4W4UA

Structure of yeast saga dubm with sgf73 y57a mutant at 2.8 angstroms resolution
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
471
structure length
438
Chain Sequence
b'MSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALRQTGFIYLLTCAWKIQDAHEFWQFIINQIHQSYVLDLPNAKEVSRANNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNYHCGECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase
publication title Uncovering the role of Sgf73 in maintaining SAGA deubiquitinating module structure and activity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/hydrolase
total genus 135
structure length 438
sequence length 471
chains with identical sequence D
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2014-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4w4uA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4w4uA02
2NAAA 2Y1MA 1VSNA 5C13A 1KFUL 2PUYA 2FRQA 1EWLA 4GNDA 2AYNA 1THEA 2KYUA 4F52B 2MD7B 1WEVA 4G54A 3EB5A 2FTDA 5B79A 2JQGR 2K4DA 4B86C 3ZYQA 3HCSA 4MZOA 5DKAA 1CSBB 3U5PA 2BAYA 4MSXA 3RTRB 5LKXA 1PXVA 2CB5A 3KSEA 2IPPB 1CQDA 4P6EA 5H1TA 2Y1NA 1PPPA 5CHTA 2WBFX 1ME3A 1EWMA 2IDAA 3BC3A 3K8UA 4YV8A 2KWNA 5JG6A 4N3WA 1STFE 2P0RA 1AECA 5FB1A 3CBJA 4FK5A 4QF3A 4FO9A 2YJ9A 4B7YC 3O0UA 2XU5A 5TDWA 5FERA 1MDWA 1CPJA 2VHFA 3K9MA 1MHWA 1PADA 1Y4HA 2FUUA 2YYRA 4YBTA 2DCCA 1NQCA 3ZVZB 4IC3A 3N9PA 5B75A 2XU4A 2L0BA 3EB6A 2IBIA 3I06A 3DQVR 2E03A 4LKAA 1WEWA 3ZPV1 1SP4B 2FYEA 2YQLA 4LJNA 1IWDA 1YT7A 1WGMA 4YYUA 2LXHC 4GNEA 3V43A 2R9NA 2EODA 4BBQA 3KNVA 1FH0A 1PIPA 2NQGA 2FRAA 1AU2A 3O7AA 3DF0A 3H6SA 2MA5A 2PADA 4BS5A 3V6EA 3QT4A 1PE6A 3ZVYA 1Q6KA 5KH7A 4QRXA 3TNXA 3H8BA 4X6JA 5AIUA 1F29A 2DJGB 5FEYA 2K1JA 2KIZA 3USVA 1CVZA 2YURA 3DPLR 1YALA 1V87A 1IYMA 1ZIVA 3MHSA 1U9XA 2MD8C 4QF2A 4Q6FA 1X4JA 4W4UA 3CH2X 1LDKC 4QRVA 2UZGA 2VP7A 3O37A 1M6DA 5CVMA 4BSQA 3LQIA 2NQIA 5EF4A 2AN6A 2MNZA 3M99A 1DVPA 4V3LC 1WEUA 3OF9A 5AITA 3PNRA 4AVXA 2L80A 2VNFA 1AYWA 3LRQA 2L5UA 2YT5A 2D8SA 3RPGB 1MIRA 3KFQA 4MZSA 4AP4A 2LV9A 1WESA 4UI9B 2YJCA 2OULA 4BPVA 2H0DB 2VPBA 2YW8A 2R6NA 3GV4A 1K3BB 2JMJA 1AU0A 3KWZA 1T1HA 2MNYA 2RSDA 1DEUA 3GCBA 1NL6A 2DZYA 3C5KA 1AYVA 4QRGA 2XU1A 4YADA 2CSZA 5EGWA 2ATOA 3ZTGA 1ZCMA 3GL6A 3KV6A 2ECGA 1Y08A 1CHCA 1PPOA 4MVTA 3MHHA 4HWYA 2KWJA 3VK6A 5TDRA 5LKUA 2VPGA 4WZ2A 1KFXL 1NLJA 3NHEA 3U5NA 2E00A 1WEPA 2JMIA 4L58A 5H9MA 3LQJA 2AIMA 4YYQA 2ECWA 3OVZA 5PADA 3N9QA 2GHUA 1VD4A 5CVNB 2DZZA 2QJ0A 2LGLA 4R2YA 2ECVA 2GFOA 4OEMA 2KGGA 3U8EA 1MM3A 4WA6A 1EWPA 2FSAA 2L43A 1YK8A 2HH5A 2HYED 1GCBA 1ATKA 2HD5A 5JA7A 1QDQA 1CB5A 2L75A 4O64A 4AYCB 3O1GA 2FQ9A 4BQVA 4YYSA 1X9YA 5B77A 2R9CA 2LDRA 3H89A 1GLOA 1BORA 2VJFA 3N9OA 2LGVA 4BS6A 3SOWA 3SHBA 8PCHA 2YREA 2M6MA 2JQFR 5D1KB 1VJVA 1JM7B 1SNKA 2C2LA 1TU6A 2HDPA 4XUIA 4OELA 2DJFB 2ZETC 1AU4A 1NPZA 3HHAA 3N9NA 3P5XA 1ITOA 2HHNA 1WE9A 3N9LA 2G8JA 9PAPA 2VPDA 4A4CA 2E02A 3FL2A 5KH3A 3H8CA 3N3GA 1JQPA 2OP3A 2YQMA 2M1RA 4DMXA 2JRJA 2YJ2A 2QIZA 1MS6A 1PBHA 2AS8A 3F75A 3KV5A 1YVBA 3P5WA 1KHQA 2AU1A 3PURA 2LGKA 1CS8A 3D6SA 1WEOA 1WEQA 3KKUA 1NB3A 3T6RA 2LN0A 4CZWA 2DC8A 2KR4A 4GB0A 5B8DA 2EA6A 2XEUA 3BOWA 3KWBX 3P5VA 1ZBDB 4I7CA 2ECJA 4W5CA 3B79A 4QH6A 1QXPA 4PP2E 1EF7A 2P86A 2B1MA 2MIQA 2DCBA 3NG2A 1WILA 3K24A 3RVWA 1U9QX 4UP5A 3KX1A 3RVXA 1N87A 4GNFA 4YYWA 3RPGC 4CCGX 1G25A 2Y5BA 4PPEA 3IHPA 3IEJA 5D1MB 1YK7A 1MM2A 3HD3A 3BWKA 1BGOA 1VFYA 2I50A 5G05B 5K16A 2E01A 2E6RA 3ASLA 4P5OB 4I07A 3LQHA 4TKPB 4YYRA 1CJLA 4I04A 4C9ZA 2AVWA 4BHWA 4A0CD 2MT5A 1PPNA 3MORA 2BDZA 3QSDA 3O35A 2RI7A 3PW3A 2XB1A 1NB5A 2B1NA 4XI1A 5TABA 1AIMA 3PBHA 2YUCA 3ZPVE 1JOCA 3U5OA 2PBHA 3IUTA 3BCNA 3O70A 2M85A 1HUCB 2AYOA 2BDLA 2VJFB 4CA1A 1ICFA 3IMAA 3HCTA 5TRBA 2ARYA 2JMDA 2YHNA 3KQIA 2DC9A 1WENA 4X6IA 2DX8A 5LKZA 5KH9A 4AXLA 1PPDA 6PADA 2P7UA 4N4FA 3PHDA 1U9WA 2Y6EA 2YJ8A 1X4UA 2LXPC 3U5MA 2DCAA 4AXMA 4CDDB 4A4BA 4R8PK 2HXZA 2AUXA 1TL9A 2LRIC 1QMYA 2FUDA 3T7LA 5LKTA 5FPWA 3MTNA 4N8WA 1DF0A 2NQAA 2LQ6A 1BY8A 4S3OB 4FIPA 3AI8A 2E6SA 2G43A 4YAXA 4CDCB 2CIOA 4XR7A 3S3RA 2G45A 4I7BA 4WZ3B 1EWOA 1AYUA 1F62A 2ACTA 1XWHA 2KE1A 2O6XA 5C11A 2PNSA 2MUMA 1Z6UA 3OF8A 5A24A 2KREA 3BPMA 2C0YA 2K16A 4P6GA 1O0EA 2ECIA 1XKGA 2VPEA 3P5UA 1A6RA 5B76A 1ME4A 4YVAA 3O34A 3HHIA 5B78A 3KW9A 2KFTA 5G04B 2CKLA 3E1ZB 2DCDA 1BP4A 3L1XA 2H0DA 1F2CA 2G6DA 1MEMA 1HYJA 4V3KC 2M3HA 3V6CA 1WFKA 1VYXA 3O33A 5EYAF 5CVOB 4X3GA 3ZUAA 4YC9A 4ZUXU 2VJEA 3ZNIA 1E4UA 3N9MA 2KWKA 4Q8GA 4A49A 2ECTA 2H7JA 1Z60A 3WXEA 4LLBA 1U5IA 2KWOA 3SOXA 4CDEB 3WXFA 2LGGA 1U9VA 2R9FA 2YHOA 5I3LA 4I7DA 1LDJB 1QOLA 1K2FA 5JH3A 3M62A 3N3KA 1F2AA 4RY2A 3S3QA 2QICA 2YU4A 2CSYA 3QZVA 4FJCA 3BPFA 3N4CA 4I05A 2C2VS 2OXQC 2F7DA 3L11A 4DMYA 4UP0A 4ZQLA 4CDFB 2R9OA 1AU3A 2XU3A 4X6HA 2CT2A 2G6QA 4YBSA 1KXRA 1POPA 1FP0A 2ECNA 3HCUA 2F6NA 1FBVA 4GNGA 4AYCA 2NQDB 1GECE 3HWNA 2EGPA 3LXSA 3OVXA 2KU3A 3O36A 1F2BA 1MEGA 4L7XA 5D1LB 1WIMA 3QJ3A 5CHVA 2DC6A 1Z2QA 3PDFA 1KHPA 1BQIA 1JM7A 4ZDTA 4YATA 7PCKA 5F02A 3H7DA 4WZ0A 1RMDA 3PUQA 5J3XA 3I3TA 5TBNA 3I2DA 1GMYA 1U6GB 1HYIA 2YSJA 2VHSA 2G7YA 3ERVA 3HTKC 4PP1A 2AUZA 4LADB 2YSMA 2FUIA 2K17A 3M63A 4N79A 3WXGA 4YYVA 2Y43A 4NN2A 2DC7A 2FT2A 4AUQB 4YABA 3C9EA 5H1UA 4QBBA 1S4VA 3CBKA 5FB0A 4PI3A 4PTBA 3LFYA 2CKLB 3CH3X 4W5BA 1WEMA 2FO5A 4LK9A 3IOQA 4S3OC 1PCIA 2F6JA 2F1GA 4R7EA 2PREA 3L1ZB 1TLOA 2R9MA 4N4ZA 3F5VA 2OZ2A 5J94A 1X4IA 2G8EA 2VJEB 3SOUA 2F42A 1CTEA 4K7CA 5G0FA 4Q8HA 3OISA 2MA6A 4KLBA 3IV2A 4IC2A 2KGIA 3C6WA 5DINA 2PNXA 2YJBA 1WEEA 3RVVA 5H1VA 4PADA 1CV8A 5LCWB 4YBMA
chains in the Genus database with same CATH superfamily
2NAAA 2Y1MA 1VSNA 5C13A 2EGMA 5SVIB 1KFUL 3BY4A 2PUYA 3W30A 2FRQA 1EWLA 5EZQA 4GNDA 2AYNA 1THEA 2KYUA 4F52B 2MD7B 1WEVA 4G54A 3EB5A 2FTDA 5B79A 2JQGR 2K4DA 4B86C 3PRMA 3ZYQA 3HCSA 4OVZA 4MZOA 4XZXA 5DKAA 1CSBB 2JTCA 3U5PA 3O65A 2BAYA 4MSXA 3RTRB 5LKXA 1PXVA 2CB5A 3KSEA 2IPPB 1CQDA 4P6EA 5H1TA 2Y1NA 2CSVA 1PPPA 1MBMA 2WBFX 5CHTA 1ME3A 3TMPA 1EWMA 2IDAA 3BC3A 2J7QA 3K8UA 4YV8A 2KWNA 3W31A 5JG6A 4N3WA 1STFE 2P0RA 1AECA 5FB1A 3CBJA 4FK5A 4QF3A 4FO9A 2YJ9A 4B7YC 3O0UA 3PHWA 2XU5A 5TDWA 5FERA 1MDWA 1CPJA 2VHFA 3K9MA 1MHWA 1PADA 1Y4HA 2FUUA 2YYRA 2E61A 4PT5A 4YBTA 2DCCA 1NQCA 3ZVZB 3PRPA 2KKYA 4IC3A 4HXDB 2IQJA 3N9PA 4Z0RA 4F1PA 5B75A 2XU4A 4OW0A 2L0BA 3EB6A 2JRIA 2IBIA 3I06A 4R3DA 4D8EA 3DQVR 2E03A 4LKAA 1WEWA 3ZPV1 4MM3B 1SP4B 2FYEA 4D8IA 2YQLA 2D8UA 4LJNA 2CRWA 1WGMA 1IWDA 2LXHC 4GNEA 3JUEA 3V43A 1DKIA 2R9NA 2EODA 4BBQA 3KNVA 3PSEA 1FH0A 2XOZA 1PIPA 2NQGA 2FRAA 1AU2A 3O7AA 3DF0A 3H6SA 2MA5A 2PADA 2M13A 4BS5A 3V6EA 4GUAA 3QT4A 1PE6A 3ZVYA 1Q6KA 5KH7A 4QRXA 3TNXA 3H8BA 4X6JA 5AIUA 1F29A 2DJGB 5FEYA 2K1JA 1YZBA 2KIZA 3USVA 4QQ4A 1CVZA 2YURA 3DPLR 4IUMA 1YALA 1V87A 1IYMA 1ZIVA 3FEHA 3MHSA 1U9XA 2MD8C 3RNVA 4QF2A 4Q6FA 1X4JA 4W4UA 3CH2X 1LDKC 4QRVA 2UZGA 2VP7A 3O37A 1M6DA 5CVMA 4BSQA 3LQIA 3IFUA 2NQIA 5EF4A 2AN6A 2MNZA 3M99A 1DVPA 4V3LC 1WEUA 3OF9A 5AITA 3PNRA 4AVXA 2L80A 2VNFA 1AYWA 3LRQA 2L5UA 2YT5A 2D8SA 3RPGB 1MIRA 3KFQA 4MZSA 4A5UA 4AP4A 3MP2A 2LV9A 1WESA 4UI9B 2YJCA 2JUNA 2OULA 4BPVA 2H0DB 2VPBA 2YW8A 2R6NA 3GV4A 3BB7A 1K3BB 2JMJA 1AU0A 3KWZA 4P16A 1T1HA 2MNYA 2RSDA 1DEUA 3GCBA 1NL6A 3C0RA 2DZYA 3C5KA 1AYVA 4QRGA 1YT7A 4RNAA 2XU1A 4YADA 2CSZA 3DWDA 5EGWA 2ATOA 3ZTGA 2XP0A 1ZCMA 3GL6A 3KV6A 2ECGA 1Y08A 1CHCA 1PPOA 4MVTA 3MHHA 4HWYA 4RF1A 4BOZA 2KWJA 3VK6A 5TDRA 5LKUA 2VPGA 4WZ2A 1KFXL 1NLJA 2XOCA 3MJ5A 3NHEA 3U5NA 2E00A 1WEPA 2JMIA 4L58A 3LDYA 2YVRA 5H9MA 2EXUA 3LQJA 2AIMA 4YYQA 2ECWA 3OVZA 5PADA 3N9QA 2GHUA 4ZTBA 1VD4A 3B21A 5CVNB 2DZZA 2QJ0A 2LGLA 4R2YA 2ECVA 2GFOA 4OEMA 2KGGA 3U8EA 4YYSA 1MM3A 4WA6A 1EWPA 2FSAA 2L43A 1YK8A 2HH5A 2HYED 1GCBA 1ATKA 4RF0A 2HD5A 2DOSA 5JA7A 3MTVA 1QDQA 1CB5A 2L75A 4O64A 4AYCB 3O1GA 2FQ9A 4BOSA 4BQVA 1X9YA 5B77A 2R9CA 2LDRA 3H89A 1GLOA 1BORA 2VJFA 3N9OA 2LGVA 4BS6A 3SOWA 3SHBA 8PCHA 2YREA 2M6MA 2JQFR 4MI7A 5D1KB 2MKEA 1VJVA 1JM7B 1SNKA 2C2LA 1TU6A 2HDPA 4XUIA 4OELA 2DJFB 2ZETC 1AU4A 1NPZA 3HHAA 3N9NA 3P5XA 1ITOA 2HHNA 1WE9A 3N9LA 4H9DA 2G8JA 5K3QA 9PAPA 2VPDA 4A4CA 2E02A 3FL2A 5KH3A 3H8CA 3N3GA 1JQPA 2OP3A 2YQMA 2M1RA 4DMXA 2JRJA 2YJ2A 2QIZA 1MS6A 1PBHA 2AS8A 4REZA 3F75A 2CONA 3KV5A 1YVBA 3P5WA 1KHQA 2AU1A 3PURA 2LGKA 1CS8A 2Z84A 3D6SA 1WEOA 1WEQA 3KKUA 1NB3A 3T6RA 4BOUA 2LN0A 2RR4A 4CZWA 2DC8A 2KR4A 4GB0A 5B8DA 2EA6A 2XEUA 3BOWA 3KWBX 3P5VA 3LVRE 1ZBDB 4I7CA 2ECJA 4W5CA 3B79A 4QH6A 3Q1DA 2DSMA 1QXPA 4PP2E 1EF7A 4YYUA 2UZJA 3FJUB 2P86A 3MDBC 2B1MA 2MIQA 2DCBA 3NG2A 3T9KA 3PLWA 2BTWB 1WILA 4D8BA 3K24A 4BOPA 3RVWA 1U9QX 4UP5A 3KX1A 3BBAA 3RVXA 1N87A 4GNFA 4YYWA 3ZNHA 3RPGC 4CCGX 1G25A 2Y5BA 4PPEA 3IHPA 3IEJA 2KKXA 5D1MB 4IP3A 1YK7A 1MM2A 3HD3A 3O47A 3BWKA 1BGOA 1VFYA 2I50A 5G05B 5EZSA 2E01A 5K16A 2E6RA 3ASLA 4P5OB 2J7QC 3LQHA 4TKPB 4I07A 4YYRA 1CJLA 4I04A 4OVZB 4C9ZA 2AVWA 4BHWA 4BOQA 4A0CD 2MT5A 1PPNA 3MORA 2BDZA 3QSDA 3O35A 2RI7A 4Z0OA 3PW3A 2FD4A 2XB1A 3LVQE 1NB5A 3DDTA 2B1NA 4XI1A 3H7HA 5TABA 1AIMA 3PBHA 2YUCA 3ZPVE 1JOCA 3U5OA 2PBHA 3IUTA 3BCNA 3O70A 2M85A 1HUCB 2AYOA 2BDLA 2VJFB 4CA1A 1ICFA 5SVXA 3IMAA 3HCTA 5TRBA 2ARYA 2JMDA 2YHNA 3KQIA 2DC9A 1WENA 4X6IA 2DX8A 5LKZA 3FM8C 5KH9A 4AXLA 1PPDA 6PADA 2P7UA 4N4FA 5KO3A 3PHDA 3PHXA 1U9WA 2Y6EA 2YJ8A 1X4UA 2LXPC 3U5MA 2DCAA 4AXMA 4CDDB 4A4BA 4R8PK 1UKFA 2HXZA 2AUXA 1TL9A 2LRIC 1QMYA 2FUDA 3T7LA 5LKTA 3M7KA 5FPWA 3MTNA 4N8WA 1DF0A 2NQAA 2LQ6A 1BY8A 4S3OB 4FIPA 3AI8A 1DCQA 3TRKA 3OQCA 2E6SA 2G43A 4YAXA 4CDCB 2CIOA 4XR7A 5JZEA 3S3RA 2G45A 4I7BA 4OGEA 4WZ3B 1EWOA 1AYUA 1F62A 2OWAA 2ACTA 1XWHA 2KE1A 2DJAA 2O6XA 5C11A 2PNSA 2MUMA 1Z6UA 3E9SA 2JM3A 3OF8A 5A24A 2KREA 3BPMA 2C0YA 2K16A 4P6GA 1O0EA 2ECIA 1XKGA 2VPEA 3P5UA 1A6RA 5B76A 1ME4A 4YVAA 3O34A 3HHIA 5B78A 3KW9A 1PVJA 2KFTA 5G04B 2CKLA 3E1ZB 2DCDA 1BP4A 3L1XA 2H0DA 1F2CA 2G6DA 1MEMA 1HYJA 3FAOA 2M3HA 4V3KC 3E2DA 1WFKA 1VYXA 3O33A 5EYAF 4OGCA 4X3GA 5CVOB 3V6CA 3ZUAA 4YC9A 4ZUXU 2VJEA 3ZNIA 1E4UA 3N9MA 2KWKA 4Q8GA 4A49A 2ECTA 2H7JA 1Z60A 3WXEA 4LLBA 1U5IA 2KWOA 3SOXA 4CDEB 3WXFA 2LGGA 1U9VA 2R9FA 4WURA 2YHOA 5I3LA 4I7DA 1LDJB 3FANA 5SVIA 4M0WA 1QOLA 1K2FA 5JH3A 3M62A 3N3KA 1F2AA 4RKXA 4RY2A 3S3QA 2QICA 2YU4A 2CSYA 2CRRA 3QZVA 4FJCA 3BPFA 3N4CA 4I05A 2C2VS 2OXQC 2F7DA 2B0OE 3L11A 4UP0A 4ZQLA 4CDFB 4DMYA 2R9OA 1AU3A 2XU3A 4X6HA 2CT2A 2G6QA 4YBSA 1KXRA 1POPA 1FP0A 2ECNA 3HCUA 2F6NA 1FBVA 4GNGA 4AYCA 2NQDB 2P57A 1GECE 3HWNA 3PHUA 2EGPA 5E6JA 2AGAA 3LXSA 2LAUA 3OVXA 2KU3A 3O36A 1F2BA 1MEGA 4L7XA 5D1LB 1WIMA 3QJ3A 5CHVA 2DC6A 1Z2QA 2BU3A 3PDFA 1KHPA 1BQIA 1JM7A 4ZDTA 4YATA 7PCKA 5F02A 3H7DA 4WZ0A 1RMDA 3PUQA 5J3XA 3I3TA 3SUBA 5TBNA 3I2DA 1GMYA 1U6GB 1HYIA 2YSJA 3KDEC 2G7YA 2VHSA 3ERVA 3HTKC 4PP1A 2AUZA 4LADB 2YSMA 2FUIA 2K17A 3M63A 4N79A 3WXGA 4YYVA 2Y43A 4NN2A 3PT2A 2DC7A 2FT2A 2FFWA 4AUQB 4YABA 3C9EA 5H1UA 4QBBA 1S4VA 3CBKA 5FB0A 4PI3A 4PTBA 3LFYA 2CKLB 2L7PA 4O62A 3CH3X 3LJUX 1WEMA 2FO5A 4W5BA 4LK9A 3IOQA 4S3OC 1PCIA 2F6JA 2F1GA 4R7EA 2PREA 3L1ZB 5SVYA 1TLOA 2R9MA 2FE8A 4N4ZA 3F5VA 2OZ2A 5J94A 1X4IA 2G8EA 2VJEB 3SOUA 2F42A 1CTEA 4K7CA 2XOYA 5G0FA 4Q8HA 3OISA 2MA6A 4KLBA 3IV2A 4IC2A 2KGIA 3C6WA 5DINA 2PNXA 2YJBA 2HWKA 1WEEA 3RVVA 5H1VA 2BTWA 4PADA 1CV8A 5LCWB 4YBMA
chains in the Genus database with same CATH topology
2NAAA 2Y1MA 1VSNA 5C13A 1KFUL 2PUYA 2FRQA 1EWLA 4GNDA 2AYNA 1THEA 2KYUA 4F52B 2MD7B 1WEVA 4G54A 3EB5A 2FTDA 5B79A 2JQGR 2K4DA 4B86C 3ZYQA 3HCSA 4MZOA 5DKAA 1CSBB 3U5PA 2BAYA 4MSXA 3RTRB 5LKXA 1PXVA 2CB5A 3KSEA 2IPPB 1CQDA 4P6EA 5H1TA 2Y1NA 1PPPA 5CHTA 2WBFX 1ME3A 1EWMA 2IDAA 3BC3A 3K8UA 4YV8A 2KWNA 5JG6A 4N3WA 1STFE 2P0RA 1AECA 5FB1A 3CBJA 4FK5A 4QF3A 4FO9A 2YJ9A 4B7YC 3O0UA 2XU5A 5TDWA 5FERA 1MDWA 1CPJA 2VHFA 3K9MA 1MHWA 1PADA 1Y4HA 2FUUA 2YYRA 4YBTA 2DCCA 1NQCA 3ZVZB 4IC3A 3N9PA 5B75A 2XU4A 2L0BA 3EB6A 2IBIA 3I06A 3DQVR 2E03A 4LKAA 1WEWA 3ZPV1 1SP4B 2FYEA 2YQLA 4LJNA 1IWDA 1YT7A 1WGMA 4YYUA 2LXHC 4GNEA 3V43A 2R9NA 2EODA 4BBQA 3KNVA 1FH0A 1PIPA 2NQGA 2FRAA 1AU2A 3O7AA 3DF0A 4B55A 3H6SA 2MA5A 2PADA 4BS5A 3LTWA 3V6EA 3QT4A 1PE6A 3ZVYA 1Q6KA 5KH7A 4QRXA 3TNXA 3H8BA 4X6JA 5AIUA 1F29A 4C5PA 2DJGB 5FEYA 2K1JA 2KIZA 3USVA 1CVZA 2YURA 3DPLR 1YALA 1V87A 1IYMA 1ZIVA 3MHSA 1U9XA 2MD8C 4QF2A 4Q6FA 1X4JA 4W4UA 3CH2X 1LDKC 4QRVA 2UZGA 2VP7A 3O37A 1M6DA 5CVMA 4BSQA 3LQIA 2NQIA 5EF4A 2AN6A 2MNZA 3M99A 1DVPA 4V3LC 1WEUA 3OF9A 5AITA 3PNRA 4AVXA 2L80A 2VNFA 1AYWA 3LRQA 2L5UA 2YT5A 2D8SA 3RPGB 1MIRA 3KFQA 4MZSA 4AP4A 2LV9A 1WESA 4UI9B 2YJCA 2OULA 4BPVA 2H0DB 2VPBA 2YW8A 2R6NA 3GV4A 1K3BB 2JMJA 1AU0A 3KWZA 1T1HA 2MNYA 2RSDA 1DEUA 2VFCA 1NL6A 3GCBA 2DZYA 3C5KA 1AYVA 4QRGA 2XU1A 4YADA 2CSZA 5EGWA 2ATOA 3ZTGA 1ZCMA 3GL6A 3KV6A 2ECGA 1Y08A 1CHCA 1GX3A 1PPOA 4MVTA 3MHHA 4HWYA 2KWJA 3VK6A 5TDRA 5LKUA 2VPGA 4WZ2A 1KFXL 1NLJA 3NHEA 3U5NA 2E00A 1WEPA 2JMIA 4L58A 5H9MA 3LQJA 2AIMA 4YYQA 2ECWA 3OVZA 5PADA 3N9QA 2GHUA 1VD4A 5CVNB 2DZZA 2QJ0A 2LGLA 4R2YA 2ECVA 2GFOA 4OEMA 2KGGA 3U8EA 1MM3A 4WA6A 1EWPA 2FSAA 2L43A 1YK8A 2HH5A 2HYED 1GCBA 1ATKA 2HD5A 5JA7A 1QDQA 1CB5A 2L75A 4O64A 4AYCB 3O1GA 2FQ9A 4BQVA 4YYSA 1X9YA 5B77A 2R9CA 2LDRA 3H89A 1GLOA 1BORA 2VJFA 3N9OA 2LGVA 4BS6A 3SOWA 3SHBA 8PCHA 2YREA 2M6MA 2JQFR 5D1KB 1VJVA 1JM7B 1SNKA 2C2LA 1TU6A 2HDPA 4XUIA 4OELA 2DJFB 1W6FA 2ZETC 1AU4A 1NPZA 3HHAA 3N9NA 3P5XA 1ITOA 2HHNA 1WE9A 3N9LA 2G8JA 9PAPA 2VPDA 4A4CA 2E02A 3FL2A 5KH3A 3H8CA 3N3GA 1JQPA 2OP3A 2YQMA 2M1RA 4DMXA 2JRJA 2YJ2A 2QIZA 1MS6A 1PBHA 2AS8A 3F75A 3KV5A 1YVBA 3P5WA 1KHQA 2AU1A 3PURA 2LGKA 1CS8A 3D6SA 1WEOA 1WEQA 3KKUA 1NB3A 4NV7A 3T6RA 2LN0A 4CZWA 2DC8A 2KR4A 4GB0A 5B8DA 2EA6A 2XEUA 3BOWA 3KWBX 3P5VA 1ZBDB 4I7CA 2ECJA 4W5CA 3B79A 4QH6A 1QXPA 4PP2E 1EF7A 2P86A 2B1MA 2MIQA 2DCBA 3NG2A 1WILA 3D9WA 3K24A 3RVWA 1U9QX 4BGFA 4UP5A 3KX1A 3RVXA 1N87A 4GNFA 4YYWA 3RPGC 4CCGX 1G25A 2Y5BA 4PPEA 3IHPA 3IEJA 5D1MB 1YK7A 1MM2A 3HD3A 3BWKA 1BGOA 1VFYA 2I50A 5G05B 5K16A 2E01A 2E6RA 3ASLA 4P5OB 4I07A 3LQHA 4TKPB 4YYRA 1CJLA 4I04A 4C9ZA 2AVWA 4BHWA 4A0CD 2MT5A 1PPNA 3MORA 2BDZA 3QSDA 3O35A 2RI7A 3PW3A 2XB1A 1NB5A 2B1NA 4XI1A 5TABA 1AIMA 3PBHA 2YUCA 3ZPVE 1JOCA 3U5OA 2PBHA 3IUTA 3BCNA 3O70A 2M85A 1HUCB 2AYOA 2BDLA 2VJFB 4CA1A 1ICFA 3IMAA 3HCTA 5TRBA 2ARYA 2JMDA 2YHNA 3KQIA 2DC9A 1WENA 4X6IA 2DX8A 5LKZA 5KH9A 4AXLA 1PPDA 6PADA 2P7UA 4N4FA 1W4TA 3PHDA 1U9WA 2Y6EA 2YJ8A 1X4UA 2LXPC 3U5MA 2DCAA 4AXMA 4CDDB 4A4BA 4R8PK 2HXZA 2AUXA 1TL9A 2LRIC 1QMYA 2FUDA 3T7LA 5LKTA 5FPWA 3MTNA 4N8WA 1DF0A 2NQAA 2LQ6A 1BY8A 4S3OB 4FIPA 3AI8A 4NV8A 2E6SA 2G43A 4YAXA 4CDCB 2CIOA 4XR7A 3S3RA 2G45A 4I7BA 4WZ3B 1EWOA 1AYUA 1F62A 2ACTA 1XWHA 2KE1A 2O6XA 5C11A 2PNSA 2MUMA 1Z6UA 2VFBA 3OF8A 5A24A 2KREA 3BPMA 2C0YA 2K16A 4P6GA 1O0EA 2ECIA 1XKGA 2VPEA 3P5UA 1A6RA 5B76A 1ME4A 4YVAA 3O34A 3HHIA 5B78A 3KW9A 2KFTA 5G04B 2CKLA 3E1ZB 2DCDA 1BP4A 3L1XA 2H0DA 1F2CA 2G6DA 1MEMA 1HYJA 4V3KC 2M3HA 3V6CA 1WFKA 1VYXA 3O33A 5EYAF 5CVOB 4X3GA 3ZUAA 4YC9A 4ZUXU 2VJEA 3ZNIA 1E4UA 3N9MA 2KWKA 4Q8GA 4A49A 2ECTA 2H7JA 1Z60A 3WXEA 4LLBA 1U5IA 2KWOA 3SOXA 4CDEB 3WXFA 2LGGA 1U9VA 2R9FA 2YHOA 5I3LA 4I7DA 1LDJB 1QOLA 1K2FA 5JH3A 3M62A 3N3KA 1F2AA 4RY2A 3S3QA 2QICA 2YU4A 2CSYA 3QZVA 4FJCA 3BPFA 3N4CA 4I05A 2C2VS 2OXQC 2F7DA 3L11A 4DMYA 4UP0A 4ZQLA 4CDFB 2R9OA 1AU3A 2XU3A 4X6HA 2CT2A 4GUZA 2G6QA 4YBSA 1KXRA 1POPA 1FP0A 2ECNA 3HCUA 1E2TA 2F6NA 1FBVA 4GNGA 4AYCA 2NQDB 1GECE 3HWNA 2EGPA 3LXSA 3OVXA 2KU3A 3O36A 1F2BA 1MEGA 4L7XA 5D1LB 1WIMA 3QJ3A 5CHVA 2DC6A 1Z2QA 3PDFA 1KHPA 1BQIA 1JM7A 4ZDTA 4YATA 7PCKA 5F02A 3H7DA 4WZ0A 1RMDA 3PUQA 5J3XA 3I3TA 2BSZA 5TBNA 3I2DA 1GMYA 1U6GB 1HYIA 2YSJA 2VHSA 2G7YA 3ERVA 3HTKC 1W5RA 2AUZA 4PP1A 4LADB 2YSMA 2FUIA 2K17A 3M63A 4N79A 3WXGA 4YYVA 2Y43A 4NN2A 2DC7A 2FT2A 4AUQB 4YABA 3C9EA 5H1UA 4QBBA 1S4VA 3CBKA 5FB0A 4PI3A 4PTBA 3LFYA 2CKLB 3CH3X 4W5BA 1WEMA 2FO5A 4LK9A 3IOQA 4S3OC 1PCIA 2F6JA 2F1GA 4R7EA 2PREA 3L1ZB 1TLOA 2R9MA 4N4ZA 3F5VA 2OZ2A 5J94A 1X4IA 2G8EA 2VJEB 3SOUA 2F42A 1CTEA 4K7CA 5G0FA 4Q8HA 3OISA 2MA6A 4KLBA 3IV2A 4IC2A 2KGIA 3C6WA 5DINA 2PNXA 2YJBA 1WEEA 3RVVA 5H1VA 4PADA 1CV8A 5LCWB 4YBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NAA A;  2Y1M A;  1VSN A;  5C13 A;  1KFU L;  2PUY A;  2FRQ A;  1EWL A;  4GND A;  2AYN A;  1THE A;  2KYU A;  4F52 B;  2MD7 B;  1WEV A;  4G54 A;  3EB5 A;  2FTD A;  5B79 A;  2JQG R;  2K4D A;  4B86 C;  3ZYQ A;  3HCS A;  4MZO A;  5DKA A;  1CSB B;  3U5P A;  2BAY A;  4MSX A;  3RTR B;  5LKX A;  1PXV A;  2CB5 A;  3KSE A;  2IPP B;  1CQD A;  4P6E A;  5H1T A;  2Y1N A;  1PPP A;  5CHT A;  2WBF X;  1ME3 A;  1EWM A;  2IDA A;  3BC3 A;  3K8U A;  4YV8 A;  2KWN A;  5JG6 A;  4N3W A;  1STF E;  2P0R A;  1AEC A;  5FB1 A;  3CBJ A;  4FK5 A;  4QF3 A;  4FO9 A;  2YJ9 A;  4B7Y C;  3O0U A;  2XU5 A;  5TDW A;  5FER A;  1MDW A;  1CPJ A;  2VHF A;  3K9M A;  1MHW A;  1PAD A;  1Y4H A;  2FUU A;  2YYR A;  4YBT A;  2DCC A;  1NQC A;  3ZVZ B;  4IC3 A;  3N9P A;  5B75 A;  2XU4 A;  2L0B A;  3EB6 A;  2IBI A;  3I06 A;  3DQV R;  2E03 A;  4LKA A;  1WEW A;  3ZPV 1;  1SP4 B;  2FYE A;  2YQL A;  4LJN A;  1IWD A;  1YT7 A;  1WGM A;  4YYU A;  2LXH C;  4GNE A;  3V43 A;  2R9N A;  2EOD A;  4BBQ A;  3KNV A;  1FH0 A;  1PIP A;  2NQG A;  2FRA A;  1AU2 A;  3O7A A;  3DF0 A;  3H6S A;  2MA5 A;  2PAD A;  4BS5 A;  3V6E A;  3QT4 A;  1PE6 A;  3ZVY A;  1Q6K A;  5KH7 A;  4QRX A;  3TNX A;  3H8B A;  4X6J A;  5AIU A;  1F29 A;  2DJG B;  5FEY A;  2K1J A;  2KIZ A;  3USV A;  1CVZ A;  2YUR A;  3DPL R;  1YAL A;  1V87 A;  1IYM A;  1ZIV A;  3MHS A;  1U9X A;  2MD8 C;  4QF2 A;  4Q6F A;  1X4J A;  4W4U A;  3CH2 X;  1LDK C;  4QRV A;  2UZG A;  2VP7 A;  3O37 A;  1M6D A;  5CVM A;  4BSQ A;  3LQI A;  2NQI A;  5EF4 A;  2AN6 A;  2MNZ A;  3M99 A;  1DVP A;  4V3L C;  1WEU A;  3OF9 A;  5AIT A;  3PNR A;  4AVX A;  2L80 A;  2VNF A;  1AYW A;  3LRQ A;  2L5U A;  2YT5 A;  2D8S A;  3RPG B;  1MIR A;  3KFQ A;  4MZS A;  4AP4 A;  2LV9 A;  1WES A;  4UI9 B;  2YJC A;  2OUL A;  4BPV A;  2H0D B;  2VPB A;  2YW8 A;  2R6N A;  3GV4 A;  1K3B B;  2JMJ A;  1AU0 A;  3KWZ A;  1T1H A;  2MNY A;  2RSD A;  1DEU A;  3GCB A;  1NL6 A;  2DZY A;  3C5K A;  1AYV A;  4QRG A;  2XU1 A;  4YAD A;  2CSZ A;  5EGW A;  2ATO A;  3ZTG A;  1ZCM A;  3GL6 A;  3KV6 A;  2ECG A;  1Y08 A;  1CHC A;  1PPO A;  4MVT A;  3MHH A;  4HWY A;  2KWJ A;  3VK6 A;  5TDR A;  5LKU A;  2VPG A;  4WZ2 A;  1KFX L;  1NLJ A;  3NHE A;  3U5N A;  2E00 A;  1WEP A;  2JMI A;  4L58 A;  5H9M A;  3LQJ A;  2AIM A;  4YYQ A;  2ECW A;  3OVZ A;  5PAD A;  3N9Q A;  2GHU A;  1VD4 A;  5CVN B;  2DZZ A;  2QJ0 A;  2LGL A;  4R2Y A;  2ECV A;  2GFO A;  4OEM A;  2KGG A;  3U8E A;  1MM3 A;  4WA6 A;  1EWP A;  2FSA A;  2L43 A;  1YK8 A;  2HH5 A;  2HYE D;  1GCB A;  1ATK A;  2HD5 A;  5JA7 A;  1QDQ A;  1CB5 A;  2L75 A;  4O64 A;  4AYC B;  3O1G A;  2FQ9 A;  4BQV A;  4YYS A;  1X9Y A;  5B77 A;  2R9C A;  2LDR A;  3H89 A;  1GLO A;  1BOR A;  2VJF A;  3N9O A;  2LGV A;  4BS6 A;  3SOW A;  3SHB A;  8PCH A;  2YRE A;  2M6M A;  2JQF R;  5D1K B;  1VJV A;  1JM7 B;  1SNK A;  2C2L A;  1TU6 A;  2HDP A;  4XUI A;  4OEL A;  2DJF B;  2ZET C;  1AU4 A;  1NPZ A;  3HHA A;  3N9N A;  3P5X A;  1ITO A;  2HHN A;  1WE9 A;  3N9L A;  2G8J A;  9PAP A;  2VPD A;  4A4C A;  2E02 A;  3FL2 A;  5KH3 A;  3H8C A;  3N3G A;  1JQP A;  2OP3 A;  2YQM A;  2M1R A;  4DMX A;  2JRJ A;  2YJ2 A;  2QIZ A;  1MS6 A;  1PBH A;  2AS8 A;  3F75 A;  3KV5 A;  1YVB A;  3P5W A;  1KHQ A;  2AU1 A;  3PUR A;  2LGK A;  1CS8 A;  3D6S A;  1WEO A;  1WEQ A;  3KKU A;  1NB3 A;  3T6R A;  2LN0 A;  4CZW A;  2DC8 A;  2KR4 A;  4GB0 A;  5B8D A;  2EA6 A;  2XEU A;  3BOW A;  3KWB X;  3P5V A;  1ZBD B;  4I7C A;  2ECJ A;  4W5C A;  3B79 A;  4QH6 A;  1QXP A;  4PP2 E;  1EF7 A;  2P86 A;  2B1M A;  2MIQ A;  2DCB A;  3NG2 A;  1WIL A;  3K24 A;  3RVW A;  1U9Q X;  4UP5 A;  3KX1 A;  3RVX A;  1N87 A;  4GNF A;  4YYW A;  3RPG C;  4CCG X;  1G25 A;  2Y5B A;  4PPE A;  3IHP A;  3IEJ A;  5D1M B;  1YK7 A;  1MM2 A;  3HD3 A;  3BWK A;  1BGO A;  1VFY A;  2I50 A;  5G05 B;  5K16 A;  2E01 A;  2E6R A;  3ASL A;  4P5O B;  4I07 A;  3LQH A;  4TKP B;  4YYR A;  1CJL A;  4I04 A;  4C9Z A;  2AVW A;  4BHW A;  4A0C D;  2MT5 A;  1PPN A;  3MOR A;  2BDZ A;  3QSD A;  3O35 A;  2RI7 A;  3PW3 A;  2XB1 A;  1NB5 A;  2B1N A;  4XI1 A;  5TAB A;  1AIM A;  3PBH A;  2YUC A;  3ZPV E;  1JOC A;  3U5O A;  2PBH A;  3IUT A;  3BCN A;  3O70 A;  2M85 A;  1HUC B;  2AYO A;  2BDL A;  2VJF B;  4CA1 A;  1ICF A;  3IMA A;  3HCT A;  5TRB A;  2ARY A;  2JMD A;  2YHN A;  3KQI A;  2DC9 A;  1WEN A;  4X6I A;  2DX8 A;  5LKZ A;  5KH9 A;  4AXL A;  1PPD A;  6PAD A;  2P7U A;  4N4F A;  3PHD A;  1U9W A;  2Y6E A;  2YJ8 A;  1X4U A;  2LXP C;  3U5M A;  2DCA A;  4AXM A;  4CDD B;  4A4B A;  4R8P K;  2HXZ A;  2AUX A;  1TL9 A;  2LRI C;  1QMY A;  2FUD A;  3T7L A;  5LKT A;  5FPW A;  3MTN A;  4N8W A;  1DF0 A;  2NQA A;  2LQ6 A;  1BY8 A;  4S3O B;  4FIP A;  3AI8 A;  2E6S A;  2G43 A;  4YAX A;  4CDC B;  2CIO A;  4XR7 A;  3S3R A;  2G45 A;  4I7B A;  4WZ3 B;  1EWO A;  1AYU A;  1F62 A;  2ACT A;  1XWH A;  2KE1 A;  2O6X A;  5C11 A;  2PNS A;  2MUM A;  1Z6U A;  3OF8 A;  5A24 A;  2KRE A;  3BPM A;  2C0Y A;  2K16 A;  4P6G A;  1O0E A;  2ECI A;  1XKG A;  2VPE A;  3P5U A;  1A6R A;  5B76 A;  1ME4 A;  4YVA A;  3O34 A;  3HHI A;  5B78 A;  3KW9 A;  2KFT A;  5G04 B;  2CKL A;  3E1Z B;  2DCD A;  1BP4 A;  3L1X A;  2H0D A;  1F2C A;  2G6D A;  1MEM A;  1HYJ A;  4V3K C;  2M3H A;  3V6C A;  1WFK A;  1VYX A;  3O33 A;  5EYA F;  5CVO B;  4X3G A;  3ZUA A;  4YC9 A;  4ZUX U;  2VJE A;  3ZNI A;  1E4U A;  3N9M A;  2KWK A;  4Q8G A;  4A49 A;  2ECT A;  2H7J A;  1Z60 A;  3WXE A;  4LLB A;  1U5I A;  2KWO A;  3SOX A;  4CDE B;  3WXF A;  2LGG A;  1U9V A;  2R9F A;  2YHO A;  5I3L A;  4I7D A;  1LDJ B;  1QOL A;  1K2F A;  5JH3 A;  3M62 A;  3N3K A;  1F2A A;  4RY2 A;  3S3Q A;  2QIC A;  2YU4 A;  2CSY A;  3QZV A;  4FJC A;  3BPF A;  3N4C A;  4I05 A;  2C2V S;  2OXQ C;  2F7D A;  3L11 A;  4DMY A;  4UP0 A;  4ZQL A;  4CDF B;  2R9O A;  1AU3 A;  2XU3 A;  4X6H A;  2CT2 A;  2G6Q A;  4YBS A;  1KXR A;  1POP A;  1FP0 A;  2ECN A;  3HCU A;  2F6N A;  1FBV A;  4GNG A;  4AYC A;  2NQD B;  1GEC E;  3HWN A;  2EGP A;  3LXS A;  3OVX A;  2KU3 A;  3O36 A;  1F2B A;  1MEG A;  4L7X A;  5D1L B;  1WIM A;  3QJ3 A;  5CHV A;  2DC6 A;  1Z2Q A;  3PDF A;  1KHP A;  1BQI A;  1JM7 A;  4ZDT A;  4YAT A;  7PCK A;  5F02 A;  3H7D A;  4WZ0 A;  1RMD A;  3PUQ A;  5J3X A;  3I3T A;  5TBN A;  3I2D A;  1GMY A;  1U6G B;  1HYI A;  2YSJ A;  2VHS A;  2G7Y A;  3ERV A;  3HTK C;  4PP1 A;  2AUZ A;  4LAD B;  2YSM A;  2FUI A;  2K17 A;  3M63 A;  4N79 A;  3WXG A;  4YYV A;  2Y43 A;  4NN2 A;  2DC7 A;  2FT2 A;  4AUQ B;  4YAB A;  3C9E A;  5H1U A;  4QBB A;  1S4V A;  3CBK A;  5FB0 A;  4PI3 A;  4PTB A;  3LFY A;  2CKL B;  3CH3 X;  4W5B A;  1WEM A;  2FO5 A;  4LK9 A;  3IOQ A;  4S3O C;  1PCI A;  2F6J A;  2F1G A;  4R7E A;  2PRE A;  3L1Z B;  1TLO A;  2R9M A;  4N4Z A;  3F5V A;  2OZ2 A;  5J94 A;  1X4I A;  2G8E A;  2VJE B;  3SOU A;  2F42 A;  1CTE A;  4K7C A;  5G0F A;  4Q8H A;  3OIS A;  2MA6 A;  4KLB A;  3IV2 A;  4IC2 A;  2KGI A;  3C6W A;  5DIN A;  2PNX A;  2YJB A;  1WEE A;  3RVV A;  5H1V A;  4PAD A;  1CV8 A;  5LCW B;  4YBM A; 
#chains in the Genus database with same CATH topology
 2NAA A;  2Y1M A;  1VSN A;  5C13 A;  2EGM A;  5SVI B;  1KFU L;  3BY4 A;  2PUY A;  3W30 A;  2FRQ A;  1EWL A;  5EZQ A;  4GND A;  2AYN A;  1THE A;  2KYU A;  4F52 B;  2MD7 B;  1WEV A;  4G54 A;  3EB5 A;  2FTD A;  5B79 A;  2JQG R;  2K4D A;  4B86 C;  3PRM A;  3ZYQ A;  3HCS A;  4OVZ A;  4MZO A;  4XZX A;  5DKA A;  1CSB B;  2JTC A;  3U5P A;  3O65 A;  2BAY A;  4MSX A;  3RTR B;  5LKX A;  1PXV A;  2CB5 A;  3KSE A;  2IPP B;  1CQD A;  4P6E A;  5H1T A;  2Y1N A;  2CSV A;  1PPP A;  1MBM A;  2WBF X;  5CHT A;  1ME3 A;  3TMP A;  1EWM A;  2IDA A;  3BC3 A;  2J7Q A;  3K8U A;  4YV8 A;  2KWN A;  3W31 A;  5JG6 A;  4N3W A;  1STF E;  2P0R A;  1AEC A;  5FB1 A;  3CBJ A;  4FK5 A;  4QF3 A;  4FO9 A;  2YJ9 A;  4B7Y C;  3O0U A;  3PHW A;  2XU5 A;  5TDW A;  5FER A;  1MDW A;  1CPJ A;  2VHF A;  3K9M A;  1MHW A;  1PAD A;  1Y4H A;  2FUU A;  2YYR A;  2E61 A;  4PT5 A;  4YBT A;  2DCC A;  1NQC A;  3ZVZ B;  3PRP A;  2KKY A;  4IC3 A;  4HXD B;  2IQJ A;  3N9P A;  4Z0R A;  4F1P A;  5B75 A;  2XU4 A;  4OW0 A;  2L0B A;  3EB6 A;  2JRI A;  2IBI A;  3I06 A;  4R3D A;  4D8E A;  3DQV R;  2E03 A;  4LKA A;  1WEW A;  3ZPV 1;  4MM3 B;  1SP4 B;  2FYE A;  4D8I A;  2YQL A;  2D8U A;  4LJN A;  2CRW A;  1WGM A;  1IWD A;  2LXH C;  4GNE A;  3JUE A;  3V43 A;  1DKI A;  2R9N A;  2EOD A;  4BBQ A;  3KNV A;  3PSE A;  1FH0 A;  2XOZ A;  1PIP A;  2NQG A;  2FRA A;  1AU2 A;  3O7A A;  3DF0 A;  3H6S A;  2MA5 A;  2PAD A;  2M13 A;  4BS5 A;  3V6E A;  4GUA A;  3QT4 A;  1PE6 A;  3ZVY A;  1Q6K A;  5KH7 A;  4QRX A;  3TNX A;  3H8B A;  4X6J A;  5AIU A;  1F29 A;  2DJG B;  5FEY A;  2K1J A;  1YZB A;  2KIZ A;  3USV A;  4QQ4 A;  1CVZ A;  2YUR A;  3DPL R;  4IUM A;  1YAL A;  1V87 A;  1IYM A;  1ZIV A;  3FEH A;  3MHS A;  1U9X A;  2MD8 C;  3RNV A;  4QF2 A;  4Q6F A;  1X4J A;  4W4U A;  3CH2 X;  1LDK C;  4QRV A;  2UZG A;  2VP7 A;  3O37 A;  1M6D A;  5CVM A;  4BSQ A;  3LQI A;  3IFU A;  2NQI A;  5EF4 A;  2AN6 A;  2MNZ A;  3M99 A;  1DVP A;  4V3L C;  1WEU A;  3OF9 A;  5AIT A;  3PNR A;  4AVX A;  2L80 A;  2VNF A;  1AYW A;  3LRQ A;  2L5U A;  2YT5 A;  2D8S A;  3RPG B;  1MIR A;  3KFQ A;  4MZS A;  4A5U A;  4AP4 A;  3MP2 A;  2LV9 A;  1WES A;  4UI9 B;  2YJC A;  2JUN A;  2OUL A;  4BPV A;  2H0D B;  2VPB A;  2YW8 A;  2R6N A;  3GV4 A;  3BB7 A;  1K3B B;  2JMJ A;  1AU0 A;  3KWZ A;  4P16 A;  1T1H A;  2MNY A;  2RSD A;  1DEU A;  3GCB A;  1NL6 A;  3C0R A;  2DZY A;  3C5K A;  1AYV A;  4QRG A;  1YT7 A;  4RNA A;  2XU1 A;  4YAD A;  2CSZ A;  3DWD A;  5EGW A;  2ATO A;  3ZTG A;  2XP0 A;  1ZCM A;  3GL6 A;  3KV6 A;  2ECG A;  1Y08 A;  1CHC A;  1PPO A;  4MVT A;  3MHH A;  4HWY A;  4RF1 A;  4BOZ A;  2KWJ A;  3VK6 A;  5TDR A;  5LKU A;  2VPG A;  4WZ2 A;  1KFX L;  1NLJ A;  2XOC A;  3MJ5 A;  3NHE A;  3U5N A;  2E00 A;  1WEP A;  2JMI A;  4L58 A;  3LDY A;  2YVR A;  5H9M A;  2EXU A;  3LQJ A;  2AIM A;  4YYQ A;  2ECW A;  3OVZ A;  5PAD A;  3N9Q A;  2GHU A;  4ZTB A;  1VD4 A;  3B21 A;  5CVN B;  2DZZ A;  2QJ0 A;  2LGL A;  4R2Y A;  2ECV A;  2GFO A;  4OEM A;  2KGG A;  3U8E A;  4YYS A;  1MM3 A;  4WA6 A;  1EWP A;  2FSA A;  2L43 A;  1YK8 A;  2HH5 A;  2HYE D;  1GCB A;  1ATK A;  4RF0 A;  2HD5 A;  2DOS A;  5JA7 A;  3MTV A;  1QDQ A;  1CB5 A;  2L75 A;  4O64 A;  4AYC B;  3O1G A;  2FQ9 A;  4BOS A;  4BQV A;  1X9Y A;  5B77 A;  2R9C A;  2LDR A;  3H89 A;  1GLO A;  1BOR A;  2VJF A;  3N9O A;  2LGV A;  4BS6 A;  3SOW A;  3SHB A;  8PCH A;  2YRE A;  2M6M A;  2JQF R;  4MI7 A;  5D1K B;  2MKE A;  1VJV A;  1JM7 B;  1SNK A;  2C2L A;  1TU6 A;  2HDP A;  4XUI A;  4OEL A;  2DJF B;  2ZET C;  1AU4 A;  1NPZ A;  3HHA A;  3N9N A;  3P5X A;  1ITO A;  2HHN A;  1WE9 A;  3N9L A;  4H9D A;  2G8J A;  5K3Q A;  9PAP A;  2VPD A;  4A4C A;  2E02 A;  3FL2 A;  5KH3 A;  3H8C A;  3N3G A;  1JQP A;  2OP3 A;  2YQM A;  2M1R A;  4DMX A;  2JRJ A;  2YJ2 A;  2QIZ A;  1MS6 A;  1PBH A;  2AS8 A;  4REZ A;  3F75 A;  2CON A;  3KV5 A;  1YVB A;  3P5W A;  1KHQ A;  2AU1 A;  3PUR A;  2LGK A;  1CS8 A;  2Z84 A;  3D6S A;  1WEO A;  1WEQ A;  3KKU A;  1NB3 A;  3T6R A;  4BOU A;  2LN0 A;  2RR4 A;  4CZW A;  2DC8 A;  2KR4 A;  4GB0 A;  5B8D A;  2EA6 A;  2XEU A;  3BOW A;  3KWB X;  3P5V A;  3LVR E;  1ZBD B;  4I7C A;  2ECJ A;  4W5C A;  3B79 A;  4QH6 A;  3Q1D A;  2DSM A;  1QXP A;  4PP2 E;  1EF7 A;  4YYU A;  2UZJ A;  3FJU B;  2P86 A;  3MDB C;  2B1M A;  2MIQ A;  2DCB A;  3NG2 A;  3T9K A;  3PLW A;  2BTW B;  1WIL A;  4D8B A;  3K24 A;  4BOP A;  3RVW A;  1U9Q X;  4UP5 A;  3KX1 A;  3BBA A;  3RVX A;  1N87 A;  4GNF A;  4YYW A;  3ZNH A;  3RPG C;  4CCG X;  1G25 A;  2Y5B A;  4PPE A;  3IHP A;  3IEJ A;  2KKX A;  5D1M B;  4IP3 A;  1YK7 A;  1MM2 A;  3HD3 A;  3O47 A;  3BWK A;  1BGO A;  1VFY A;  2I50 A;  5G05 B;  5EZS A;  2E01 A;  5K16 A;  2E6R A;  3ASL A;  4P5O B;  2J7Q C;  3LQH A;  4TKP B;  4I07 A;  4YYR A;  1CJL A;  4I04 A;  4OVZ B;  4C9Z A;  2AVW A;  4BHW A;  4BOQ A;  4A0C D;  2MT5 A;  1PPN A;  3MOR A;  2BDZ A;  3QSD A;  3O35 A;  2RI7 A;  4Z0O A;  3PW3 A;  2FD4 A;  2XB1 A;  3LVQ E;  1NB5 A;  3DDT A;  2B1N A;  4XI1 A;  3H7H A;  5TAB A;  1AIM A;  3PBH A;  2YUC A;  3ZPV E;  1JOC A;  3U5O A;  2PBH A;  3IUT A;  3BCN A;  3O70 A;  2M85 A;  1HUC B;  2AYO A;  2BDL A;  2VJF B;  4CA1 A;  1ICF A;  5SVX A;  3IMA A;  3HCT A;  5TRB A;  2ARY A;  2JMD A;  2YHN A;  3KQI A;  2DC9 A;  1WEN A;  4X6I A;  2DX8 A;  5LKZ A;  3FM8 C;  5KH9 A;  4AXL A;  1PPD A;  6PAD A;  2P7U A;  4N4F A;  5KO3 A;  3PHD A;  3PHX A;  1U9W A;  2Y6E A;  2YJ8 A;  1X4U A;  2LXP C;  3U5M A;  2DCA A;  4AXM A;  4CDD B;  4A4B A;  4R8P K;  1UKF A;  2HXZ A;  2AUX A;  1TL9 A;  2LRI C;  1QMY A;  2FUD A;  3T7L A;  5LKT A;  3M7K A;  5FPW A;  3MTN A;  4N8W A;  1DF0 A;  2NQA A;  2LQ6 A;  1BY8 A;  4S3O B;  4FIP A;  3AI8 A;  1DCQ A;  3TRK A;  3OQC A;  2E6S A;  2G43 A;  4YAX A;  4CDC B;  2CIO A;  4XR7 A;  5JZE A;  3S3R A;  2G45 A;  4I7B A;  4OGE A;  4WZ3 B;  1EWO A;  1AYU A;  1F62 A;  2OWA A;  2ACT A;  1XWH A;  2KE1 A;  2DJA A;  2O6X A;  5C11 A;  2PNS A;  2MUM A;  1Z6U A;  3E9S A;  2JM3 A;  3OF8 A;  5A24 A;  2KRE A;  3BPM A;  2C0Y A;  2K16 A;  4P6G A;  1O0E A;  2ECI A;  1XKG A;  2VPE A;  3P5U A;  1A6R A;  5B76 A;  1ME4 A;  4YVA A;  3O34 A;  3HHI A;  5B78 A;  3KW9 A;  1PVJ A;  2KFT A;  5G04 B;  2CKL A;  3E1Z B;  2DCD A;  1BP4 A;  3L1X A;  2H0D A;  1F2C A;  2G6D A;  1MEM A;  1HYJ A;  3FAO A;  2M3H A;  4V3K C;  3E2D A;  1WFK A;  1VYX A;  3O33 A;  5EYA F;  4OGC A;  4X3G A;  5CVO B;  3V6C A;  3ZUA A;  4YC9 A;  4ZUX U;  2VJE A;  3ZNI A;  1E4U A;  3N9M A;  2KWK A;  4Q8G A;  4A49 A;  2ECT A;  2H7J A;  1Z60 A;  3WXE A;  4LLB A;  1U5I A;  2KWO A;  3SOX A;  4CDE B;  3WXF A;  2LGG A;  1U9V A;  2R9F A;  4WUR A;  2YHO A;  5I3L A;  4I7D A;  1LDJ B;  3FAN A;  5SVI A;  4M0W A;  1QOL A;  1K2F A;  5JH3 A;  3M62 A;  3N3K A;  1F2A A;  4RKX A;  4RY2 A;  3S3Q A;  2QIC A;  2YU4 A;  2CSY A;  2CRR A;  3QZV A;  4FJC A;  3BPF A;  3N4C A;  4I05 A;  2C2V S;  2OXQ C;  2F7D A;  2B0O E;  3L11 A;  4UP0 A;  4ZQL A;  4CDF B;  4DMY A;  2R9O A;  1AU3 A;  2XU3 A;  4X6H A;  2CT2 A;  2G6Q A;  4YBS A;  1KXR A;  1POP A;  1FP0 A;  2ECN A;  3HCU A;  2F6N A;  1FBV A;  4GNG A;  4AYC A;  2NQD B;  2P57 A;  1GEC E;  3HWN A;  3PHU A;  2EGP A;  5E6J A;  2AGA A;  3LXS A;  2LAU A;  3OVX A;  2KU3 A;  3O36 A;  1F2B A;  1MEG A;  4L7X A;  5D1L B;  1WIM A;  3QJ3 A;  5CHV A;  2DC6 A;  1Z2Q A;  2BU3 A;  3PDF A;  1KHP A;  1BQI A;  1JM7 A;  4ZDT A;  4YAT A;  7PCK A;  5F02 A;  3H7D A;  4WZ0 A;  1RMD A;  3PUQ A;  5J3X A;  3I3T A;  3SUB A;  5TBN A;  3I2D A;  1GMY A;  1U6G B;  1HYI A;  2YSJ A;  3KDE C;  2G7Y A;  2VHS A;  3ERV A;  3HTK C;  4PP1 A;  2AUZ A;  4LAD B;  2YSM A;  2FUI A;  2K17 A;  3M63 A;  4N79 A;  3WXG A;  4YYV A;  2Y43 A;  4NN2 A;  3PT2 A;  2DC7 A;  2FT2 A;  2FFW A;  4AUQ B;  4YAB A;  3C9E A;  5H1U A;  4QBB A;  1S4V A;  3CBK A;  5FB0 A;  4PI3 A;  4PTB A;  3LFY A;  2CKL B;  2L7P A;  4O62 A;  3CH3 X;  3LJU X;  1WEM A;  2FO5 A;  4W5B A;  4LK9 A;  3IOQ A;  4S3O C;  1PCI A;  2F6J A;  2F1G A;  4R7E A;  2PRE A;  3L1Z B;  5SVY A;  1TLO A;  2R9M A;  2FE8 A;  4N4Z A;  3F5V A;  2OZ2 A;  5J94 A;  1X4I A;  2G8E A;  2VJE B;  3SOU A;  2F42 A;  1CTE A;  4K7C A;  2XOY A;  5G0F A;  4Q8H A;  3OIS A;  2MA6 A;  4KLB A;  3IV2 A;  4IC2 A;  2KGI A;  3C6W A;  5DIN A;  2PNX A;  2YJB A;  2HWK A;  1WEE A;  3RVV A;  5H1V A;  2BTW A;  4PAD A;  1CV8 A;  5LCW B;  4YBM A; 
#chains in the Genus database with same CATH homology
 2NAA A;  2Y1M A;  1VSN A;  5C13 A;  1KFU L;  2PUY A;  2FRQ A;  1EWL A;  4GND A;  2AYN A;  1THE A;  2KYU A;  4F52 B;  2MD7 B;  1WEV A;  4G54 A;  3EB5 A;  2FTD A;  5B79 A;  2JQG R;  2K4D A;  4B86 C;  3ZYQ A;  3HCS A;  4MZO A;  5DKA A;  1CSB B;  3U5P A;  2BAY A;  4MSX A;  3RTR B;  5LKX A;  1PXV A;  2CB5 A;  3KSE A;  2IPP B;  1CQD A;  4P6E A;  5H1T A;  2Y1N A;  1PPP A;  5CHT A;  2WBF X;  1ME3 A;  1EWM A;  2IDA A;  3BC3 A;  3K8U A;  4YV8 A;  2KWN A;  5JG6 A;  4N3W A;  1STF E;  2P0R A;  1AEC A;  5FB1 A;  3CBJ A;  4FK5 A;  4QF3 A;  4FO9 A;  2YJ9 A;  4B7Y C;  3O0U A;  2XU5 A;  5TDW A;  5FER A;  1MDW A;  1CPJ A;  2VHF A;  3K9M A;  1MHW A;  1PAD A;  1Y4H A;  2FUU A;  2YYR A;  4YBT A;  2DCC A;  1NQC A;  3ZVZ B;  4IC3 A;  3N9P A;  5B75 A;  2XU4 A;  2L0B A;  3EB6 A;  2IBI A;  3I06 A;  3DQV R;  2E03 A;  4LKA A;  1WEW A;  3ZPV 1;  1SP4 B;  2FYE A;  2YQL A;  4LJN A;  1IWD A;  1YT7 A;  1WGM A;  4YYU A;  2LXH C;  4GNE A;  3V43 A;  2R9N A;  2EOD A;  4BBQ A;  3KNV A;  1FH0 A;  1PIP A;  2NQG A;  2FRA A;  1AU2 A;  3O7A A;  3DF0 A;  4B55 A;  3H6S A;  2MA5 A;  2PAD A;  4BS5 A;  3LTW A;  3V6E A;  3QT4 A;  1PE6 A;  3ZVY A;  1Q6K A;  5KH7 A;  4QRX A;  3TNX A;  3H8B A;  4X6J A;  5AIU A;  1F29 A;  4C5P A;  2DJG B;  5FEY A;  2K1J A;  2KIZ A;  3USV A;  1CVZ A;  2YUR A;  3DPL R;  1YAL A;  1V87 A;  1IYM A;  1ZIV A;  3MHS A;  1U9X A;  2MD8 C;  4QF2 A;  4Q6F A;  1X4J A;  4W4U A;  3CH2 X;  1LDK C;  4QRV A;  2UZG A;  2VP7 A;  3O37 A;  1M6D A;  5CVM A;  4BSQ A;  3LQI A;  2NQI A;  5EF4 A;  2AN6 A;  2MNZ A;  3M99 A;  1DVP A;  4V3L C;  1WEU A;  3OF9 A;  5AIT A;  3PNR A;  4AVX A;  2L80 A;  2VNF A;  1AYW A;  3LRQ A;  2L5U A;  2YT5 A;  2D8S A;  3RPG B;  1MIR A;  3KFQ A;  4MZS A;  4AP4 A;  2LV9 A;  1WES A;  4UI9 B;  2YJC A;  2OUL A;  4BPV A;  2H0D B;  2VPB A;  2YW8 A;  2R6N A;  3GV4 A;  1K3B B;  2JMJ A;  1AU0 A;  3KWZ A;  1T1H A;  2MNY A;  2RSD A;  1DEU A;  2VFC A;  1NL6 A;  3GCB A;  2DZY A;  3C5K A;  1AYV A;  4QRG A;  2XU1 A;  4YAD A;  2CSZ A;  5EGW A;  2ATO A;  3ZTG A;  1ZCM A;  3GL6 A;  3KV6 A;  2ECG A;  1Y08 A;  1CHC A;  1GX3 A;  1PPO A;  4MVT A;  3MHH A;  4HWY A;  2KWJ A;  3VK6 A;  5TDR A;  5LKU A;  2VPG A;  4WZ2 A;  1KFX L;  1NLJ A;  3NHE A;  3U5N A;  2E00 A;  1WEP A;  2JMI A;  4L58 A;  5H9M A;  3LQJ A;  2AIM A;  4YYQ A;  2ECW A;  3OVZ A;  5PAD A;  3N9Q A;  2GHU A;  1VD4 A;  5CVN B;  2DZZ A;  2QJ0 A;  2LGL A;  4R2Y A;  2ECV A;  2GFO A;  4OEM A;  2KGG A;  3U8E A;  1MM3 A;  4WA6 A;  1EWP A;  2FSA A;  2L43 A;  1YK8 A;  2HH5 A;  2HYE D;  1GCB A;  1ATK A;  2HD5 A;  5JA7 A;  1QDQ A;  1CB5 A;  2L75 A;  4O64 A;  4AYC B;  3O1G A;  2FQ9 A;  4BQV A;  4YYS A;  1X9Y A;  5B77 A;  2R9C A;  2LDR A;  3H89 A;  1GLO A;  1BOR A;  2VJF A;  3N9O A;  2LGV A;  4BS6 A;  3SOW A;  3SHB A;  8PCH A;  2YRE A;  2M6M A;  2JQF R;  5D1K B;  1VJV A;  1JM7 B;  1SNK A;  2C2L A;  1TU6 A;  2HDP A;  4XUI A;  4OEL A;  2DJF B;  1W6F A;  2ZET C;  1AU4 A;  1NPZ A;  3HHA A;  3N9N A;  3P5X A;  1ITO A;  2HHN A;  1WE9 A;  3N9L A;  2G8J A;  9PAP A;  2VPD A;  4A4C A;  2E02 A;  3FL2 A;  5KH3 A;  3H8C A;  3N3G A;  1JQP A;  2OP3 A;  2YQM A;  2M1R A;  4DMX A;  2JRJ A;  2YJ2 A;  2QIZ A;  1MS6 A;  1PBH A;  2AS8 A;  3F75 A;  3KV5 A;  1YVB A;  3P5W A;  1KHQ A;  2AU1 A;  3PUR A;  2LGK A;  1CS8 A;  3D6S A;  1WEO A;  1WEQ A;  3KKU A;  1NB3 A;  4NV7 A;  3T6R A;  2LN0 A;  4CZW A;  2DC8 A;  2KR4 A;  4GB0 A;  5B8D A;  2EA6 A;  2XEU A;  3BOW A;  3KWB X;  3P5V A;  1ZBD B;  4I7C A;  2ECJ A;  4W5C A;  3B79 A;  4QH6 A;  1QXP A;  4PP2 E;  1EF7 A;  2P86 A;  2B1M A;  2MIQ A;  2DCB A;  3NG2 A;  1WIL A;  3D9W A;  3K24 A;  3RVW A;  1U9Q X;  4BGF A;  4UP5 A;  3KX1 A;  3RVX A;  1N87 A;  4GNF A;  4YYW A;  3RPG C;  4CCG X;  1G25 A;  2Y5B A;  4PPE A;  3IHP A;  3IEJ A;  5D1M B;  1YK7 A;  1MM2 A;  3HD3 A;  3BWK A;  1BGO A;  1VFY A;  2I50 A;  5G05 B;  5K16 A;  2E01 A;  2E6R A;  3ASL A;  4P5O B;  4I07 A;  3LQH A;  4TKP B;  4YYR A;  1CJL A;  4I04 A;  4C9Z A;  2AVW A;  4BHW A;  4A0C D;  2MT5 A;  1PPN A;  3MOR A;  2BDZ A;  3QSD A;  3O35 A;  2RI7 A;  3PW3 A;  2XB1 A;  1NB5 A;  2B1N A;  4XI1 A;  5TAB A;  1AIM A;  3PBH A;  2YUC A;  3ZPV E;  1JOC A;  3U5O A;  2PBH A;  3IUT A;  3BCN A;  3O70 A;  2M85 A;  1HUC B;  2AYO A;  2BDL A;  2VJF B;  4CA1 A;  1ICF A;  3IMA A;  3HCT A;  5TRB A;  2ARY A;  2JMD A;  2YHN A;  3KQI A;  2DC9 A;  1WEN A;  4X6I A;  2DX8 A;  5LKZ A;  5KH9 A;  4AXL A;  1PPD A;  6PAD A;  2P7U A;  4N4F A;  1W4T A;  3PHD A;  1U9W A;  2Y6E A;  2YJ8 A;  1X4U A;  2LXP C;  3U5M A;  2DCA A;  4AXM A;  4CDD B;  4A4B A;  4R8P K;  2HXZ A;  2AUX A;  1TL9 A;  2LRI C;  1QMY A;  2FUD A;  3T7L A;  5LKT A;  5FPW A;  3MTN A;  4N8W A;  1DF0 A;  2NQA A;  2LQ6 A;  1BY8 A;  4S3O B;  4FIP A;  3AI8 A;  4NV8 A;  2E6S A;  2G43 A;  4YAX A;  4CDC B;  2CIO A;  4XR7 A;  3S3R A;  2G45 A;  4I7B A;  4WZ3 B;  1EWO A;  1AYU A;  1F62 A;  2ACT A;  1XWH A;  2KE1 A;  2O6X A;  5C11 A;  2PNS A;  2MUM A;  1Z6U A;  2VFB A;  3OF8 A;  5A24 A;  2KRE A;  3BPM A;  2C0Y A;  2K16 A;  4P6G A;  1O0E A;  2ECI A;  1XKG A;  2VPE A;  3P5U A;  1A6R A;  5B76 A;  1ME4 A;  4YVA A;  3O34 A;  3HHI A;  5B78 A;  3KW9 A;  2KFT A;  5G04 B;  2CKL A;  3E1Z B;  2DCD A;  1BP4 A;  3L1X A;  2H0D A;  1F2C A;  2G6D A;  1MEM A;  1HYJ A;  4V3K C;  2M3H A;  3V6C A;  1WFK A;  1VYX A;  3O33 A;  5EYA F;  5CVO B;  4X3G A;  3ZUA A;  4YC9 A;  4ZUX U;  2VJE A;  3ZNI A;  1E4U A;  3N9M A;  2KWK A;  4Q8G A;  4A49 A;  2ECT A;  2H7J A;  1Z60 A;  3WXE A;  4LLB A;  1U5I A;  2KWO A;  3SOX A;  4CDE B;  3WXF A;  2LGG A;  1U9V A;  2R9F A;  2YHO A;  5I3L A;  4I7D A;  1LDJ B;  1QOL A;  1K2F A;  5JH3 A;  3M62 A;  3N3K A;  1F2A A;  4RY2 A;  3S3Q A;  2QIC A;  2YU4 A;  2CSY A;  3QZV A;  4FJC A;  3BPF A;  3N4C A;  4I05 A;  2C2V S;  2OXQ C;  2F7D A;  3L11 A;  4DMY A;  4UP0 A;  4ZQL A;  4CDF B;  2R9O A;  1AU3 A;  2XU3 A;  4X6H A;  2CT2 A;  4GUZ A;  2G6Q A;  4YBS A;  1KXR A;  1POP A;  1FP0 A;  2ECN A;  3HCU A;  1E2T A;  2F6N A;  1FBV A;  4GNG A;  4AYC A;  2NQD B;  1GEC E;  3HWN A;  2EGP A;  3LXS A;  3OVX A;  2KU3 A;  3O36 A;  1F2B A;  1MEG A;  4L7X A;  5D1L B;  1WIM A;  3QJ3 A;  5CHV A;  2DC6 A;  1Z2Q A;  3PDF A;  1KHP A;  1BQI A;  1JM7 A;  4ZDT A;  4YAT A;  7PCK A;  5F02 A;  3H7D A;  4WZ0 A;  1RMD A;  3PUQ A;  5J3X A;  3I3T A;  2BSZ A;  5TBN A;  3I2D A;  1GMY A;  1U6G B;  1HYI A;  2YSJ A;  2VHS A;  2G7Y A;  3ERV A;  3HTK C;  1W5R A;  2AUZ A;  4PP1 A;  4LAD B;  2YSM A;  2FUI A;  2K17 A;  3M63 A;  4N79 A;  3WXG A;  4YYV A;  2Y43 A;  4NN2 A;  2DC7 A;  2FT2 A;  4AUQ B;  4YAB A;  3C9E A;  5H1U A;  4QBB A;  1S4V A;  3CBK A;  5FB0 A;  4PI3 A;  4PTB A;  3LFY A;  2CKL B;  3CH3 X;  4W5B A;  1WEM A;  2FO5 A;  4LK9 A;  3IOQ A;  4S3O C;  1PCI A;  2F6J A;  2F1G A;  4R7E A;  2PRE A;  3L1Z B;  1TLO A;  2R9M A;  4N4Z A;  3F5V A;  2OZ2 A;  5J94 A;  1X4I A;  2G8E A;  2VJE B;  3SOU A;  2F42 A;  1CTE A;  4K7C A;  5G0F A;  4Q8H A;  3OIS A;  2MA6 A;  4KLB A;  3IV2 A;  4IC2 A;  2KGI A;  3C6W A;  5DIN A;  2PNX A;  2YJB A;  1WEE A;  3RVV A;  5H1V A;  4PAD A;  1CV8 A;  5LCW B;  4YBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...