0W A;  6PAD A;  4MI7 A;  3HHA A;  3AI8 A;  4X6I A;  1AU2 A;  1KFX L;  4ZUX U;  2HH5 A;  2G8E A;  1JQP A;  1THE A;  1QOL A;  4MZO A;  4YYV A;  1BP4 A;  3ZUA A;  4QBB A;  4BOQ A;  1YK8 A;  3PRM A;  5JA7 A;  1HUC B;  1QXP A;  2DJF B;  3C9E A;  1YT7 A;  2NQA A;  1U9V A; 
#chains in the Genus database with same CATH homology
 1IWD A;  3IMA A;  1BY8 A;  1PIP A;  2BDL A;  4QRX A;  1W6F A;  3K24 A;  3RVW A;  3H6S A;  1Y08 A;  3OVX A;  5CHT A;  2R9C A;  2VHF A;  2BDZ A;  3PNR A;  2FT2 A;  2G7Y A;  3V6E A;  1AIM A;  4BQV A;  2NQD B;  4DMX A;  4MZS A;  2O6X A;  1K3B B;  3N4C A;  5A24 A;  2DCB A;  2DZY A;  4NV8 A;  4PP2 E;  4WA6 A;  3KKU A;  3ERV A;  2VFC A;  3IUT A;  5JH3 A;  1EWL A;  1W4T A;  1M6D A;  1NL6 A;  1U9X A;  1GX3 A;  1AU3 A;  2YJB A;  1CQD A;  2IBI A;  3WXE A;  1CSB B;  3LFY A;  3QJ3 A;  1DEU A;  1VJV A;  3M99 A;  2R9O A;  3MOR A;  2CB5 A;  3BC3 A;  1DF0 A;  3KWZ A;  2DC9 A;  1CTE A;  3DF0 A;  4I07 A;  2ATO A;  5J94 A;  4P6G A;  3K8U A;  3KSE A;  4CDC B;  4MSX A;  2E02 A;  2OZ2 A;  1AU4 A;  9PAP A;  8PCH A;  1KHQ A;  3CBK A;  3IV2 A;  3S3R A;  1PXV A;  5EGW A;  3H89 A;  3CH3 X;  1ME3 A;  2C0Y A;  4K7C A;  1X9Y A;  1ZIV A;  1CVZ A;  2FRA A;  2OUL A;  2OP3 A;  3I3T A;  2JQG R;  1CPJ A;  3MTN A;  5PAD A;  2YJ2 A;  4XUI A;  3P5W A;  1KHP A;  1TLO A;  1KXR A;  3HHI A;  2WBF X;  1W5R A;  4BSQ A;  5CHV A;  2P0R A;  2XU1 A;  2AU1 A;  1MEM A;  4XR7 A;  1NB3 A;  4PP1 A;  3P5V A;  5F02 A;  2FRQ A;  3BWK A;  1PAD A;  2Y6E A;  1YAL A;  2PRE A;  2DC8 A;  2NQG A;  2VFB A;  2XU3 A;  1PBH A;  2G6D A;  4DMY A;  3HWN A;  2AYO A;  3O0U A;  2FUD A;  2GHU A;  4OEM A;  3BOW A;  1O0E A;  3IEJ A;  2DC6 A;  3LXS A;  4KLB A;  1CB5 A;  1FH0 A;  2FTD A;  2FO5 A;  1AEC A;  4BGF A;  2AVW A;  1PPN A;  1SNK A;  3RVX A;  4FK5 A;  4W5B A;  1PPP A;  3F5V A;  3CH2 X;  4NV7 A;  2DZZ A;  2CIO A;  1SP4 B;  5CVM A;  4YYS A;  2E00 A;  2YJ8 A;  5FPW A;  4W4U A;  1NQC A;  4GUZ A;  1ATK A;  4BPV A;  1AYU A;  3F75 A;  1BQI A;  3GCB A;  3OF8 A;  1CJL A;  2XU5 A;  1PCI A;  1A6R A;  1PPO A;  1POP A;  1GEC E;  2B1N A;  1AU0 A;  2R9N A;  3WXG A;  1U9W A;  4I04 A;  5K16 A;  2R6N A;  4YYR A;  3I06 A;  4P6E A;  1E2T A;  3BPF A;  1F2C A;  3MHH A;  2DCA A;  7PCK A;  3USV A;  1KFU L;  1PE6 A;  1NB5 A;  3OVZ A;  3RVV A;  3KWB X;  2PNS A;  2G8J A;  2VHS A;  3H7D A;  4N79 A;  4PI3 A;  1EWO A;  1BGO A;  1MEG A;  2YJC A;  1PPD A;  3WXF A;  2AUZ A;  2XU4 A;  1TU6 A;  1Q6K A;  4C5P A;  2F1G A;  3V6C A;  4CDE B;  2DCD A;  5CVO B;  4I05 A;  3QT4 A;  2E01 A;  4FIP A;  3NHE A;  3BPM A;  4N4Z A;  3O1G A;  2R9F A;  4CDF B;  3IHP A;  3QSD A;  1CS8 A;  2AYN A;  4CZW A;  2E03 A;  3E1Z B;  1GCB A;  2ACT A;  4Q8H A;  1MDW A;  2FYE A;  1CV8 A;  3N3K A;  1EWP A;  2BSZ A;  1NLJ A;  2H7J A;  2PAD A;  4X6J A;  2P86 A;  2R9M A;  4AXL A;  3PBH A;  3U8E A;  1U9Q X;  1F2B A;  4CDD B;  1AYV A;  3CBJ A;  1TL9 A;  3K9M A;  1XKG A;  4BS5 A;  3IOQ A;  4Q8G A;  2HHN A;  1STF E;  2IPP B;  3D9W A;  1S4V A;  4YVA A;  2NQI A;  4QRV A;  2DC7 A;  3H8C A;  1GMY A;  2DCC A;  3MHS A;  3N3G A;  1MHW A;  4HWY A;  2FQ9 A;  1Y4H A;  3S3Q A;  5CVN B;  1EWM A;  3KW9 A;  2HXZ A;  2JQF R;  4BS6 A;  3H8B A;  1U5I A;  4N8W A;  5EF4 A;  3BCN A;  1MS6 A;  1ME4 A;  3PDF A;  2AUX A;  3OIS A;  4RY2 A;  4PAD A;  2YJ9 A;  3OF9 A;  3HD3 A;  3D6S A;  4AXM A;  1QDQ A;  2F7D A;  4G54 A;  4QH6 A;  3P5U A;  4OEL A;  1AYW A;  2HD5 A;  3LTW A;  3P5X A;  4YYW A;  1EF7 A;  2AIM A;  3TNX A;  2AS8 A;  1F2A A;  2P7U A;  4YYU A;  2B1M A;  1VSN A;  1QMY A;  2Y5B A;  1ZCM A;  2ARY A;  2PBH A;  3B79 A;  3PW3 A;  1GLO A;  4YYQ A;  3KX1 A;  3KFQ A;  1NPZ A;  4YV8 A;  2DJG B;  1F29 A;  1ICF A;  4FJC A;  2GFO A;  1MIR A;  4W5C A;  4X6H A;  1ITO A;  1YK7 A;  1YVB A;  4QRG A;  6PAD A;  3HHA A;  3AI8 A;  4X6I A;  1AU2 A;  1KFX L;  4ZUX U;  2HH5 A;  2G8E A;  1JQP A;  1THE A;  1QOL A;  4MZO A;  4YYV A;  1BP4 A;  3ZUA A;  4QBB A;  1YK8 A;  5JA7 A;  1HUC B;  1QXP A;  2DJF B;  3C9E A;  1YT7 A;  2NQA A;  1U9V A;  4B55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...