4BS5A

Mouse cathepsin s with covalent ligand
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
219
structure length
219
Chain Sequence
TLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKAMDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN S
publication title Identification of Potent and Selective Cathepsin S (Cats) Inhibitors Containing Different Central Cyclic Scaffolds.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 63
structure length 219
sequence length 219
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2013-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4bs5A00
3RVVA 4PP1A 1NPZA 3CH3X 1QOLA 1ME4A 2YJ2A 1MEMA 2R9FA 2FRQA 2XU4A 2AIMA 3WXEA 4YV8A 1GCBA 4FIPA 4CDCB 2DZYA 3HHIA 2HH5A 1CJLA 2HXZA 3IEJA 4MZOA 4PP2E 4YYRA 1F29A 1AU4A 4QRGA 1BGOA 3ZUAA 4QBBA 4X6JA 3KFQA 1CPJA 1PPPA 8PCHA 1AYUA 1YVBA 5K16A 2YJBA 1CS8A 2JQGR 4I07A 2FRAA 2NQGA 1XKGA 4OELA 4BQVA 2NQIA 2JQFR 3BPMA 3O0UA 4XUIA 4YYQA 3H7DA 3KX1A 2C0YA 2FTDA 5JA7A 2P7UA 3WXFA 1A6RA 5EGWA 2R9NA 2AYNA 4PADA 1NL6A 1U9QX 2AYOA 1PADA 2HD5A 2OZ2A 1U9WA 3V6CA 1AIMA 2NQAA 4MZSA 1F2AA 4P6EA 4KLBA 4XR7A 1AU2A 1F2BA 1TLOA 1MS6A 3CBJA 4MSXA 4QRVA 3HWNA 1GMYA 2G8JA 1CVZA 4WA6A 1AYWA 3OISA 5CVOB 2CIOA 2HHNA 1PBHA 4YYWA 2WBFX 1U9XA 3B79A 3PDFA 2OULA 1BY8A 5PADA 1STFE 1VSNA 4BS5A 1U9VA 4K7CA 5CVNB 5J94A 2ATOA 3OF9A 4YYVA 1MIRA 1U5IA 3C9EA 1POPA 3LXSA 1KFUL 3USVA 1AECA 1AYVA 4PI3A 4YYSA 3U8EA 1BQIA 3E1ZB 3HD3A 2H7JA 3P5VA 4CDEB 3H89A 4DMXA 3P5XA 2BDLA 1DEUA 4AXLA 1PPDA 2GFOA 1Y4HA 1Y08A 2VHFA 1CSBB 2DC6A 3RVWA 1KHQA 2DCCA 2BDZA 3GCBA 2AUXA 1CV8A 3IUTA 1ICFA 3MTNA 2R9MA 1F2CA 2DCBA 2NQDB 3H8CA 3RVXA 2FYEA 2FO5A 3MORA 3WXGA 5EF4A 2DC8A 1YK7A 3OVXA 1HUCB 1EWOA 3IHPA 2XU1A 4AXMA 1AU3A 4QRXA 3O1GA 3BOWA 1PXVA 2IBIA 1NB3A 1PPNA 3N3GA 4N4ZA 2FT2A 2DJFB 5CVMA 3BC3A 3S3QA 5JH3A 1CB5A 1JQPA 1GLOA 3KWZA 3BWKA 4YVAA 3DF0A 1TU6A 3AI8A 1NB5A 1EWPA 4Q8HA 1Q6KA 2YJ9A 4W5CA 1AU0A 1M6DA 4CDFB 5F02A 1BP4A 1IWDA 1KFXL 3ERVA 3PNRA 1QMYA 3M99A 2G6DA 2ACTA 1YK8A 4BSQA 3V6EA 3F75A 4I04A 1QDQA 2E00A 2FUDA 3IV2A 4OEMA 1SNKA 2F7DA 2P0RA 5FPWA 3S3RA 1QXPA 3P5UA 3H8BA 3D6SA 2PADA 2Y5BA 1S4VA 2E01A 2DC7A 4W4UA 1FH0A 3H6SA 3OF8A 2DJGB 2G8EA 2DZZA 3N3KA 5A24A 1EWLA 1NLJA 1MHWA 4G54A 4W5BA 1TL9A 3I3TA 3MHSA 4BPVA 2R9CA 3LFYA 4QH6A 1VJVA 3KSEA 3HHAA 1NQCA 2YJ8A 4ZUXU 1KHPA 2CB5A 2AVWA 3QT4A 2G7YA 1ZIVA 1CQDA 1THEA 3TNXA 3K8UA 3KW9A 1GECE 3IMAA 1PE6A 4YYUA 4FJCA 3F5VA 1ZCMA 2AU1A 1MEGA 3QSDA 1X9YA 3BCNA 2PNSA 3KKUA 1DF0A 3PW3A 1PIPA 4P6GA 1SP4B 2DC9A 4Q8GA 2YJCA 4CZWA 2DCDA 1YT7A 2PBHA 4CDDB 3NHEA 4RY2A 3K24A 2GHUA 7PCKA 1K3BB 4X6IA 2AUZA 2O6XA 2XU3A 2VHSA 2OP3A 2PREA 3PBHA 4DMYA 3K9MA 2E03A 1CTEA 3I06A 2AS8A 2F1GA 3KWBX 5CHVA 1EF7A 6PADA 1ME3A 1EWMA 1YALA 2B1NA 2Y6EA 4N79A 2XU5A 3N4CA 3QJ3A 1KXRA 4FK5A 4X6HA 9PAPA 1PCIA 3P5WA 2E02A 2FQ9A 3CBKA 2DCAA 3IOQA 3CH2X 1ATKA 4N8WA 1ITOA 1PPOA 2R6NA 1O0EA 2R9OA 2B1MA 1MDWA 2IPPB 2P86A 3BPFA 2ARYA 4HWYA 5CHTA 3MHHA 3OVZA 4I05A 4BS6A
chains in the Genus database with same CATH superfamily
3RVVA 4PP1A 1NPZA 3CH3X 1QOLA 1ME4A 2YJ2A 1MEMA 4P16A 2R9FA 2FRQA 2XU4A 2AIMA 3PHWA 4RKXA 2Z84A 3WXEA 4YV8A 1GCBA 4FIPA 5JZEA 4RNAA 4CDCB 2DZYA 4D8BA 3HHIA 2HH5A 1CJLA 2HXZA 3IEJA 4MZOA 4PP2E 4YYRA 1F29A 1AU4A 4QRGA 3MJ5A 1BGOA 3ZUAA 4QBBA 4X6JA 3KFQA 1CPJA 1PPPA 8PCHA 1AYUA 4GUAA 4ZTBA 1YVBA 3OQCA 5K16A 2YJBA 1CS8A 2JQGR 3MP2A 4I07A 2FRAA 2NQGA 1XKGA 4OELA 4BQVA 2NQIA 2JQFR 3BB7A 3BPMA 3O0UA 4XUIA 4YYQA 3H7DA 3BY4A 3KX1A 2C0YA 2FTDA 5JA7A 2P7UA 3WXFA 1A6RA 5EGWA 2R9NA 2AYNA 4PADA 1NL6A 1U9QX 2AYOA 1PADA 2HD5A 2OZ2A 4IUMA 1U9WA 3V6CA 1AIMA 2NQAA 4MM3B 4MZSA 1F2AA 4P6EA 4KLBA 4XR7A 1AU2A 1F2BA 1TLOA 1MS6A 3CBJA 4MSXA 4QRVA 3HWNA 3ZNHA 1GMYA 2G8JA 1CVZA 4WA6A 1AYWA 3OISA 4WURA 5CVOB 2CIOA 1PVJA 1DKIA 1PBHA 2HHNA 4YYWA 2WBFX 1U9XA 3B79A 3PDFA 2OULA 1BY8A 3PSEA 1STFE 5PADA 1VSNA 4BS5A 1U9VA 3E9SA 4K7CA 5CVNB 5J94A 2ATOA 3OF9A 4YYVA 1MIRA 1U5IA 3C9EA 1POPA 3LXSA 2BTWA 1KFUL 3USVA 1AECA 1AYVA 4PI3A 4IP3A 4YYSA 3U8EA 1BQIA 3E1ZB 3HD3A 2H7JA 3P5VA 4CDEB 3H89A 4DMXA 3P5XA 4PT5A 2BDLA 3RNVA 4XZXA 1DEUA 4AXLA 1PPDA 2GFOA 1Y4HA 1Y08A 2VHFA 1CSBB 2DC6A 3RVWA 4BOPA 1KHQA 2DCCA 4OVZB 4A5UA 2BDZA 3GCBA 2AUXA 1CV8A 3IUTA 1ICFA 4R3DA 2J7QA 4HXDB 3MTNA 4BOUA 4D8EA 2R9MA 1F2CA 2DCBA 2NQDB 3H8CA 3RVXA 2FYEA 2FO5A 2UZJA 3MORA 4RF0A 3WXGA 2BTWB 2DOSA 2DC8A 5EF4A 1YK7A 3OVXA 1HUCB 1EWOA 5EZQA 3IHPA 2XU1A 4AXMA 2AGAA 1AU3A 4QRXA 3O1GA 3TRKA 3BOWA 1PXVA 2IBIA 1NB3A 1PPNA 3N3GA 4N4ZA 2FT2A 3B21A 2DJFB 5CVMA 3BC3A 3S3QA 1UKFA 5JH3A 1CB5A 1JQPA 1GLOA 3KWZA 3BWKA 3IFUA 4YVAA 3DF0A 1TU6A 3AI8A 1NB5A 1EWPA 4BOQA 4Q8HA 1Q6KA 2YJ9A 4W5CA 1AU0A 1M6DA 4CDFB 5F02A 1BP4A 1IWDA 1KFXL 3ERVA 3PNRA 1QMYA 3M99A 2G6DA 2ACTA 3BBAA 1YK8A 4BSQA 3V6EA 2J7QC 3F75A 4I04A 1QDQA 2E00A 2FE8A 2FUDA 3IV2A 4OEMA 5EZSA 1SNKA 2F7DA 2P0RA 5FPWA 3S3RA 1QXPA 3P5UA 3H8BA 3D6SA 2PADA 2Y5BA 1S4VA 3O65A 2E01A 5E6JA 2DC7A 4W4UA 1FH0A 3H6SA 3OF8A 2DJGB 2G8EA 2DZZA 3N3KA 5A24A 1EWLA 1NLJA 1MHWA 4G54A 4W5BA 1TL9A 1YZBA 3I3TA 3TMPA 3MHSA 3PRPA 3W31A 4BOZA 4BPVA 2R9CA 3LFYA 4QH6A 1VJVA 3KSEA 5KO3A 3HHAA 1NQCA 2YJ8A 4ZUXU 4D8IA 1KHPA 2CB5A 2AVWA 3QT4A 2G7YA 1ZIVA 1CQDA 1THEA 3TNXA 2BU3A 3PT2A 2HWKA 3K8UA 3KW9A 1GECE 3IMAA 1PE6A 4YYUA 4FJCA 3F5VA 1ZCMA 3PHXA 3W30A 2AU1A 3MTVA 1MEGA 3QSDA 1X9YA 3BCNA 4REZA 2PNSA 3KKUA 1DF0A 3PW3A 1PIPA 4P6GA 1SP4B 2DC9A 4Q8GA 2YJCA 4RF1A 2JRIA 4CZWA 2DCDA 1YT7A 2PBHA 3PRMA 4CDDB 3NHEA 3PHUA 4RY2A 3K24A 2GHUA 4MI7A 7PCKA 1K3BB 4X6IA 2AUZA 2O6XA 2XU3A 2JTCA 2VHSA 2OP3A 2PREA 3PBHA 4DMYA 3K9MA 3C0RA 2E03A 1CTEA 3I06A 2AS8A 2F1GA 3KWBX 5CHVA 1EF7A 6PADA 1ME3A 1EWMA 1YALA 2B1NA 2Y6EA 4N79A 4BOSA 2XU5A 3N4CA 3QJ3A 1KXRA 4FK5A 4X6HA 9PAPA 1PCIA 4OW0A 3P5WA 2E02A 2FQ9A 3CBKA 2DCAA 3IOQA 3CH2X 1ATKA 4N8WA 1ITOA 1PPOA 2R6NA 4OVZA 1O0EA 2R9OA 2B1MA 1MDWA 2IPPB 4M0WA 2P86A 3BPFA 2ARYA 4HWYA 5CHTA 3MHHA 3OVZA 4I05A 4BS6A
chains in the Genus database with same CATH topology
3RVVA 4PP1A 1NPZA 3CH3X 1QOLA 1ME4A 2YJ2A 1MEMA 1W5RA 4NV8A 2R9FA 2FRQA 2XU4A 2AIMA 3WXEA 4YV8A 1GCBA 4FIPA 4CDCB 2DZYA 3HHIA 2HH5A 1CJLA 2HXZA 3IEJA 4MZOA 4PP2E 4YYRA 1F29A 1AU4A 4QRGA 1BGOA 3ZUAA 4QBBA 4X6JA 3KFQA 1CPJA 1PPPA 8PCHA 1AYUA 1YVBA 1W4TA 5K16A 2YJBA 1CS8A 2JQGR 4I07A 2FRAA 2NQGA 1XKGA 4OELA 4BQVA 2NQIA 2JQFR 3BPMA 3O0UA 4XUIA 3D9WA 4YYQA 3H7DA 3KX1A 2C0YA 2FTDA 5JA7A 2P7UA 3WXFA 1A6RA 5EGWA 2R9NA 2AYNA 4PADA 1NL6A 1U9QX 2AYOA 1PADA 2HD5A 2OZ2A 1U9WA 3V6CA 1E2TA 1AIMA 2NQAA 4MZSA 1F2AA 4P6EA 4KLBA 4XR7A 1AU2A 1F2BA 1TLOA 1MS6A 3CBJA 4MSXA 4QRVA 3HWNA 1GMYA 2G8JA 1CVZA 4WA6A 1AYWA 3OISA 5CVOB 2CIOA 2HHNA 1PBHA 4YYWA 2WBFX 1U9XA 3B79A 3PDFA 2BSZA 2OULA 1BY8A 5PADA 1STFE 1VSNA 4BS5A 1U9VA 4K7CA 5CVNB 5J94A 2ATOA 3OF9A 4YYVA 1MIRA 1U5IA 3C9EA 1POPA 3LXSA 1KFUL 3USVA 1AECA 1AYVA 4PI3A 4YYSA 3U8EA 1BQIA 3E1ZB 3HD3A 4NV7A 2H7JA 3P5VA 4CDEB 3H89A 4DMXA 3P5XA 2BDLA 1DEUA 4AXLA 1PPDA 2GFOA 1Y4HA 1Y08A 2VHFA 1CSBB 2DC6A 3RVWA 1W6FA 1KHQA 2DCCA 3LTWA 2BDZA 3GCBA 2AUXA 1CV8A 3IUTA 1ICFA 4C5PA 3MTNA 2R9MA 1F2CA 2DCBA 2NQDB 3H8CA 3RVXA 2FYEA 2FO5A 3MORA 3WXGA 5EF4A 2DC8A 1YK7A 3OVXA 1HUCB 1EWOA 3IHPA 2XU1A 4AXMA 1AU3A 4QRXA 3O1GA 3BOWA 1PXVA 2IBIA 1NB3A 1PPNA 3N3GA 4N4ZA 2FT2A 2DJFB 5CVMA 3BC3A 3S3QA 5JH3A 1CB5A 1JQPA 1GLOA 3KWZA 3BWKA 4YVAA 3DF0A 1TU6A 3AI8A 1NB5A 1EWPA 4Q8HA 4GUZA 1Q6KA 2YJ9A 4W5CA 1AU0A 1M6DA 4CDFB 5F02A 1BP4A 1IWDA 1KFXL 3ERVA 3PNRA 1QMYA 3M99A 2G6DA 2ACTA 1YK8A 4BSQA 3V6EA 3F75A 4I04A 1QDQA 2E00A 2FUDA 3IV2A 4OEMA 1SNKA 2F7DA 2P0RA 5FPWA 3S3RA 1QXPA 3P5UA 3H8BA 3D6SA 2PADA 2Y5BA 1S4VA 2E01A 2DC7A 4W4UA 1FH0A 3H6SA 3OF8A 2DJGB 2G8EA 2DZZA 3N3KA 5A24A 1EWLA 1NLJA 1MHWA 4G54A 4W5BA 1TL9A 3I3TA 3MHSA 4BPVA 2R9CA 3LFYA 4QH6A 1VJVA 3KSEA 3HHAA 1NQCA 2YJ8A 4ZUXU 1KHPA 2CB5A 2AVWA 3QT4A 2G7YA 1ZIVA 1CQDA 1THEA 3TNXA 3K8UA 3KW9A 1GECE 3IMAA 1PE6A 4YYUA 4FJCA 3F5VA 1ZCMA 2VFBA 2AU1A 1MEGA 3QSDA 1X9YA 3BCNA 2PNSA 3KKUA 1DF0A 3PW3A 1PIPA 4P6GA 1SP4B 2DC9A 4Q8GA 2YJCA 4CZWA 2DCDA 1YT7A 2PBHA 4CDDB 3NHEA 4RY2A 3K24A 2GHUA 7PCKA 1K3BB 4X6IA 2AUZA 2O6XA 2XU3A 2VHSA 2OP3A 2PREA 3PBHA 4DMYA 3K9MA 2E03A 1CTEA 3I06A 2AS8A 2F1GA 2VFCA 3KWBX 5CHVA 1EF7A 6PADA 1ME3A 1EWMA 4B55A 1YALA 2B1NA 2Y6EA 4N79A 1GX3A 2XU5A 3N4CA 3QJ3A 1KXRA 4FK5A 4X6HA 9PAPA 1PCIA 3P5WA 2E02A 2FQ9A 3CBKA 2DCAA 3IOQA 3CH2X 1ATKA 4N8WA 1ITOA 1PPOA 2R6NA 4BGFA 1O0EA 2R9OA 2B1MA 1MDWA 2IPPB 2P86A 3BPFA 2ARYA 4HWYA 5CHTA 3MHHA 3OVZA 4I05A 4BS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RVV A;  4PP1 A;  1NPZ A;  3CH3 X;  1QOL A;  1ME4 A;  2YJ2 A;  1MEM A;  2R9F A;  2FRQ A;  2XU4 A;  2AIM A;  3WXE A;  4YV8 A;  1GCB A;  4FIP A;  4CDC B;  2DZY A;  3HHI A;  2HH5 A;  1CJL A;  2HXZ A;  3IEJ A;  4MZO A;  4PP2 E;  4YYR A;  1F29 A;  1AU4 A;  4QRG A;  1BGO A;  3ZUA A;  4QBB A;  4X6J A;  3KFQ A;  1CPJ A;  1PPP A;  8PCH A;  1AYU A;  1YVB A;  5K16 A;  2YJB A;  1CS8 A;  2JQG R;  4I07 A;  2FRA A;  2NQG A;  1XKG A;  4OEL A;  4BQV A;  2NQI A;  2JQF R;  3BPM A;  3O0U A;  4XUI A;  4YYQ A;  3H7D A;  3KX1 A;  2C0Y A;  2FTD A;  5JA7 A;  2P7U A;  3WXF A;  1A6R A;  5EGW A;  2R9N A;  2AYN A;  4PAD A;  1NL6 A;  1U9Q X;  2AYO A;  1PAD A;  2HD5 A;  2OZ2 A;  1U9W A;  3V6C A;  1AIM A;  2NQA A;  4MZS A;  1F2A A;  4P6E A;  4KLB A;  4XR7 A;  1AU2 A;  1F2B A;  1TLO A;  1MS6 A;  3CBJ A;  4MSX A;  4QRV A;  3HWN A;  1GMY A;  2G8J A;  1CVZ A;  4WA6 A;  1AYW A;  3OIS A;  5CVO B;  2CIO A;  2HHN A;  1PBH A;  4YYW A;  2WBF X;  1U9X A;  3B79 A;  3PDF A;  2OUL A;  1BY8 A;  5PAD A;  1STF E;  1VSN A;  4BS5 A;  1U9V A;  4K7C A;  5CVN B;  5J94 A;  2ATO A;  3OF9 A;  4YYV A;  1MIR A;  1U5I A;  3C9E A;  1POP A;  3LXS A;  1KFU L;  3USV A;  1AEC A;  1AYV A;  4PI3 A;  4YYS A;  3U8E A;  1BQI A;  3E1Z B;  3HD3 A;  2H7J A;  3P5V A;  4CDE B;  3H89 A;  4DMX A;  3P5X A;  2BDL A;  1DEU A;  4AXL A;  1PPD A;  2GFO A;  1Y4H A;  1Y08 A;  2VHF A;  1CSB B;  2DC6 A;  3RVW A;  1KHQ A;  2DCC A;  2BDZ A;  3GCB A;  2AUX A;  1CV8 A;  3IUT A;  1ICF A;  3MTN A;  2R9M A;  1F2C A;  2DCB A;  2NQD B;  3H8C A;  3RVX A;  2FYE A;  2FO5 A;  3MOR A;  3WXG A;  5EF4 A;  2DC8 A;  1YK7 A;  3OVX A;  1HUC B;  1EWO A;  3IHP A;  2XU1 A;  4AXM A;  1AU3 A;  4QRX A;  3O1G A;  3BOW A;  1PXV A;  2IBI A;  1NB3 A;  1PPN A;  3N3G A;  4N4Z A;  2FT2 A;  2DJF B;  5CVM A;  3BC3 A;  3S3Q A;  5JH3 A;  1CB5 A;  1JQP A;  1GLO A;  3KWZ A;  3BWK A;  4YVA A;  3DF0 A;  1TU6 A;  3AI8 A;  1NB5 A;  1EWP A;  4Q8H A;  1Q6K A;  2YJ9 A;  4W5C A;  1AU0 A;  1M6D A;  4CDF B;  5F02 A;  1BP4 A;  1IWD A;  1KFX L;  3ERV A;  3PNR A;  1QMY A;  3M99 A;  2G6D A;  2ACT A;  1YK8 A;  4BSQ A;  3V6E A;  3F75 A;  4I04 A;  1QDQ A;  2E00 A;  2FUD A;  3IV2 A;  4OEM A;  1SNK A;  2F7D A;  2P0R A;  5FPW A;  3S3R A;  1QXP A;  3P5U A;  3H8B A;  3D6S A;  2PAD A;  2Y5B A;  1S4V A;  2E01 A;  2DC7 A;  4W4U A;  1FH0 A;  3H6S A;  3OF8 A;  2DJG B;  2G8E A;  2DZZ A;  3N3K A;  5A24 A;  1EWL A;  1NLJ A;  1MHW A;  4G54 A;  4W5B A;  1TL9 A;  3I3T A;  3MHS A;  4BPV A;  2R9C A;  3LFY A;  4QH6 A;  1VJV A;  3KSE A;  3HHA A;  1NQC A;  2YJ8 A;  4ZUX U;  1KHP A;  2CB5 A;  2AVW A;  3QT4 A;  2G7Y A;  1ZIV A;  1CQD A;  1THE A;  3TNX A;  3K8U A;  3KW9 A;  1GEC E;  3IMA A;  1PE6 A;  4YYU A;  4FJC A;  3F5V A;  1ZCM A;  2AU1 A;  1MEG A;  3QSD A;  1X9Y A;  3BCN A;  2PNS A;  3KKU A;  1DF0 A;  3PW3 A;  1PIP A;  4P6G A;  1SP4 B;  2DC9 A;  4Q8G A;  2YJC A;  4CZW A;  2DCD A;  1YT7 A;  2PBH A;  4CDD B;  3NHE A;  4RY2 A;  3K24 A;  2GHU A;  7PCK A;  1K3B B;  4X6I A;  2AUZ A;  2O6X A;  2XU3 A;  2VHS A;  2OP3 A;  2PRE A;  3PBH A;  4DMY A;  3K9M A;  2E03 A;  1CTE A;  3I06 A;  2AS8 A;  2F1G A;  3KWB X;  5CHV A;  1EF7 A;  6PAD A;  1ME3 A;  1EWM A;  1YAL A;  2B1N A;  2Y6E A;  4N79 A;  2XU5 A;  3N4C A;  3QJ3 A;  1KXR A;  4FK5 A;  4X6H A;  9PAP A;  1PCI A;  3P5W A;  2E02 A;  2FQ9 A;  3CBK A;  2DCA A;  3IOQ A;  3CH2 X;  1ATK A;  4N8W A;  1ITO A;  1PPO A;  2R6N A;  1O0E A;  2R9O A;  2B1M A;  1MDW A;  2IPP B;  2P86 A;  3BPF A;  2ARY A;  4HWY A;  5CHT A;  3MHH A;  3OVZ A;  4I05 A;  4BS6 A; 
#chains in the Genus database with same CATH topology
 3RVV A;  4PP1 A;  1NPZ A;  3CH3 X;  1QOL A;  1ME4 A;  2YJ2 A;  1MEM A;  4P16 A;  2R9F A;  2FRQ A;  2XU4 A;  2AIM A;  3PHW A;  4RKX A;  2Z84 A;  3WXE A;  4YV8 A;  1GCB A;  4FIP A;  5JZE A;  4RNA A;  4CDC B;  2DZY A;  4D8B A;  3HHI A;  2HH5 A;  1CJL A;  2HXZ A;  3IEJ A;  4MZO A;  4PP2 E;  4YYR A;  1F29 A;  1AU4 A;  4QRG A;  3MJ5 A;  1BGO A;  3ZUA A;  4QBB A;  4X6J A;  3KFQ A;  1CPJ A;  1PPP A;  8PCH A;  1AYU A;  4GUA A;  4ZTB A;  1YVB A;  3OQC A;  5K16 A;  2YJB A;  1CS8 A;  2JQG R;  3MP2 A;  4I07 A;  2FRA A;  2NQG A;  1XKG A;  4OEL A;  4BQV A;  2NQI A;  2JQF R;  3BB7 A;  3BPM A;  3O0U A;  4XUI A;  4YYQ A;  3H7D A;  3BY4 A;  3KX1 A;  2C0Y A;  2FTD A;  5JA7 A;  2P7U A;  3WXF A;  1A6R A;  5EGW A;  2R9N A;  2AYN A;  4PAD A;  1NL6 A;  1U9Q X;  2AYO A;  1PAD A;  2HD5 A;  2OZ2 A;  4IUM A;  1U9W A;  3V6C A;  1AIM A;  2NQA A;  4MM3 B;  4MZS A;  1F2A A;  4P6E A;  4KLB A;  4XR7 A;  1AU2 A;  1F2B A;  1TLO A;  1MS6 A;  3CBJ A;  4MSX A;  4QRV A;  3HWN A;  3ZNH A;  1GMY A;  2G8J A;  1CVZ A;  4WA6 A;  1AYW A;  3OIS A;  4WUR A;  5CVO B;  2CIO A;  1PVJ A;  1DKI A;  1PBH A;  2HHN A;  4YYW A;  2WBF X;  1U9X A;  3B79 A;  3PDF A;  2OUL A;  1BY8 A;  3PSE A;  1STF E;  5PAD A;  1VSN A;  4BS5 A;  1U9V A;  3E9S A;  4K7C A;  5CVN B;  5J94 A;  2ATO A;  3OF9 A;  4YYV A;  1MIR A;  1U5I A;  3C9E A;  1POP A;  3LXS A;  2BTW A;  1KFU L;  3USV A;  1AEC A;  1AYV A;  4PI3 A;  4IP3 A;  4YYS A;  3U8E A;  1BQI A;  3E1Z B;  3HD3 A;  2H7J A;  3P5V A;  4CDE B;  3H89 A;  4DMX A;  3P5X A;  4PT5 A;  2BDL A;  3RNV A;  4XZX A;  1DEU A;  4AXL A;  1PPD A;  2GFO A;  1Y4H A;  1Y08 A;  2VHF A;  1CSB B;  2DC6 A;  3RVW A;  4BOP A;  1KHQ A;  2DCC A;  4OVZ B;  4A5U A;  2BDZ A;  3GCB A;  2AUX A;  1CV8 A;  3IUT A;  1ICF A;  4R3D A;  2J7Q A;  4HXD B;  3MTN A;  4BOU A;  4D8E A;  2R9M A;  1F2C A;  2DCB A;  2NQD B;  3H8C A;  3RVX A;  2FYE A;  2FO5 A;  2UZJ A;  3MOR A;  4RF0 A;  3WXG A;  2BTW B;  2DOS A;  2DC8 A;  5EF4 A;  1YK7 A;  3OVX A;  1HUC B;  1EWO A;  5EZQ A;  3IHP A;  2XU1 A;  4AXM A;  2AGA A;  1AU3 A;  4QRX A;  3O1G A;  3TRK A;  3BOW A;  1PXV A;  2IBI A;  1NB3 A;  1PPN A;  3N3G A;  4N4Z A;  2FT2 A;  3B21 A;  2DJF B;  5CVM A;  3BC3 A;  3S3Q A;  1UKF A;  5JH3 A;  1CB5 A;  1JQP A;  1GLO A;  3KWZ A;  3BWK A;  3IFU A;  4YVA A;  3DF0 A;  1TU6 A;  3AI8 A;  1NB5 A;  1EWP A;  4BOQ A;  4Q8H A;  1Q6K A;  2YJ9 A;  4W5C A;  1AU0 A;  1M6D A;  4CDF B;  5F02 A;  1BP4 A;  1IWD A;  1KFX L;  3ERV A;  3PNR A;  1QMY A;  3M99 A;  2G6D A;  2ACT A;  3BBA A;  1YK8 A;  4BSQ A;  3V6E A;  2J7Q C;  3F75 A;  4I04 A;  1QDQ A;  2E00 A;  2FE8 A;  2FUD A;  3IV2 A;  4OEM A;  5EZS A;  1SNK A;  2F7D A;  2P0R A;  5FPW A;  3S3R A;  1QXP A;  3P5U A;  3H8B A;  3D6S A;  2PAD A;  2Y5B A;  1S4V A;  3O65 A;  2E01 A;  5E6J A;  2DC7 A;  4W4U A;  1FH0 A;  3H6S A;  3OF8 A;  2DJG B;  2G8E A;  2DZZ A;  3N3K A;  5A24 A;  1EWL A;  1NLJ A;  1MHW A;  4G54 A;  4W5B A;  1TL9 A;  1YZB A;  3I3T A;  3TMP A;  3MHS A;  3PRP A;  3W31 A;  4BOZ A;  4BPV A;  2R9C A;  3LFY A;  4QH6 A;  1VJV A;  3KSE A;  5KO3 A;  3HHA A;  1NQC A;  2YJ8 A;  4ZUX U;  4D8I A;  1KHP A;  2CB5 A;  2AVW A;  3QT4 A;  2G7Y A;  1ZIV A;  1CQD A;  1THE A;  3TNX A;  2BU3 A;  3PT2 A;  2HWK A;  3K8U A;  3KW9 A;  1GEC E;  3IMA A;  1PE6 A;  4YYU A;  4FJC A;  3F5V A;  1ZCM A;  3PHX A;  3W30 A;  2AU1 A;  3MTV A;  1MEG A;  3QSD A;  1X9Y A;  3BCN A;  4REZ A;  2PNS A;  3KKU A;  1DF0 A;  3PW3 A;  1PIP A;  4P6G A;  1SP4 B;  2DC9 A;  4Q8G A;  2YJC A;  4RF1 A;  2JRI A;  4CZW A;  2DCD A;  1YT7 A;  2PBH A;  3PRM A;  4CDD B;  3NHE A;  3PHU A;  4RY2 A;  3K24 A;  2GHU A;  4MI7 A;  7PCK A;  1K3B B;  4X6I A;  2AUZ A;  2O6X A;  2XU3 A;  2JTC A;  2VHS A;  2OP3 A;  2PRE A;  3PBH A;  4DMY A;  3K9M A;  3C0R A;  2E03 A;  1CTE A;  3I06 A;  2AS8 A;  2F1G A;  3KWB X;  5CHV A;  1EF7 A;  6PAD A;  1ME3 A;  1EWM A;  1YAL A;  2B1N A;  2Y6E A;  4N79 A;  4BOS A;  2XU5 A;  3N4C A;  3QJ3 A;  1KXR A;  4FK5 A;  4X6H A;  9PAP A;  1PCI A;  4OW0 A;  3P5W A;  2E02 A;  2FQ9 A;  3CBK A;  2DCA A;  3IOQ A;  3CH2 X;  1ATK A;  4N8W A;  1ITO A;  1PPO A;  2R6N A;  4OVZ A;  1O0E A;  2R9O A;  2B1M A;  1MDW A;  2IPP B;  4M0W A;  2P86 A;  3BPF A;  2ARY A;  4HWY A;  5CHT A;  3MHH A;  3OVZ A;  4I05 A;  4BS6 A; 
#chains in the Genus database with same CATH homology
 3RVV A;  4PP1 A;  1NPZ A;  3CH3 X;  1QOL A;  1ME4 A;  2YJ2 A;  1MEM A;  1W5R A;  4NV8 A;  2R9F A;  2FRQ A;  2XU4 A;  2AIM A;  3WXE A;  4YV8 A;  1GCB A;  4FIP A;  4CDC B;  2DZY A;  3HHI A;  2HH5 A;  1CJL A;  2HXZ A;  3IEJ A;  4MZO A;  4PP2 E;  4YYR A;  1F29 A;  1AU4 A;  4QRG A;  1BGO A;  3ZUA A;  4QBB A;  4X6J A;  3KFQ A;  1CPJ A;  1PPP A;  8PCH A;  1AYU A;  1YVB A;  1W4T A;  5K16 A;  2YJB A;  1CS8 A;  2JQG R;  4I07 A;  2FRA A;  2NQG A;  1XKG A;  4OEL A;  4BQV A;  2NQI A;  2JQF R;  3BPM A;  3O0U A;  4XUI A;  3D9W A;  4YYQ A;  3H7D A;  3KX1 A;  2C0Y A;  2FTD A;  5JA7 A;  2P7U A;  3WXF A;  1A6R A;  5EGW A;  2R9N A;  2AYN A;  4PAD A;  1NL6 A;  1U9Q X;  2AYO A;  1PAD A;  2HD5 A;  2OZ2 A;  1U9W A;  3V6C A;  1E2T A;  1AIM A;  2NQA A;  4MZS A;  1F2A A;  4P6E A;  4KLB A;  4XR7 A;  1AU2 A;  1F2B A;  1TLO A;  1MS6 A;  3CBJ A;  4MSX A;  4QRV A;  3HWN A;  1GMY A;  2G8J A;  1CVZ A;  4WA6 A;  1AYW A;  3OIS A;  5CVO B;  2CIO A;  2HHN A;  1PBH A;  4YYW A;  2WBF X;  1U9X A;  3B79 A;  3PDF A;  2BSZ A;  2OUL A;  1BY8 A;  5PAD A;  1STF E;  1VSN A;  4BS5 A;  1U9V A;  4K7C A;  5CVN B;  5J94 A;  2ATO A;  3OF9 A;  4YYV A;  1MIR A;  1U5I A;  3C9E A;  1POP A;  3LXS A;  1KFU L;  3USV A;  1AEC A;  1AYV A;  4PI3 A;  4YYS A;  3U8E A;  1BQI A;  3E1Z B;  3HD3 A;  4NV7 A;  2H7J A;  3P5V A;  4CDE B;  3H89 A;  4DMX A;  3P5X A;  2BDL A;  1DEU A;  4AXL A;  1PPD A;  2GFO A;  1Y4H A;  1Y08 A;  2VHF A;  1CSB B;  2DC6 A;  3RVW A;  1W6F A;  1KHQ A;  2DCC A;  3LTW A;  2BDZ A;  3GCB A;  2AUX A;  1CV8 A;  3IUT A;  1ICF A;  4C5P A;  3MTN A;  2R9M A;  1F2C A;  2DCB A;  2NQD B;  3H8C A;  3RVX A;  2FYE A;  2FO5 A;  3MOR A;  3WXG A;  5EF4 A;  2DC8 A;  1YK7 A;  3OVX A;  1HUC B;  1EWO A;  3IHP A;  2XU1 A;  4AXM A;  1AU3 A;  4QRX A;  3O1G A;  3BOW A;  1PXV A;  2IBI A;  1NB3 A;  1PPN A;  3N3G A;  4N4Z A;  2FT2 A;  2DJF B;  5CVM A;  3BC3 A;  3S3Q A;  5JH3 A;  1CB5 A;  1JQP A;  1GLO A;  3KWZ A;  3BWK A;  4YVA A;  3DF0 A;  1TU6 A;  3AI8 A;  1NB5 A;  1EWP A;  4Q8H A;  4GUZ A;  1Q6K A;  2YJ9 A;  4W5C A;  1AU0 A;  1M6D A;  4CDF B;  5F02 A;  1BP4 A;  1IWD A;  1KFX L;  3ERV A;  3PNR A;  1QMY A;  3M99 A;  2G6D A;  2ACT A;  1YK8 A;  4BSQ A;  3V6E A;  3F75 A;  4I04 A;  1QDQ A;  2E00 A;  2FUD A;  3IV2 A;  4OEM A;  1SNK A;  2F7D A;  2P0R A;  5FPW A;  3S3R A;  1QXP A;  3P5U A;  3H8B A;  3D6S A;  2PAD A;  2Y5B A;  1S4V A;  2E01 A;  2DC7 A;  4W4U A;  1FH0 A;  3H6S A;  3OF8 A;  2DJG B;  2G8E A;  2DZZ A;  3N3K A;  5A24 A;  1EWL A;  1NLJ A;  1MHW A;  4G54 A;  4W5B A;  1TL9 A;  3I3T A;  3MHS A;  4BPV A;  2R9C A;  3LFY A;  4QH6 A;  1VJV A;  3KSE A;  3HHA A;  1NQC A;  2YJ8 A;  4ZUX U;  1KHP A;  2CB5 A;  2AVW A;  3QT4 A;  2G7Y A;  1ZIV A;  1CQD A;  1THE A;  3TNX A;  3K8U A;  3KW9 A;  1GEC E;  3IMA A;  1PE6 A;  4YYU A;  4FJC A;  3F5V A;  1ZCM A;  2VFB A;  2AU1 A;  1MEG A;  3QSD A;  1X9Y A;  3BCN A;  2PNS A;  3KKU A;  1DF0 A;  3PW3 A;  1PIP A;  4P6G A;  1SP4 B;  2DC9 A;  4Q8G A;  2YJC A;  4CZW A;  2DCD A;  1YT7 A;  2PBH A;  4CDD B;  3NHE A;  4RY2 A;  3K24 A;  2GHU A;  7PCK A;  1K3B B;  4X6I A;  2AUZ A;  2O6X A;  2XU3 A;  2VHS A;  2OP3 A;  2PRE A;  3PBH A;  4DMY A;  3K9M A;  2E03 A;  1CTE A;  3I06 A;  2AS8 A;  2F1G A;  2VFC A;  3KWB X;  5CHV A;  1EF7 A;  6PAD A;  1ME3 A;  1EWM A;  4B55 A;  1YAL A;  2B1N A;  2Y6E A;  4N79 A;  1GX3 A;  2XU5 A;  3N4C A;  3QJ3 A;  1KXR A;  4FK5 A;  4X6H A;  9PAP A;  1PCI A;  3P5W A;  2E02 A;  2FQ9 A;  3CBK A;  2DCA A;  3IOQ A;  3CH2 X;  1ATK A;  4N8W A;  1ITO A;  1PPO A;  2R6N A;  4BGF A;  1O0E A;  2R9O A;  2B1M A;  1MDW A;  2IPP B;  2P86 A;  3BPF A;  2ARY A;  4HWY A;  5CHT A;  3MHH A;  3OVZ A;  4I05 A;  4BS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...