4W4UA

Structure of yeast saga dubm with sgf73 y57a mutant at 2.8 angstroms resolution
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
471
structure length
438
Chain Sequence
MSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALRQTGFIYLLTCAWKIQDAHEFWQFIINQIHQSYVLDLPNAKEVSRANNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNYHCGECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Uncovering the role of Sgf73 in maintaining SAGA deubiquitinating module structure and activity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase
total genus 135
structure length 438
sequence length 471
chains with identical sequence D
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2014-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4w4uA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4w4uA02
5J94A 2VJFA 5G05B 3V6CA 2XU4A 5FB0A 2YYRA 1A6RA 2R9FA 3K24A 4RY2A 3U5PA 1YT7A 1ME4A 4X6HA 4B86C 5J3XA 5AIUA 2JQGR 5KH9A 1CTEA 2E00A 2G7YA 5EYAF 2G8JA 3GCBA 5C11A 5AITA 5D1LB 5B79A 2DC6A 3HHIA 2VNFA 1JQPA 2Y6EA 4YYVA 2VPEA 5DINA 2ECNA 5KH7A 2PADA 2G6QA 5FEYA 3SOUA 3M62A 2KU3A 1F2AA 4ZUXU 3RVWA 3PW3A 2DCBA 5EGWA 3N9MA 2DX8A 1PPDA 1M6DA 4X6IA 2R9CA 3KNVA 3F5VA 4GNGA 5I3LA 2LN0A 4A49A 4N3WA 2F1GA 2FUDA 5CVNB 3HCTA 3ZNIA 2JMIA 1NL6A 2ATOA 1ZBDB 1WEEA 2DJGB 2DC8A 2LQ6A 2VP7A 1NPZA 1MS6A 4PP1A 2JQFR 3ZVYA 1KXRA 1IYMA 2KGIA 3RPGC 2YSJA 4YYUA 4QBBA 4DMXA 2KGGA 2I50A 3KQIA 4UP0A 1WGMA 2CB5A 1WENA 4K7CA 2ACTA 3KWBX 2JMDA 4A0CD 3ERVA 1MEMA 1LDJB 3KV5A 2XU3A 2EA6A 3L11A 2FT2A 4FK5A 3SHBA 1BGOA 4LK9A 2GHUA 1RMDA 3HD3A 2P7UA 3ZTGA 4KLBA 4G54A 3U5NA 3BPFA 1ME3A 3O0UA 2AUXA 2Y5BA 1NB3A 2JMJA 4N4FA 5D1MB 1MIRA 2E6SA 1PBHA 2XB1A 4QRXA 2MA5A 4I05A 2QICA 1BQIA 4IC3A 3PHDA 3HCSA 1BY8A 4BBQA 4YABA 1HYIA 2NAAA 3H8CA 1V87A 2YU4A 8PCHA 2K4DA 3KV6A 1AU3A 3HCUA 2OULA 3B79A 1Z60A 4QH6A 3LQHA 5FB1A 1CJLA 2E03A 4MSXA 4B7YC 3LFYA 4DMYA 4W4UA 5LKXA 5CHVA 2VPDA 4AXMA 3S3RA 2DC7A 5CHTA 4I7BA 3AI8A 3WXFA 1U6GB 2FO5A 2VPGA 3T6RA 3C6WA 4FIPA 4YATA 1BORA 1WEUA 3RPGB 1NQCA 3V6EA 3H89A 2M6MA 2LGVA 2K16A 1CPJA 5G04B 1X4JA 2PUYA 1TU6A 3HHAA 1FBVA 4X3GA 2FQ9A 2L5UA 1WEPA 2HHNA 1X4UA 1ZCMA 3DF0A 1VD4A 4YBSA 1WEOA 3PNRA 1DF0A 3QZVA 1JOCA 3K8UA 3P5WA 4S3OB 1HUCB 2R9MA 3CBKA 1K2FA 1MDWA 1CHCA 2IPPB 4W5CA 3OVXA 3KW9A 4YYQA 1WIMA 3PURA 4CZWA 5CVMA 3OVZA 1VYXA 4CDDB 4UI9B 5B8DA 2ECWA 4I04A 2NQGA 4YBTA 4PADA 1PCIA 2VJEB 2ECTA 1F29A 2OP3A 1PPOA 2P86A 3P5XA 2VHSA 3QT4A 2BDZA 3L1ZB 3N3KA 1HYJA 3O35A 5DKAA 1S4VA 2Y1NA 2RSDA 5H1UA 3BOWA 2VPBA 4LJNA 4PP2E 4YAXA 3RTRB 3D6SA 4A4CA 1ITOA 3L1XA 1U9QX 2KR4A 2NQIA 2G6DA 3H7DA 3I06A 2D8SA 2G8EA 3PUQA 2UZGA 1YALA 1YK8A 2F7DA 1LDKC 2QJ0A 5B77A 1U9VA 4YYSA 3O70A 2DCCA 2MUMA 2YUCA 4GNFA 1F62A 2VJFB 1EWPA 4X6JA 3N4CA 3LQIA 4V3KC 3SOXA 3KWZA 3IV2A 2KIZA 1AIMA 1U9XA 4P6EA 3M63A 4MZOA 3TNXA 2LGKA 4AP4A 1F2CA 4XUIA 4NN2A 2YJ2A 3BWKA 2KWOA 2OXQC 1GCBA 3T7LA 2FTDA 3U5MA 4AYCA 3ASLA 2MT5A 2HD5A 2KWNA 1XWHA 1KHPA 3QSDA 3C5KA 2VJEA 2AIMA 2M3HA 2YJ9A 2PNXA 3ZPV1 2E02A 3I2DA 5D1KB 2LV9A 2FSAA 2HYED 2KYUA 3BCNA 1GECE 4UP5A 2AS8A 1ATKA 4QF3A 3N3GA 5FERA 4FO9A 2L43A 2ZETC 4IC2A 1CSBB 1QDQA 5PADA 2LGGA 3EB6A 2KE1A 2ECJA 5TBNA 4R8PK 2H7JA 4Q6FA 4GNEA 5TDWA 4C9ZA 4CDEB 3CBJA 1FP0A 4R2YA 2PNSA 4QRGA 3S3QA 2CSYA 2CKLA 2YREA 2EGPA 4PTBA 2E01A 9PAPA 1G25A 3MTNA 3P5UA 3U8EA 1QXPA 3IMAA 2R6NA 3RVVA 2IBIA 1WESA 1WE9A 4YC9A 1IWDA 2HDPA 2CIOA 1Z2QA 3N9LA 1O0EA 2XU5A 3SOWA 2F42A 3HWNA 5F02A 3N9QA 2O6XA 2DCDA 2YQLA 2NQAA 4CDCB 2MD8C 2NQDB 3N9OA 1SNKA 3LXSA 2LDRA 4BS6A 1F2BA 3E1ZB 2YJ8A 3WXGA 4L7XA 2JRJA 5B78A 2AVWA 3F75A 2B1NA 2KREA 2AYOA 4L58A 5FPWA 4W5BA 1ZIVA 4LKAA 2ECGA 2FUIA 4I7DA 1TLOA 2AUZA 2EODA 1PADA 3H6SA 2PREA 1CB5A 4OELA 2ARYA 2HH5A 1X9YA 3CH3X 4YVAA 1ICFA 2CKLB 5EF4A 5LKTA 2ECIA 1MHWA 1WEMA 2KWKA 1Z6UA 2MNYA 2KFTA 2RI7A 2YURA 5TDRA 5JG6A 1Y08A 1EWOA 5JA7A 3M99A 1THEA 3LRQA 2M1RA 1WEVA 2C2VS 2L0BA 1YK7A 7PCKA 4YYWA 3HTKC 3MORA 2QIZA 4I7CA 5B75A 1KFXL 5JH3A 2R9OA 4F52B 3O33A 1Q6KA 2FYEA 5TABA 1Y4HA 5G0FA 4BQVA 2MNZA 1EF7A 2FRQA 1BP4A 1NLJA 1STFE 2G45A 2CT2A 2ECVA 4N8WA 2M85A 2G43A 4QRVA 1WILA 4A4BA 4TKPB 2R9NA 1YVBA 3I3TA 4GNDA 4YV8A 1CV8A 5H1TA 4MVTA 5TRBA 2MA6A 2Y1MA 2F6NA 2LXHC 2L75A 2F6JA 4O64A 4WZ0A 4WZ2A 2VHFA 3O1GA 4PI3A 4V3LC 3K9MA 3IHPA 1FH0A 3KSEA 4P6GA 4BPVA 1X4IA 2FRAA 1MM2A 3DQVR 1PPNA 4N4ZA 3GL6A 1EWLA 1MEGA 1E4UA 4S3OC 3GV4A 3PDFA 4PPEA 2YHNA 2DZYA 1T1HA 3BC3A 3NG2A 2MIQA 3IOQA 1CS8A 2GFOA 4FJCA 3H8BA 5KH3A 1AU2A 1CQDA 1AYWA 3NHEA 2DCAA 4CCGX 2OZ2A 1WEQA 2B1MA 1AU0A 1EWMA 4MZSA 3IEJA 4Q8GA 2H0DB 3QJ3A 2LRIC 4GB0A 2LGLA 4HWYA 2IDAA 3V43A 3P5VA 4QF2A 2BDLA 5CVOB 1GLOA 1XKGA 2YQMA 2DC9A 1VSNA 4R7EA 5H9MA 5B76A 4BSQA 3KKUA 1PIPA 3VK6A 2YSMA 3OF9A 1SP4B 2AU1A 3ZYQA 3PBHA 1MM3A 4ZQLA 5K16A 2KWJA 1AECA 1TL9A 1KFUL 5H1VA 3OF8A 3RVXA 4LADB 3N9NA 4YYRA 2YJCA 3C9EA 1GMYA 1WEWA 1CVZA 2K17A 2H0DA 3FL2A 4BS5A 5LKUA 6PADA 2DZZA 3ZUAA 2CSZA 4AVXA 1AU4A 3O37A 1QOLA 1K3BB 3KFQA 3N9PA 1DVPA 4AYCB 1PXVA 3O36A 2YJBA 2BAYA 5LKZA 1AYUA 2AYNA 4Q8HA 3MHSA 4BHWA 3O7AA 3U5OA 1U5IA 2XU1A 3ZVZB 3DPLR 1JM7A 2E6RA 4ZDTA 3USVA 4CA1A 2YT5A 2MD7B 4P5OB 2FUUA 2YHOA 3EB5A 2Y43A 1WFKA 3ZPVE 1N87A 4WA6A 2LXPC 2C0YA 4YBMA 1KHQA 1AYVA 2AN6A 4YADA 2L80A 4AUQB 4XR7A 1VFYA 4I07A 1VJVA 1JM7B 1POPA 4N79A 4AXLA 4LLBA 3KX1A 2WBFX 4XI1A 1PPPA 2HXZA 4CDFB 1DEUA 5C13A 1U9WA 1QMYA 2YW8A 2C2LA 2DJFB 2P0RA 2K1JA 2XEUA 3CH2X 3O34A 5A24A 3OISA 3WXEA 3IUTA 5LCWB 4WZ3B 3MHHA 4OEMA 2PBHA 3BPMA 1NB5A 1PE6A 3LQJA
chains in the Genus database with same CATH superfamily
5J94A 3DWDA 2VJFA 2L7PA 5G05B 4BOQA 3FAOA 4REZA 3V6CA 2XU4A 5FB0A 2YYRA 1A6RA 2R9FA 3K24A 4RY2A 3U5PA 1YT7A 1ME4A 4X6HA 4B86C 3O65A 5J3XA 5AIUA 1UKFA 2JQGR 5KH9A 1CTEA 2E00A 2G7YA 5EYAF 2G8JA 3BY4A 3GCBA 5C11A 5AITA 5D1LB 5B79A 2DC6A 3HHIA 2VNFA 1JQPA 2Y6EA 4YYVA 2VPEA 5DINA 2ECNA 5KH7A 2PADA 2G6QA 5FEYA 3SOUA 3M62A 4M0WA 2KU3A 1F2AA 4ZUXU 3RVWA 3PW3A 2DCBA 5EGWA 3N9MA 2DX8A 1PPDA 1M6DA 4X6IA 2R9CA 3KNVA 3F5VA 3W31A 4GNGA 5I3LA 2LN0A 4A49A 4N3WA 2F1GA 2FUDA 5CVNB 3W30A 3HCTA 3ZNIA 2JMIA 3T9KA 1NL6A 1ZBDB 1WEEA 2ATOA 2DJGB 2DC8A 2LQ6A 3PT2A 2VP7A 1NPZA 1MS6A 4PP1A 2XP0A 2JQFR 3ZVYA 1KXRA 1IYMA 2KGIA 3RPGC 2YSJA 4YYUA 4QBBA 5KO3A 4DMXA 2KGGA 2I50A 3KQIA 4UP0A 1WGMA 2CB5A 1WENA 4K7CA 5EZSA 2ACTA 3KWBX 2JMDA 4A0CD 3ERVA 3PHUA 1MEMA 1LDJB 3KV5A 2XU3A 2EA6A 3BBAA 3L11A 2FT2A 4FK5A 3SHBA 1BGOA 4LK9A 2GHUA 1RMDA 2CRRA 2JTCA 3HD3A 2P7UA 3ZTGA 4KLBA 4G54A 3U5NA 3BPFA 1ME3A 3O0UA 1PVJA 2AUXA 2Y5BA 1NB3A 4OW0A 2JMJA 3JUEA 4N4FA 5D1MB 1MIRA 2E6SA 1PBHA 2XB1A 2JRIA 4QRXA 5E6JA 2EXUA 3RNVA 2MA5A 4I05A 2QICA 1BQIA 4IC3A 4A5UA 3PHDA 3HCSA 1BY8A 4BBQA 4YABA 1HYIA 2NAAA 3H8CA 1V87A 2YU4A 8PCHA 3FM8C 2K4DA 3KV6A 1AU3A 3HCUA 2OULA 3B79A 1Z60A 4QH6A 3ZNHA 3LQHA 5FB1A 1CJLA 3FANA 4MSXA 2E03A 4B7YC 3LFYA 4DMYA 4W4UA 4OVZA 5LKXA 2BTWA 3LJUX 5CHVA 2P57A 2VPDA 4AXMA 3S3RA 2DC7A 5CHTA 4I7BA 3AI8A 3WXFA 1U6GB 2FO5A 2UZJA 2VPGA 2E61A 3T6RA 3C6WA 4FIPA 4YATA 1BORA 1WEUA 3RPGB 1DKIA 1NQCA 3V6EA 3H89A 2M6MA 2LGVA 2K16A 2LAUA 1CPJA 5G04B 1X4JA 2PUYA 1TU6A 3HHAA 1FBVA 4X3GA 2FQ9A 2L5UA 1WEPA 2HHNA 1X4UA 1ZCMA 3DF0A 1VD4A 4YBSA 1WEOA 3PHWA 3PNRA 1DF0A 3QZVA 1JOCA 4BOZA 3K8UA 3P5WA 4S3OB 1HUCB 2R9MA 4GUAA 3CBKA 1K2FA 1MDWA 1CHCA 2IPPB 4W5CA 3OVXA 3KW9A 4YYQA 1WIMA 3PURA 3E2DA 5CVMA 3OVZA 4CZWA 1VYXA 4CDDB 4UI9B 5B8DA 2ECWA 4I04A 3PSEA 2CONA 2NQGA 4YBTA 4PADA 1PCIA 2BTWB 2VJEB 2ECTA 1F29A 2OP3A 1PPOA 2P86A 3P5XA 2VHSA 2Z84A 3QT4A 2BDZA 3L1ZB 3N3KA 1HYJA 3O35A 5DKAA 1S4VA 2Y1NA 2RSDA 5K3QA 3MP2A 5H1UA 3BOWA 2VPBA 4LJNA 4PP2E 4YAXA 3RTRB 3D6SA 4A4CA 1ITOA 2DSMA 3L1XA 1U9QX 2KR4A 2NQIA 2G6DA 3H7DA 3I06A 2D8SA 2KKYA 2G8EA 4MI7A 4HXDB 3PUQA 2UZGA 1YALA 1DCQA 1YK8A 2F7DA 1LDKC 2QJ0A 4RKXA 3PLWA 5B77A 1U9VA 3O70A 2DCCA 4YYSA 2MUMA 2YUCA 4GNFA 1F62A 2VJFB 1EWPA 1YZBA 4X6JA 3N4CA 3LQIA 4V3KC 3SOXA 3KWZA 4RF0A 3IV2A 2KIZA 1AIMA 1U9XA 4P6EA 3M63A 4MZOA 3TNXA 2LGKA 5SVXA 4AP4A 1F2CA 4XUIA 4NN2A 2YJ2A 3BWKA 2KWOA 2OXQC 1GCBA 3T7LA 2FTDA 3U5MA 4AYCA 3ASLA 2MT5A 2HD5A 2KWNA 1XWHA 1KHPA 3QSDA 3C5KA 2VJEA 2AIMA 2M3HA 2YJ9A 2PNXA 3ZPV1 2E02A 3I2DA 5D1KB 2LV9A 2FSAA 2HYED 2KYUA 3BCNA 1GECE 3MJ5A 4UP5A 2AS8A 2CSVA 4QF3A 1ATKA 3N3GA 5FERA 4FO9A 2L43A 2ZETC 4PT5A 4IC2A 1CSBB 1QDQA 5PADA 2LGGA 4F1PA 3TMPA 4R3DA 3EB6A 2KE1A 2ECJA 5TBNA 4R8PK 2H7JA 4D8BA 4Q6FA 2FD4A 4GNEA 5TDWA 4C9ZA 4CDEB 1MBMA 3CBJA 1FP0A 4R2YA 2PNSA 4QRGA 3S3QA 2XOYA 2CSYA 2CKLA 2DJAA 2EGPA 2YREA 3B21A 4PTBA 2E01A 3Q1DA 9PAPA 1G25A 4H9DA 3MTNA 3P5UA 3U8EA 1QXPA 2IQJA 3KDEC 2HWKA 2B0OE 3IMAA 2R6NA 3RVVA 2IBIA 1WESA 1WE9A 4YC9A 1IWDA 2HDPA 2CIOA 1Z2QA 3N9LA 1O0EA 2XU5A 3SOWA 2F42A 3HWNA 4P16A 5F02A 4O62A 3N9QA 2O6XA 2DCDA 4XZXA 2YQLA 2NQAA 4CDCB 2MD8C 2NQDB 3N9OA 1SNKA 3LXSA 2LDRA 4BS6A 1F2BA 3E1ZB 2YJ8A 3WXGA 4L7XA 2JRJA 5B78A 2AVWA 2XOZA 2YVRA 3F75A 2B1NA 4D8EA 2KREA 2AYOA 4L58A 5FPWA 4W5BA 1ZIVA 4LKAA 2ECGA 2FUIA 4I7DA 1TLOA 4IUMA 2AUZA 2EODA 3LDYA 1PADA 2PREA 3H6SA 1CB5A 4OELA 2ARYA 2HH5A 1X9YA 3CH3X 4ZTBA 1ICFA 2CKLB 4BOUA 5EF4A 4YVAA 5LKTA 2ECIA 1MHWA 1WEMA 2M13A 2KWKA 3FEHA 3C0RA 1Z6UA 2MNYA 5EZQA 3M7KA 2KFTA 2RI7A 2YURA 5TDRA 5JG6A 1Y08A 1EWOA 5JA7A 2D8UA 3M99A 3LVRE 3LRQA 1THEA 2M1RA 3TRKA 1WEVA 2C2VS 2L0BA 1YK7A 7PCKA 4YYWA 3HTKC 3MORA 2QIZA 4I7CA 4Z0OA 5B75A 2J7QC 1KFXL 5JH3A 2R9OA 4F52B 3OQCA 3O33A 2JUNA 1Q6KA 2FYEA 5TABA 1Y4HA 2JM3A 5G0FA 4BQVA 2MNZA 1EF7A 4D8IA 4QQ4A 2FRQA 1BP4A 1NLJA 1STFE 2G45A 2CT2A 2ECVA 4N8WA 2M85A 2G43A 4QRVA 3PRPA 1WILA 4OGEA 4A4BA 4TKPB 2R9NA 1YVBA 3I3TA 4GNDA 4YV8A 3E9SA 1CV8A 5H1TA 4MVTA 5TRBA 2MA6A 2Y1MA 2F6NA 2LXHC 2L75A 5SVIA 2F6JA 4O64A 4WZ0A 4WZ2A 2VHFA 3O1GA 4MM3B 4PI3A 4V3LC 3K9MA 3IHPA 1FH0A 3O47A 3KSEA 4P6GA 1X4IA 2KKXA 4BPVA 2FRAA 1MM2A 3LVQE 3DQVR 1PPNA 4N4ZA 3GL6A 1EWLA 1MEGA 1E4UA 4S3OC 3GV4A 3PDFA 4OVZB 4PPEA 2YHNA 2DZYA 1T1HA 4RNAA 3BC3A 3NG2A 4IP3A 2MIQA 3IOQA 1CS8A 2GFOA 4FJCA 3H8BA 5KH3A 4BOPA 3IFUA 1AU2A 1CQDA 5SVYA 1AYWA 3SUBA 2DCAA 4CCGX 2OZ2A 3H7HA 3NHEA 1WEQA 2B1MA 3PRMA 1AU0A 1EWMA 4MZSA 3IEJA 4Q8GA 2H0DB 3QJ3A 2LRIC 4GB0A 2LGLA 4HWYA 2IDAA 3MTVA 4RF1A 3V43A 3P5VA 4QF2A 2BDLA 5CVOB 1GLOA 1XKGA 2YQMA 2RR4A 2AGAA 2DC9A 1VSNA 2FE8A 4R7EA 3DDTA 5H9MA 5B76A 4BSQA 3KKUA 1PIPA 3VK6A 2YSMA 3OF9A 1SP4B 2AU1A 3ZYQA 3PBHA 1MM3A 4ZQLA 5K16A 5SVIB 2KWJA 1AECA 1TL9A 1KFUL 5H1VA 3OF8A 3RVXA 4LADB 2FFWA 3N9NA 4YYRA 2YJCA 3C9EA 1GMYA 3MDBC 1WEWA 1CVZA 2K17A 2H0DA 3FL2A 4BS5A 5LKUA 6PADA 2DZZA 3ZUAA 2CSZA 4AVXA 1AU4A 3O37A 1QOLA 1K3BB 3KFQA 3N9PA 4OGCA 1DVPA 4AYCB 3PHXA 2MKEA 1PXVA 2J7QA 3O36A 2YJBA 2BAYA 5LKZA 1AYUA 5JZEA 2AYNA 4Q8HA 3MHSA 4BHWA 2CRWA 3O7AA 3U5OA 1U5IA 2XU1A 3ZVZB 3DPLR 1JM7A 2E6RA 4ZDTA 3USVA 4CA1A 2XOCA 3FJUB 2YT5A 2MD7B 4P5OB 2FUUA 2YHOA 3EB5A 2Y43A 1WFKA 3ZPVE 1N87A 4WA6A 4Z0RA 2LXPC 2C0YA 4YBMA 1KHQA 1AYVA 2EGMA 4YADA 2AN6A 2L80A 4AUQB 4XR7A 1VFYA 4I07A 1VJVA 1JM7B 1POPA 4N79A 4AXLA 4LLBA 4WURA 3KX1A 2WBFX 4XI1A 1PPPA 2HXZA 4CDFB 1DEUA 5C13A 2BU3A 1U9WA 1QMYA 2YW8A 2C2LA 2DJFB 2P0RA 2K1JA 2XEUA 3CH2X 3O34A 3BB7A 5A24A 3OISA 3WXEA 3IUTA 5LCWB 2OWAA 4WZ3B 3MHHA 4OEMA 2DOSA 2PBHA 3BPMA 1NB5A 1PE6A 3LQJA 4BOSA
chains in the Genus database with same CATH topology
5J94A 2VJFA 5G05B 3V6CA 2XU4A 5FB0A 2YYRA 1A6RA 2R9FA 3K24A 4RY2A 3U5PA 1YT7A 1ME4A 4X6HA 4B86C 5J3XA 5AIUA 2JQGR 5KH9A 1CTEA 2E00A 2G7YA 5EYAF 2G8JA 3GCBA 5C11A 5AITA 5D1LB 5B79A 2DC6A 3HHIA 2VNFA 1JQPA 2Y6EA 4YYVA 2VPEA 5DINA 2ECNA 5KH7A 2PADA 2G6QA 5FEYA 3SOUA 3M62A 2KU3A 1F2AA 4ZUXU 3RVWA 3PW3A 2DCBA 5EGWA 3N9MA 2DX8A 1PPDA 1M6DA 4X6IA 2R9CA 3KNVA 3F5VA 4GNGA 5I3LA 2LN0A 4A49A 4N3WA 2F1GA 2FUDA 5CVNB 3HCTA 3ZNIA 2JMIA 1NL6A 2ATOA 1ZBDB 1WEEA 2DJGB 2DC8A 2LQ6A 2VP7A 1NPZA 1MS6A 4PP1A 2JQFR 1E2TA 3ZVYA 1KXRA 1IYMA 2KGIA 3RPGC 2YSJA 4YYUA 4QBBA 4DMXA 2KGGA 2I50A 3KQIA 4UP0A 1WGMA 2CB5A 1WENA 4K7CA 2ACTA 3KWBX 2JMDA 4A0CD 3ERVA 1MEMA 1LDJB 3KV5A 2XU3A 2EA6A 3L11A 2FT2A 4FK5A 3SHBA 1BGOA 4LK9A 2GHUA 1RMDA 3HD3A 2P7UA 3ZTGA 4KLBA 4G54A 3U5NA 3BPFA 2BSZA 1ME3A 3O0UA 2AUXA 2Y5BA 1NB3A 2JMJA 4N4FA 5D1MB 1MIRA 2E6SA 1PBHA 2XB1A 4QRXA 1W4TA 2MA5A 4I05A 2QICA 1BQIA 4IC3A 3PHDA 3HCSA 1BY8A 4BBQA 1W6FA 4YABA 1HYIA 2NAAA 3H8CA 1V87A 2YU4A 8PCHA 2K4DA 3KV6A 1AU3A 3HCUA 2OULA 3B79A 1Z60A 4QH6A 3LQHA 5FB1A 1CJLA 2E03A 4MSXA 4B7YC 3LFYA 4DMYA 4W4UA 5LKXA 5CHVA 1GX3A 2VPDA 4AXMA 3S3RA 2DC7A 5CHTA 4I7BA 3AI8A 3WXFA 1U6GB 2FO5A 2VPGA 3T6RA 3C6WA 4FIPA 4YATA 1BORA 1WEUA 3RPGB 1NQCA 3V6EA 3H89A 2M6MA 2LGVA 2K16A 1CPJA 5G04B 1X4JA 2PUYA 1TU6A 3HHAA 1FBVA 4X3GA 2FQ9A 2L5UA 1WEPA 2HHNA 1X4UA 1ZCMA 3DF0A 1VD4A 4YBSA 1WEOA 3PNRA 1DF0A 3QZVA 4NV7A 1JOCA 3K8UA 3P5WA 4S3OB 1HUCB 2R9MA 3CBKA 1K2FA 1MDWA 3D9WA 1CHCA 2IPPB 1W5RA 4W5CA 3OVXA 3KW9A 4YYQA 1WIMA 3PURA 4CZWA 5CVMA 3OVZA 1VYXA 4CDDB 4UI9B 5B8DA 2ECWA 4I04A 2NQGA 4YBTA 4PADA 1PCIA 2VJEB 2ECTA 1F29A 2OP3A 1PPOA 2P86A 3P5XA 2VHSA 3QT4A 2BDZA 3L1ZB 3N3KA 1HYJA 3O35A 5DKAA 1S4VA 2Y1NA 2RSDA 5H1UA 3BOWA 2VPBA 4LJNA 4PP2E 4YAXA 3RTRB 3D6SA 4A4CA 1ITOA 3L1XA 1U9QX 2KR4A 2NQIA 2G6DA 3H7DA 3I06A 2D8SA 2G8EA 3PUQA 2UZGA 1YALA 1YK8A 2F7DA 1LDKC 2QJ0A 5B77A 1U9VA 4YYSA 3O70A 2DCCA 2MUMA 2YUCA 4GNFA 1F62A 2VJFB 1EWPA 4GUZA 4X6JA 3N4CA 3LQIA 4V3KC 3SOXA 3KWZA 3IV2A 2KIZA 1AIMA 1U9XA 4P6EA 3M63A 4MZOA 3TNXA 2LGKA 4NV8A 4AP4A 1F2CA 4XUIA 4NN2A 2YJ2A 3BWKA 2KWOA 2OXQC 1GCBA 3T7LA 2FTDA 3U5MA 4AYCA 3ASLA 2MT5A 2HD5A 2KWNA 1XWHA 1KHPA 3QSDA 3C5KA 2VJEA 2AIMA 2M3HA 2YJ9A 2PNXA 3ZPV1 2E02A 3I2DA 5D1KB 2LV9A 2FSAA 2HYED 2KYUA 3BCNA 1GECE 4UP5A 2AS8A 1ATKA 4QF3A 3N3GA 5FERA 4FO9A 2L43A 2ZETC 4IC2A 1CSBB 1QDQA 5PADA 2LGGA 3EB6A 2KE1A 2ECJA 5TBNA 4R8PK 2H7JA 4Q6FA 4GNEA 5TDWA 4C9ZA 4CDEB 3CBJA 1FP0A 4R2YA 2PNSA 4QRGA 3S3QA 2CSYA 2CKLA 2YREA 2EGPA 4PTBA 2E01A 9PAPA 1G25A 3MTNA 3P5UA 3U8EA 2VFBA 1QXPA 3IMAA 2R6NA 3RVVA 2VFCA 2IBIA 1WESA 1WE9A 4YC9A 1IWDA 2HDPA 2CIOA 1Z2QA 3N9LA 1O0EA 2XU5A 3SOWA 2F42A 3HWNA 5F02A 3N9QA 2O6XA 2DCDA 2YQLA 2NQAA 4CDCB 2MD8C 2NQDB 3N9OA 4C5PA 1SNKA 3LXSA 2LDRA 4BS6A 1F2BA 3E1ZB 2YJ8A 3WXGA 4L7XA 2JRJA 5B78A 2AVWA 3F75A 2B1NA 2KREA 2AYOA 4L58A 5FPWA 4W5BA 1ZIVA 4LKAA 2ECGA 2FUIA 4I7DA 1TLOA 2AUZA 2EODA 1PADA 3H6SA 2PREA 1CB5A 4OELA 2ARYA 2HH5A 1X9YA 3CH3X 4YVAA 1ICFA 2CKLB 5EF4A 5LKTA 2ECIA 1MHWA 1WEMA 2KWKA 1Z6UA 2MNYA 2KFTA 2RI7A 2YURA 5TDRA 5JG6A 1Y08A 1EWOA 5JA7A 3M99A 1THEA 3LRQA 2M1RA 1WEVA 2C2VS 2L0BA 1YK7A 7PCKA 4YYWA 3HTKC 3MORA 2QIZA 4I7CA 5B75A 1KFXL 5JH3A 2R9OA 4F52B 3O33A 1Q6KA 2FYEA 5TABA 1Y4HA 5G0FA 4BQVA 2MNZA 1EF7A 2FRQA 1BP4A 1NLJA 1STFE 2G45A 2CT2A 2ECVA 4N8WA 2M85A 2G43A 4QRVA 1WILA 4A4BA 4TKPB 2R9NA 1YVBA 3I3TA 4GNDA 4YV8A 1CV8A 5H1TA 4MVTA 5TRBA 2MA6A 2Y1MA 4B55A 2F6NA 2LXHC 2L75A 2F6JA 4O64A 4WZ0A 4WZ2A 2VHFA 3O1GA 4PI3A 4V3LC 3K9MA 3IHPA 1FH0A 3KSEA 4P6GA 4BPVA 1X4IA 2FRAA 1MM2A 3DQVR 1PPNA 4N4ZA 3GL6A 1EWLA 1MEGA 1E4UA 4S3OC 3GV4A 3PDFA 4PPEA 2YHNA 2DZYA 1T1HA 3BC3A 3NG2A 2MIQA 3IOQA 1CS8A 2GFOA 4FJCA 3H8BA 5KH3A 1AU2A 1CQDA 1AYWA 3NHEA 2DCAA 4CCGX 2OZ2A 1WEQA 2B1MA 1AU0A 1EWMA 4MZSA 3IEJA 4Q8GA 2H0DB 3QJ3A 2LRIC 4GB0A 2LGLA 4HWYA 2IDAA 3V43A 3P5VA 4QF2A 2BDLA 5CVOB 1GLOA 1XKGA 2YQMA 2DC9A 1VSNA 4R7EA 5H9MA 5B76A 4BSQA 3KKUA 1PIPA 3VK6A 2YSMA 3OF9A 1SP4B 2AU1A 3ZYQA 3PBHA 1MM3A 4ZQLA 5K16A 2KWJA 1AECA 1TL9A 1KFUL 5H1VA 3OF8A 3RVXA 4LADB 3N9NA 4YYRA 2YJCA 3C9EA 1GMYA 1WEWA 1CVZA 2K17A 2H0DA 3FL2A 4BS5A 5LKUA 6PADA 2DZZA 3ZUAA 2CSZA 4AVXA 1AU4A 3O37A 1QOLA 1K3BB 3KFQA 3N9PA 1DVPA 4AYCB 1PXVA 3O36A 2YJBA 2BAYA 5LKZA 1AYUA 2AYNA 4Q8HA 3MHSA 4BHWA 3O7AA 3U5OA 1U5IA 2XU1A 3ZVZB 4BGFA 3DPLR 1JM7A 2E6RA 4ZDTA 3USVA 4CA1A 2YT5A 2MD7B 4P5OB 2FUUA 2YHOA 3EB5A 2Y43A 1WFKA 3ZPVE 1N87A 4WA6A 2LXPC 2C0YA 4YBMA 1KHQA 1AYVA 2AN6A 4YADA 2L80A 4AUQB 4XR7A 1VFYA 4I07A 1VJVA 1JM7B 1POPA 4N79A 4AXLA 4LLBA 3KX1A 2WBFX 4XI1A 1PPPA 2HXZA 4CDFB 1DEUA 5C13A 1U9WA 1QMYA 2YW8A 2C2LA 2DJFB 2P0RA 2K1JA 2XEUA 3CH2X 3O34A 3LTWA 5A24A 3OISA 3WXEA 3IUTA 5LCWB 4WZ3B 3MHHA 4OEMA 2PBHA 3BPMA 1NB5A 1PE6A 3LQJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J94 A;  2VJF A;  5G05 B;  3V6C A;  2XU4 A;  5FB0 A;  2YYR A;  1A6R A;  2R9F A;  3K24 A;  4RY2 A;  3U5P A;  1YT7 A;  1ME4 A;  4X6H A;  4B86 C;  5J3X A;  5AIU A;  2JQG R;  5KH9 A;  1CTE A;  2E00 A;  2G7Y A;  5EYA F;  2G8J A;  3GCB A;  5C11 A;  5AIT A;  5D1L B;  5B79 A;  2DC6 A;  3HHI A;  2VNF A;  1JQP A;  2Y6E A;  4YYV A;  2VPE A;  5DIN A;  2ECN A;  5KH7 A;  2PAD A;  2G6Q A;  5FEY A;  3SOU A;  3M62 A;  2KU3 A;  1F2A A;  4ZUX U;  3RVW A;  3PW3 A;  2DCB A;  5EGW A;  3N9M A;  2DX8 A;  1PPD A;  1M6D A;  4X6I A;  2R9C A;  3KNV A;  3F5V A;  4GNG A;  5I3L A;  2LN0 A;  4A49 A;  4N3W A;  2F1G A;  2FUD A;  5CVN B;  3HCT A;  3ZNI A;  2JMI A;  1NL6 A;  2ATO A;  1ZBD B;  1WEE A;  2DJG B;  2DC8 A;  2LQ6 A;  2VP7 A;  1NPZ A;  1MS6 A;  4PP1 A;  2JQF R;  3ZVY A;  1KXR A;  1IYM A;  2KGI A;  3RPG C;  2YSJ A;  4YYU A;  4QBB A;  4DMX A;  2KGG A;  2I50 A;  3KQI A;  4UP0 A;  1WGM A;  2CB5 A;  1WEN A;  4K7C A;  2ACT A;  3KWB X;  2JMD A;  4A0C D;  3ERV A;  1MEM A;  1LDJ B;  3KV5 A;  2XU3 A;  2EA6 A;  3L11 A;  2FT2 A;  4FK5 A;  3SHB A;  1BGO A;  4LK9 A;  2GHU A;  1RMD A;  3HD3 A;  2P7U A;  3ZTG A;  4KLB A;  4G54 A;  3U5N A;  3BPF A;  1ME3 A;  3O0U A;  2AUX A;  2Y5B A;  1NB3 A;  2JMJ A;  4N4F A;  5D1M B;  1MIR A;  2E6S A;  1PBH A;  2XB1 A;  4QRX A;  2MA5 A;  4I05 A;  2QIC A;  1BQI A;  4IC3 A;  3PHD A;  3HCS A;  1BY8 A;  4BBQ A;  4YAB A;  1HYI A;  2NAA A;  3H8C A;  1V87 A;  2YU4 A;  8PCH A;  2K4D A;  3KV6 A;  1AU3 A;  3HCU A;  2OUL A;  3B79 A;  1Z60 A;  4QH6 A;  3LQH A;  5FB1 A;  1CJL A;  2E03 A;  4MSX A;  4B7Y C;  3LFY A;  4DMY A;  4W4U A;  5LKX A;  5CHV A;  2VPD A;  4AXM A;  3S3R A;  2DC7 A;  5CHT A;  4I7B A;  3AI8 A;  3WXF A;  1U6G B;  2FO5 A;  2VPG A;  3T6R A;  3C6W A;  4FIP A;  4YAT A;  1BOR A;  1WEU A;  3RPG B;  1NQC A;  3V6E A;  3H89 A;  2M6M A;  2LGV A;  2K16 A;  1CPJ A;  5G04 B;  1X4J A;  2PUY A;  1TU6 A;  3HHA A;  1FBV A;  4X3G A;  2FQ9 A;  2L5U A;  1WEP A;  2HHN A;  1X4U A;  1ZCM A;  3DF0 A;  1VD4 A;  4YBS A;  1WEO A;  3PNR A;  1DF0 A;  3QZV A;  1JOC A;  3K8U A;  3P5W A;  4S3O B;  1HUC B;  2R9M A;  3CBK A;  1K2F A;  1MDW A;  1CHC A;  2IPP B;  4W5C A;  3OVX A;  3KW9 A;  4YYQ A;  1WIM A;  3PUR A;  4CZW A;  5CVM A;  3OVZ A;  1VYX A;  4CDD B;  4UI9 B;  5B8D A;  2ECW A;  4I04 A;  2NQG A;  4YBT A;  4PAD A;  1PCI A;  2VJE B;  2ECT A;  1F29 A;  2OP3 A;  1PPO A;  2P86 A;  3P5X A;  2VHS A;  3QT4 A;  2BDZ A;  3L1Z B;  3N3K A;  1HYJ A;  3O35 A;  5DKA A;  1S4V A;  2Y1N A;  2RSD A;  5H1U A;  3BOW A;  2VPB A;  4LJN A;  4PP2 E;  4YAX A;  3RTR B;  3D6S A;  4A4C A;  1ITO A;  3L1X A;  1U9Q X;  2KR4 A;  2NQI A;  2G6D A;  3H7D A;  3I06 A;  2D8S A;  2G8E A;  3PUQ A;  2UZG A;  1YAL A;  1YK8 A;  2F7D A;  1LDK C;  2QJ0 A;  5B77 A;  1U9V A;  4YYS A;  3O70 A;  2DCC A;  2MUM A;  2YUC A;  4GNF A;  1F62 A;  2VJF B;  1EWP A;  4X6J A;  3N4C A;  3LQI A;  4V3K C;  3SOX A;  3KWZ A;  3IV2 A;  2KIZ A;  1AIM A;  1U9X A;  4P6E A;  3M63 A;  4MZO A;  3TNX A;  2LGK A;  4AP4 A;  1F2C A;  4XUI A;  4NN2 A;  2YJ2 A;  3BWK A;  2KWO A;  2OXQ C;  1GCB A;  3T7L A;  2FTD A;  3U5M A;  4AYC A;  3ASL A;  2MT5 A;  2HD5 A;  2KWN A;  1XWH A;  1KHP A;  3QSD A;  3C5K A;  2VJE A;  2AIM A;  2M3H A;  2YJ9 A;  2PNX A;  3ZPV 1;  2E02 A;  3I2D A;  5D1K B;  2LV9 A;  2FSA A;  2HYE D;  2KYU A;  3BCN A;  1GEC E;  4UP5 A;  2AS8 A;  1ATK A;  4QF3 A;  3N3G A;  5FER A;  4FO9 A;  2L43 A;  2ZET C;  4IC2 A;  1CSB B;  1QDQ A;  5PAD A;  2LGG A;  3EB6 A;  2KE1 A;  2ECJ A;  5TBN A;  4R8P K;  2H7J A;  4Q6F A;  4GNE A;  5TDW A;  4C9Z A;  4CDE B;  3CBJ A;  1FP0 A;  4R2Y A;  2PNS A;  4QRG A;  3S3Q A;  2CSY A;  2CKL A;  2YRE A;  2EGP A;  4PTB A;  2E01 A;  9PAP A;  1G25 A;  3MTN A;  3P5U A;  3U8E A;  1QXP A;  3IMA A;  2R6N A;  3RVV A;  2IBI A;  1WES A;  1WE9 A;  4YC9 A;  1IWD A;  2HDP A;  2CIO A;  1Z2Q A;  3N9L A;  1O0E A;  2XU5 A;  3SOW A;  2F42 A;  3HWN A;  5F02 A;  3N9Q A;  2O6X A;  2DCD A;  2YQL A;  2NQA A;  4CDC B;  2MD8 C;  2NQD B;  3N9O A;  1SNK A;  3LXS A;  2LDR A;  4BS6 A;  1F2B A;  3E1Z B;  2YJ8 A;  3WXG A;  4L7X A;  2JRJ A;  5B78 A;  2AVW A;  3F75 A;  2B1N A;  2KRE A;  2AYO A;  4L58 A;  5FPW A;  4W5B A;  1ZIV A;  4LKA A;  2ECG A;  2FUI A;  4I7D A;  1TLO A;  2AUZ A;  2EOD A;  1PAD A;  3H6S A;  2PRE A;  1CB5 A;  4OEL A;  2ARY A;  2HH5 A;  1X9Y A;  3CH3 X;  4YVA A;  1ICF A;  2CKL B;  5EF4 A;  5LKT A;  2ECI A;  1MHW A;  1WEM A;  2KWK A;  1Z6U A;  2MNY A;  2KFT A;  2RI7 A;  2YUR A;  5TDR A;  5JG6 A;  1Y08 A;  1EWO A;  5JA7 A;  3M99 A;  1THE A;  3LRQ A;  2M1R A;  1WEV A;  2C2V S;  2L0B A;  1YK7 A;  7PCK A;  4YYW A;  3HTK C;  3MOR A;  2QIZ A;  4I7C A;  5B75 A;  1KFX L;  5JH3 A;  2R9O A;  4F52 B;  3O33 A;  1Q6K A;  2FYE A;  5TAB A;  1Y4H A;  5G0F A;  4BQV A;  2MNZ A;  1EF7 A;  2FRQ A;  1BP4 A;  1NLJ A;  1STF E;  2G45 A;  2CT2 A;  2ECV A;  4N8W A;  2M85 A;  2G43 A;  4QRV A;  1WIL A;  4A4B A;  4TKP B;  2R9N A;  1YVB A;  3I3T A;  4GND A;  4YV8 A;  1CV8 A;  5H1T A;  4MVT A;  5TRB A;  2MA6 A;  2Y1M A;  2F6N A;  2LXH C;  2L75 A;  2F6J A;  4O64 A;  4WZ0 A;  4WZ2 A;  2VHF A;  3O1G A;  4PI3 A;  4V3L C;  3K9M A;  3IHP A;  1FH0 A;  3KSE A;  4P6G A;  4BPV A;  1X4I A;  2FRA A;  1MM2 A;  3DQV R;  1PPN A;  4N4Z A;  3GL6 A;  1EWL A;  1MEG A;  1E4U A;  4S3O C;  3GV4 A;  3PDF A;  4PPE A;  2YHN A;  2DZY A;  1T1H A;  3BC3 A;  3NG2 A;  2MIQ A;  3IOQ A;  1CS8 A;  2GFO A;  4FJC A;  3H8B A;  5KH3 A;  1AU2 A;  1CQD A;  1AYW A;  3NHE A;  2DCA A;  4CCG X;  2OZ2 A;  1WEQ A;  2B1M A;  1AU0 A;  1EWM A;  4MZS A;  3IEJ A;  4Q8G A;  2H0D B;  3QJ3 A;  2LRI C;  4GB0 A;  2LGL A;  4HWY A;  2IDA A;  3V43 A;  3P5V A;  4QF2 A;  2BDL A;  5CVO B;  1GLO A;  1XKG A;  2YQM A;  2DC9 A;  1VSN A;  4R7E A;  5H9M A;  5B76 A;  4BSQ A;  3KKU A;  1PIP A;  3VK6 A;  2YSM A;  3OF9 A;  1SP4 B;  2AU1 A;  3ZYQ A;  3PBH A;  1MM3 A;  4ZQL A;  5K16 A;  2KWJ A;  1AEC A;  1TL9 A;  1KFU L;  5H1V A;  3OF8 A;  3RVX A;  4LAD B;  3N9N A;  4YYR A;  2YJC A;  3C9E A;  1GMY A;  1WEW A;  1CVZ A;  2K17 A;  2H0D A;  3FL2 A;  4BS5 A;  5LKU A;  6PAD A;  2DZZ A;  3ZUA A;  2CSZ A;  4AVX A;  1AU4 A;  3O37 A;  1QOL A;  1K3B B;  3KFQ A;  3N9P A;  1DVP A;  4AYC B;  1PXV A;  3O36 A;  2YJB A;  2BAY A;  5LKZ A;  1AYU A;  2AYN A;  4Q8H A;  3MHS A;  4BHW A;  3O7A A;  3U5O A;  1U5I A;  2XU1 A;  3ZVZ B;  3DPL R;  1JM7 A;  2E6R A;  4ZDT A;  3USV A;  4CA1 A;  2YT5 A;  2MD7 B;  4P5O B;  2FUU A;  2YHO A;  3EB5 A;  2Y43 A;  1WFK A;  3ZPV E;  1N87 A;  4WA6 A;  2LXP C;  2C0Y A;  4YBM A;  1KHQ A;  1AYV A;  2AN6 A;  4YAD A;  2L80 A;  4AUQ B;  4XR7 A;  1VFY A;  4I07 A;  1VJV A;  1JM7 B;  1POP A;  4N79 A;  4AXL A;  4LLB A;  3KX1 A;  2WBF X;  4XI1 A;  1PPP A;  2HXZ A;  4CDF B;  1DEU A;  5C13 A;  1U9W A;  1QMY A;  2YW8 A;  2C2L A;  2DJF B;  2P0R A;  2K1J A;  2XEU A;  3CH2 X;  3O34 A;  5A24 A;  3OIS A;  3WXE A;  3IUT A;  5LCW B;  4WZ3 B;  3MHH A;  4OEM A;  2PBH A;  3BPM A;  1NB5 A;  1PE6 A;  3LQJ A; 
#chains in the Genus database with same CATH topology
 5J94 A;  3DWD A;  2VJF A;  2L7P A;  5G05 B;  4BOQ A;  3FAO A;  4REZ A;  3V6C A;  2XU4 A;  5FB0 A;  2YYR A;  1A6R A;  2R9F A;  3K24 A;  4RY2 A;  3U5P A;  1YT7 A;  1ME4 A;  4X6H A;  4B86 C;  3O65 A;  5J3X A;  5AIU A;  1UKF A;  2JQG R;  5KH9 A;  1CTE A;  2E00 A;  2G7Y A;  5EYA F;  2G8J A;  3BY4 A;  3GCB A;  5C11 A;  5AIT A;  5D1L B;  5B79 A;  2DC6 A;  3HHI A;  2VNF A;  1JQP A;  2Y6E A;  4YYV A;  2VPE A;  5DIN A;  2ECN A;  5KH7 A;  2PAD A;  2G6Q A;  5FEY A;  3SOU A;  3M62 A;  4M0W A;  2KU3 A;  1F2A A;  4ZUX U;  3RVW A;  3PW3 A;  2DCB A;  5EGW A;  3N9M A;  2DX8 A;  1PPD A;  1M6D A;  4X6I A;  2R9C A;  3KNV A;  3F5V A;  3W31 A;  4GNG A;  5I3L A;  2LN0 A;  4A49 A;  4N3W A;  2F1G A;  2FUD A;  5CVN B;  3W30 A;  3HCT A;  3ZNI A;  2JMI A;  3T9K A;  1NL6 A;  1ZBD B;  1WEE A;  2ATO A;  2DJG B;  2DC8 A;  2LQ6 A;  3PT2 A;  2VP7 A;  1NPZ A;  1MS6 A;  4PP1 A;  2XP0 A;  2JQF R;  3ZVY A;  1KXR A;  1IYM A;  2KGI A;  3RPG C;  2YSJ A;  4YYU A;  4QBB A;  5KO3 A;  4DMX A;  2KGG A;  2I50 A;  3KQI A;  4UP0 A;  1WGM A;  2CB5 A;  1WEN A;  4K7C A;  5EZS A;  2ACT A;  3KWB X;  2JMD A;  4A0C D;  3ERV A;  3PHU A;  1MEM A;  1LDJ B;  3KV5 A;  2XU3 A;  2EA6 A;  3BBA A;  3L11 A;  2FT2 A;  4FK5 A;  3SHB A;  1BGO A;  4LK9 A;  2GHU A;  1RMD A;  2CRR A;  2JTC A;  3HD3 A;  2P7U A;  3ZTG A;  4KLB A;  4G54 A;  3U5N A;  3BPF A;  1ME3 A;  3O0U A;  1PVJ A;  2AUX A;  2Y5B A;  1NB3 A;  4OW0 A;  2JMJ A;  3JUE A;  4N4F A;  5D1M B;  1MIR A;  2E6S A;  1PBH A;  2XB1 A;  2JRI A;  4QRX A;  5E6J A;  2EXU A;  3RNV A;  2MA5 A;  4I05 A;  2QIC A;  1BQI A;  4IC3 A;  4A5U A;  3PHD A;  3HCS A;  1BY8 A;  4BBQ A;  4YAB A;  1HYI A;  2NAA A;  3H8C A;  1V87 A;  2YU4 A;  8PCH A;  3FM8 C;  2K4D A;  3KV6 A;  1AU3 A;  3HCU A;  2OUL A;  3B79 A;  1Z60 A;  4QH6 A;  3ZNH A;  3LQH A;  5FB1 A;  1CJL A;  3FAN A;  4MSX A;  2E03 A;  4B7Y C;  3LFY A;  4DMY A;  4W4U A;  4OVZ A;  5LKX A;  2BTW A;  3LJU X;  5CHV A;  2P57 A;  2VPD A;  4AXM A;  3S3R A;  2DC7 A;  5CHT A;  4I7B A;  3AI8 A;  3WXF A;  1U6G B;  2FO5 A;  2UZJ A;  2VPG A;  2E61 A;  3T6R A;  3C6W A;  4FIP A;  4YAT A;  1BOR A;  1WEU A;  3RPG B;  1DKI A;  1NQC A;  3V6E A;  3H89 A;  2M6M A;  2LGV A;  2K16 A;  2LAU A;  1CPJ A;  5G04 B;  1X4J A;  2PUY A;  1TU6 A;  3HHA A;  1FBV A;  4X3G A;  2FQ9 A;  2L5U A;  1WEP A;  2HHN A;  1X4U A;  1ZCM A;  3DF0 A;  1VD4 A;  4YBS A;  1WEO A;  3PHW A;  3PNR A;  1DF0 A;  3QZV A;  1JOC A;  4BOZ A;  3K8U A;  3P5W A;  4S3O B;  1HUC B;  2R9M A;  4GUA A;  3CBK A;  1K2F A;  1MDW A;  1CHC A;  2IPP B;  4W5C A;  3OVX A;  3KW9 A;  4YYQ A;  1WIM A;  3PUR A;  3E2D A;  5CVM A;  3OVZ A;  4CZW A;  1VYX A;  4CDD B;  4UI9 B;  5B8D A;  2ECW A;  4I04 A;  3PSE A;  2CON A;  2NQG A;  4YBT A;  4PAD A;  1PCI A;  2BTW B;  2VJE B;  2ECT A;  1F29 A;  2OP3 A;  1PPO A;  2P86 A;  3P5X A;  2VHS A;  2Z84 A;  3QT4 A;  2BDZ A;  3L1Z B;  3N3K A;  1HYJ A;  3O35 A;  5DKA A;  1S4V A;  2Y1N A;  2RSD A;  5K3Q A;  3MP2 A;  5H1U A;  3BOW A;  2VPB A;  4LJN A;  4PP2 E;  4YAX A;  3RTR B;  3D6S A;  4A4C A;  1ITO A;  2DSM A;  3L1X A;  1U9Q X;  2KR4 A;  2NQI A;  2G6D A;  3H7D A;  3I06 A;  2D8S A;  2KKY A;  2G8E A;  4MI7 A;  4HXD B;  3PUQ A;  2UZG A;  1YAL A;  1DCQ A;  1YK8 A;  2F7D A;  1LDK C;  2QJ0 A;  4RKX A;  3PLW A;  5B77 A;  1U9V A;  3O70 A;  2DCC A;  4YYS A;  2MUM A;  2YUC A;  4GNF A;  1F62 A;  2VJF B;  1EWP A;  1YZB A;  4X6J A;  3N4C A;  3LQI A;  4V3K C;  3SOX A;  3KWZ A;  4RF0 A;  3IV2 A;  2KIZ A;  1AIM A;  1U9X A;  4P6E A;  3M63 A;  4MZO A;  3TNX A;  2LGK A;  5SVX A;  4AP4 A;  1F2C A;  4XUI A;  4NN2 A;  2YJ2 A;  3BWK A;  2KWO A;  2OXQ C;  1GCB A;  3T7L A;  2FTD A;  3U5M A;  4AYC A;  3ASL A;  2MT5 A;  2HD5 A;  2KWN A;  1XWH A;  1KHP A;  3QSD A;  3C5K A;  2VJE A;  2AIM A;  2M3H A;  2YJ9 A;  2PNX A;  3ZPV 1;  2E02 A;  3I2D A;  5D1K B;  2LV9 A;  2FSA A;  2HYE D;  2KYU A;  3BCN A;  1GEC E;  3MJ5 A;  4UP5 A;  2AS8 A;  2CSV A;  4QF3 A;  1ATK A;  3N3G A;  5FER A;  4FO9 A;  2L43 A;  2ZET C;  4PT5 A;  4IC2 A;  1CSB B;  1QDQ A;  5PAD A;  2LGG A;  4F1P A;  3TMP A;  4R3D A;  3EB6 A;  2KE1 A;  2ECJ A;  5TBN A;  4R8P K;  2H7J A;  4D8B A;  4Q6F A;  2FD4 A;  4GNE A;  5TDW A;  4C9Z A;  4CDE B;  1MBM A;  3CBJ A;  1FP0 A;  4R2Y A;  2PNS A;  4QRG A;  3S3Q A;  2XOY A;  2CSY A;  2CKL A;  2DJA A;  2EGP A;  2YRE A;  3B21 A;  4PTB A;  2E01 A;  3Q1D A;  9PAP A;  1G25 A;  4H9D A;  3MTN A;  3P5U A;  3U8E A;  1QXP A;  2IQJ A;  3KDE C;  2HWK A;  2B0O E;  3IMA A;  2R6N A;  3RVV A;  2IBI A;  1WES A;  1WE9 A;  4YC9 A;  1IWD A;  2HDP A;  2CIO A;  1Z2Q A;  3N9L A;  1O0E A;  2XU5 A;  3SOW A;  2F42 A;  3HWN A;  4P16 A;  5F02 A;  4O62 A;  3N9Q A;  2O6X A;  2DCD A;  4XZX A;  2YQL A;  2NQA A;  4CDC B;  2MD8 C;  2NQD B;  3N9O A;  1SNK A;  3LXS A;  2LDR A;  4BS6 A;  1F2B A;  3E1Z B;  2YJ8 A;  3WXG A;  4L7X A;  2JRJ A;  5B78 A;  2AVW A;  2XOZ A;  2YVR A;  3F75 A;  2B1N A;  4D8E A;  2KRE A;  2AYO A;  4L58 A;  5FPW A;  4W5B A;  1ZIV A;  4LKA A;  2ECG A;  2FUI A;  4I7D A;  1TLO A;  4IUM A;  2AUZ A;  2EOD A;  3LDY A;  1PAD A;  2PRE A;  3H6S A;  1CB5 A;  4OEL A;  2ARY A;  2HH5 A;  1X9Y A;  3CH3 X;  4ZTB A;  1ICF A;  2CKL B;  4BOU A;  5EF4 A;  4YVA A;  5LKT A;  2ECI A;  1MHW A;  1WEM A;  2M13 A;  2KWK A;  3FEH A;  3C0R A;  1Z6U A;  2MNY A;  5EZQ A;  3M7K A;  2KFT A;  2RI7 A;  2YUR A;  5TDR A;  5JG6 A;  1Y08 A;  1EWO A;  5JA7 A;  2D8U A;  3M99 A;  3LVR E;  3LRQ A;  1THE A;  2M1R A;  3TRK A;  1WEV A;  2C2V S;  2L0B A;  1YK7 A;  7PCK A;  4YYW A;  3HTK C;  3MOR A;  2QIZ A;  4I7C A;  4Z0O A;  5B75 A;  2J7Q C;  1KFX L;  5JH3 A;  2R9O A;  4F52 B;  3OQC A;  3O33 A;  2JUN A;  1Q6K A;  2FYE A;  5TAB A;  1Y4H A;  2JM3 A;  5G0F A;  4BQV A;  2MNZ A;  1EF7 A;  4D8I A;  4QQ4 A;  2FRQ A;  1BP4 A;  1NLJ A;  1STF E;  2G45 A;  2CT2 A;  2ECV A;  4N8W A;  2M85 A;  2G43 A;  4QRV A;  3PRP A;  1WIL A;  4OGE A;  4A4B A;  4TKP B;  2R9N A;  1YVB A;  3I3T A;  4GND A;  4YV8 A;  3E9S A;  1CV8 A;  5H1T A;  4MVT A;  5TRB A;  2MA6 A;  2Y1M A;  2F6N A;  2LXH C;  2L75 A;  5SVI A;  2F6J A;  4O64 A;  4WZ0 A;  4WZ2 A;  2VHF A;  3O1G A;  4MM3 B;  4PI3 A;  4V3L C;  3K9M A;  3IHP A;  1FH0 A;  3O47 A;  3KSE A;  4P6G A;  1X4I A;  2KKX A;  4BPV A;  2FRA A;  1MM2 A;  3LVQ E;  3DQV R;  1PPN A;  4N4Z A;  3GL6 A;  1EWL A;  1MEG A;  1E4U A;  4S3O C;  3GV4 A;  3PDF A;  4OVZ B;  4PPE A;  2YHN A;  2DZY A;  1T1H A;  4RNA A;  3BC3 A;  3NG2 A;  4IP3 A;  2MIQ A;  3IOQ A;  1CS8 A;  2GFO A;  4FJC A;  3H8B A;  5KH3 A;  4BOP A;  3IFU A;  1AU2 A;  1CQD A;  5SVY A;  1AYW A;  3SUB A;  2DCA A;  4CCG X;  2OZ2 A;  3H7H A;  3NHE A;  1WEQ A;  2B1M A;  3PRM A;  1AU0 A;  1EWM A;  4MZS A;  3IEJ A;  4Q8G A;  2H0D B;  3QJ3 A;  2LRI C;  4GB0 A;  2LGL A;  4HWY A;  2IDA A;  3MTV A;  4RF1 A;  3V43 A;  3P5V A;  4QF2 A;  2BDL A;  5CVO B;  1GLO A;  1XKG A;  2YQM A;  2RR4 A;  2AGA A;  2DC9 A;  1VSN A;  2FE8 A;  4R7E A;  3DDT A;  5H9M A;  5B76 A;  4BSQ A;  3KKU A;  1PIP A;  3VK6 A;  2YSM A;  3OF9 A;  1SP4 B;  2AU1 A;  3ZYQ A;  3PBH A;  1MM3 A;  4ZQL A;  5K16 A;  5SVI B;  2KWJ A;  1AEC A;  1TL9 A;  1KFU L;  5H1V A;  3OF8 A;  3RVX A;  4LAD B;  2FFW A;  3N9N A;  4YYR A;  2YJC A;  3C9E A;  1GMY A;  3MDB C;  1WEW A;  1CVZ A;  2K17 A;  2H0D A;  3FL2 A;  4BS5 A;  5LKU A;  6PAD A;  2DZZ A;  3ZUA A;  2CSZ A;  4AVX A;  1AU4 A;  3O37 A;  1QOL A;  1K3B B;  3KFQ A;  3N9P A;  4OGC A;  1DVP A;  4AYC B;  3PHX A;  2MKE A;  1PXV A;  2J7Q A;  3O36 A;  2YJB A;  2BAY A;  5LKZ A;  1AYU A;  5JZE A;  2AYN A;  4Q8H A;  3MHS A;  4BHW A;  2CRW A;  3O7A A;  3U5O A;  1U5I A;  2XU1 A;  3ZVZ B;  3DPL R;  1JM7 A;  2E6R A;  4ZDT A;  3USV A;  4CA1 A;  2XOC A;  3FJU B;  2YT5 A;  2MD7 B;  4P5O B;  2FUU A;  2YHO A;  3EB5 A;  2Y43 A;  1WFK A;  3ZPV E;  1N87 A;  4WA6 A;  4Z0R A;  2LXP C;  2C0Y A;  4YBM A;  1KHQ A;  1AYV A;  2EGM A;  4YAD A;  2AN6 A;  2L80 A;  4AUQ B;  4XR7 A;  1VFY A;  4I07 A;  1VJV A;  1JM7 B;  1POP A;  4N79 A;  4AXL A;  4LLB A;  4WUR A;  3KX1 A;  2WBF X;  4XI1 A;  1PPP A;  2HXZ A;  4CDF B;  1DEU A;  5C13 A;  2BU3 A;  1U9W A;  1QMY A;  2YW8 A;  2C2L A;  2DJF B;  2P0R A;  2K1J A;  2XEU A;  3CH2 X;  3O34 A;  3BB7 A;  5A24 A;  3OIS A;  3WXE A;  3IUT A;  5LCW B;  2OWA A;  4WZ3 B;  3MHH A;  4OEM A;  2DOS A;  2PBH A;  3BPM A;  1NB5 A;  1PE6 A;  3LQJ A;  4BOS A; 
#chains in the Genus database with same CATH homology
 5J94 A;  2VJF A;  5G05 B;  3V6C A;  2XU4 A;  5FB0 A;  2YYR A;  1A6R A;  2R9F A;  3K24 A;  4RY2 A;  3U5P A;  1YT7 A;  1ME4 A;  4X6H A;  4B86 C;  5J3X A;  5AIU A;  2JQG R;  5KH9 A;  1CTE A;  2E00 A;  2G7Y A;  5EYA F;  2G8J A;  3GCB A;  5C11 A;  5AIT A;  5D1L B;  5B79 A;  2DC6 A;  3HHI A;  2VNF A;  1JQP A;  2Y6E A;  4YYV A;  2VPE A;  5DIN A;  2ECN A;  5KH7 A;  2PAD A;  2G6Q A;  5FEY A;  3SOU A;  3M62 A;  2KU3 A;  1F2A A;  4ZUX U;  3RVW A;  3PW3 A;  2DCB A;  5EGW A;  3N9M A;  2DX8 A;  1PPD A;  1M6D A;  4X6I A;  2R9C A;  3KNV A;  3F5V A;  4GNG A;  5I3L A;  2LN0 A;  4A49 A;  4N3W A;  2F1G A;  2FUD A;  5CVN B;  3HCT A;  3ZNI A;  2JMI A;  1NL6 A;  2ATO A;  1ZBD B;  1WEE A;  2DJG B;  2DC8 A;  2LQ6 A;  2VP7 A;  1NPZ A;  1MS6 A;  4PP1 A;  2JQF R;  1E2T A;  3ZVY A;  1KXR A;  1IYM A;  2KGI A;  3RPG C;  2YSJ A;  4YYU A;  4QBB A;  4DMX A;  2KGG A;  2I50 A;  3KQI A;  4UP0 A;  1WGM A;  2CB5 A;  1WEN A;  4K7C A;  2ACT A;  3KWB X;  2JMD A;  4A0C D;  3ERV A;  1MEM A;  1LDJ B;  3KV5 A;  2XU3 A;  2EA6 A;  3L11 A;  2FT2 A;  4FK5 A;  3SHB A;  1BGO A;  4LK9 A;  2GHU A;  1RMD A;  3HD3 A;  2P7U A;  3ZTG A;  4KLB A;  4G54 A;  3U5N A;  3BPF A;  2BSZ A;  1ME3 A;  3O0U A;  2AUX A;  2Y5B A;  1NB3 A;  2JMJ A;  4N4F A;  5D1M B;  1MIR A;  2E6S A;  1PBH A;  2XB1 A;  4QRX A;  1W4T A;  2MA5 A;  4I05 A;  2QIC A;  1BQI A;  4IC3 A;  3PHD A;  3HCS A;  1BY8 A;  4BBQ A;  1W6F A;  4YAB A;  1HYI A;  2NAA A;  3H8C A;  1V87 A;  2YU4 A;  8PCH A;  2K4D A;  3KV6 A;  1AU3 A;  3HCU A;  2OUL A;  3B79 A;  1Z60 A;  4QH6 A;  3LQH A;  5FB1 A;  1CJL A;  2E03 A;  4MSX A;  4B7Y C;  3LFY A;  4DMY A;  4W4U A;  5LKX A;  5CHV A;  1GX3 A;  2VPD A;  4AXM A;  3S3R A;  2DC7 A;  5CHT A;  4I7B A;  3AI8 A;  3WXF A;  1U6G B;  2FO5 A;  2VPG A;  3T6R A;  3C6W A;  4FIP A;  4YAT A;  1BOR A;  1WEU A;  3RPG B;  1NQC A;  3V6E A;  3H89 A;  2M6M A;  2LGV A;  2K16 A;  1CPJ A;  5G04 B;  1X4J A;  2PUY A;  1TU6 A;  3HHA A;  1FBV A;  4X3G A;  2FQ9 A;  2L5U A;  1WEP A;  2HHN A;  1X4U A;  1ZCM A;  3DF0 A;  1VD4 A;  4YBS A;  1WEO A;  3PNR A;  1DF0 A;  3QZV A;  4NV7 A;  1JOC A;  3K8U A;  3P5W A;  4S3O B;  1HUC B;  2R9M A;  3CBK A;  1K2F A;  1MDW A;  3D9W A;  1CHC A;  2IPP B;  1W5R A;  4W5C A;  3OVX A;  3KW9 A;  4YYQ A;  1WIM A;  3PUR A;  4CZW A;  5CVM A;  3OVZ A;  1VYX A;  4CDD B;  4UI9 B;  5B8D A;  2ECW A;  4I04 A;  2NQG A;  4YBT A;  4PAD A;  1PCI A;  2VJE B;  2ECT A;  1F29 A;  2OP3 A;  1PPO A;  2P86 A;  3P5X A;  2VHS A;  3QT4 A;  2BDZ A;  3L1Z B;  3N3K A;  1HYJ A;  3O35 A;  5DKA A;  1S4V A;  2Y1N A;  2RSD A;  5H1U A;  3BOW A;  2VPB A;  4LJN A;  4PP2 E;  4YAX A;  3RTR B;  3D6S A;  4A4C A;  1ITO A;  3L1X A;  1U9Q X;  2KR4 A;  2NQI A;  2G6D A;  3H7D A;  3I06 A;  2D8S A;  2G8E A;  3PUQ A;  2UZG A;  1YAL A;  1YK8 A;  2F7D A;  1LDK C;  2QJ0 A;  5B77 A;  1U9V A;  4YYS A;  3O70 A;  2DCC A;  2MUM A;  2YUC A;  4GNF A;  1F62 A;  2VJF B;  1EWP A;  4GUZ A;  4X6J A;  3N4C A;  3LQI A;  4V3K C;  3SOX A;  3KWZ A;  3IV2 A;  2KIZ A;  1AIM A;  1U9X A;  4P6E A;  3M63 A;  4MZO A;  3TNX A;  2LGK A;  4NV8 A;  4AP4 A;  1F2C A;  4XUI A;  4NN2 A;  2YJ2 A;  3BWK A;  2KWO A;  2OXQ C;  1GCB A;  3T7L A;  2FTD A;  3U5M A;  4AYC A;  3ASL A;  2MT5 A;  2HD5 A;  2KWN A;  1XWH A;  1KHP A;  3QSD A;  3C5K A;  2VJE A;  2AIM A;  2M3H A;  2YJ9 A;  2PNX A;  3ZPV 1;  2E02 A;  3I2D A;  5D1K B;  2LV9 A;  2FSA A;  2HYE D;  2KYU A;  3BCN A;  1GEC E;  4UP5 A;  2AS8 A;  1ATK A;  4QF3 A;  3N3G A;  5FER A;  4FO9 A;  2L43 A;  2ZET C;  4IC2 A;  1CSB B;  1QDQ A;  5PAD A;  2LGG A;  3EB6 A;  2KE1 A;  2ECJ A;  5TBN A;  4R8P K;  2H7J A;  4Q6F A;  4GNE A;  5TDW A;  4C9Z A;  4CDE B;  3CBJ A;  1FP0 A;  4R2Y A;  2PNS A;  4QRG A;  3S3Q A;  2CSY A;  2CKL A;  2YRE A;  2EGP A;  4PTB A;  2E01 A;  9PAP A;  1G25 A;  3MTN A;  3P5U A;  3U8E A;  2VFB A;  1QXP A;  3IMA A;  2R6N A;  3RVV A;  2VFC A;  2IBI A;  1WES A;  1WE9 A;  4YC9 A;  1IWD A;  2HDP A;  2CIO A;  1Z2Q A;  3N9L A;  1O0E A;  2XU5 A;  3SOW A;  2F42 A;  3HWN A;  5F02 A;  3N9Q A;  2O6X A;  2DCD A;  2YQL A;  2NQA A;  4CDC B;  2MD8 C;  2NQD B;  3N9O A;  4C5P A;  1SNK A;  3LXS A;  2LDR A;  4BS6 A;  1F2B A;  3E1Z B;  2YJ8 A;  3WXG A;  4L7X A;  2JRJ A;  5B78 A;  2AVW A;  3F75 A;  2B1N A;  2KRE A;  2AYO A;  4L58 A;  5FPW A;  4W5B A;  1ZIV A;  4LKA A;  2ECG A;  2FUI A;  4I7D A;  1TLO A;  2AUZ A;  2EOD A;  1PAD A;  3H6S A;  2PRE A;  1CB5 A;  4OEL A;  2ARY A;  2HH5 A;  1X9Y A;  3CH3 X;  4YVA A;  1ICF A;  2CKL B;  5EF4 A;  5LKT A;  2ECI A;  1MHW A;  1WEM A;  2KWK A;  1Z6U A;  2MNY A;  2KFT A;  2RI7 A;  2YUR A;  5TDR A;  5JG6 A;  1Y08 A;  1EWO A;  5JA7 A;  3M99 A;  1THE A;  3LRQ A;  2M1R A;  1WEV A;  2C2V S;  2L0B A;  1YK7 A;  7PCK A;  4YYW A;  3HTK C;  3MOR A;  2QIZ A;  4I7C A;  5B75 A;  1KFX L;  5JH3 A;  2R9O A;  4F52 B;  3O33 A;  1Q6K A;  2FYE A;  5TAB A;  1Y4H A;  5G0F A;  4BQV A;  2MNZ A;  1EF7 A;  2FRQ A;  1BP4 A;  1NLJ A;  1STF E;  2G45 A;  2CT2 A;  2ECV A;  4N8W A;  2M85 A;  2G43 A;  4QRV A;  1WIL A;  4A4B A;  4TKP B;  2R9N A;  1YVB A;  3I3T A;  4GND A;  4YV8 A;  1CV8 A;  5H1T A;  4MVT A;  5TRB A;  2MA6 A;  2Y1M A;  4B55 A;  2F6N A;  2LXH C;  2L75 A;  2F6J A;  4O64 A;  4WZ0 A;  4WZ2 A;  2VHF A;  3O1G A;  4PI3 A;  4V3L C;  3K9M A;  3IHP A;  1FH0 A;  3KSE A;  4P6G A;  4BPV A;  1X4I A;  2FRA A;  1MM2 A;  3DQV R;  1PPN A;  4N4Z A;  3GL6 A;  1EWL A;  1MEG A;  1E4U A;  4S3O C;  3GV4 A;  3PDF A;  4PPE A;  2YHN A;  2DZY A;  1T1H A;  3BC3 A;  3NG2 A;  2MIQ A;  3IOQ A;  1CS8 A;  2GFO A;  4FJC A;  3H8B A;  5KH3 A;  1AU2 A;  1CQD A;  1AYW A;  3NHE A;  2DCA A;  4CCG X;  2OZ2 A;  1WEQ A;  2B1M A;  1AU0 A;  1EWM A;  4MZS A;  3IEJ A;  4Q8G A;  2H0D B;  3QJ3 A;  2LRI C;  4GB0 A;  2LGL A;  4HWY A;  2IDA A;  3V43 A;  3P5V A;  4QF2 A;  2BDL A;  5CVO B;  1GLO A;  1XKG A;  2YQM A;  2DC9 A;  1VSN A;  4R7E A;  5H9M A;  5B76 A;  4BSQ A;  3KKU A;  1PIP A;  3VK6 A;  2YSM A;  3OF9 A;  1SP4 B;  2AU1 A;  3ZYQ A;  3PBH A;  1MM3 A;  4ZQL A;  5K16 A;  2KWJ A;  1AEC A;  1TL9 A;  1KFU L;  5H1V A;  3OF8 A;  3RVX A;  4LAD B;  3N9N A;  4YYR A;  2YJC A;  3C9E A;  1GMY A;  1WEW A;  1CVZ A;  2K17 A;  2H0D A;  3FL2 A;  4BS5 A;  5LKU A;  6PAD A;  2DZZ A;  3ZUA A;  2CSZ A;  4AVX A;  1AU4 A;  3O37 A;  1QOL A;  1K3B B;  3KFQ A;  3N9P A;  1DVP A;  4AYC B;  1PXV A;  3O36 A;  2YJB A;  2BAY A;  5LKZ A;  1AYU A;  2AYN A;  4Q8H A;  3MHS A;  4BHW A;  3O7A A;  3U5O A;  1U5I A;  2XU1 A;  3ZVZ B;  4BGF A;  3DPL R;  1JM7 A;  2E6R A;  4ZDT A;  3USV A;  4CA1 A;  2YT5 A;  2MD7 B;  4P5O B;  2FUU A;  2YHO A;  3EB5 A;  2Y43 A;  1WFK A;  3ZPV E;  1N87 A;  4WA6 A;  2LXP C;  2C0Y A;  4YBM A;  1KHQ A;  1AYV A;  2AN6 A;  4YAD A;  2L80 A;  4AUQ B;  4XR7 A;  1VFY A;  4I07 A;  1VJV A;  1JM7 B;  1POP A;  4N79 A;  4AXL A;  4LLB A;  3KX1 A;  2WBF X;  4XI1 A;  1PPP A;  2HXZ A;  4CDF B;  1DEU A;  5C13 A;  1U9W A;  1QMY A;  2YW8 A;  2C2L A;  2DJF B;  2P0R A;  2K1J A;  2XEU A;  3CH2 X;  3O34 A;  3LTW A;  5A24 A;  3OIS A;  3WXE A;  3IUT A;  5LCW B;  4WZ3 B;  3MHH A;  4OEM A;  2PBH A;  3BPM A;  1NB5 A;  1PE6 A;  3LQJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...