4W4UA

Structure of yeast saga dubm with sgf73 y57a mutant at 2.8 angstroms resolution
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
471
structure length
438
Chain Sequence
MSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALRQTGFIYLLTCAWKIQDAHEFWQFIINQIHQSYVLDLPNAKEVSRANNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNYHCGECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase
publication title Uncovering the role of Sgf73 in maintaining SAGA deubiquitinating module structure and activity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/hydrolase
total genus 135
structure length 438
sequence length 471
chains with identical sequence D
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2014-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4w4uA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4w4uA02
1AYUA 2AVWA 2M85A 4FJCA 4B7YC 5TDRA 3BCNA 4CDCB 4QRXA 2NQAA 2IBIA 4S3OC 5AITA 3ZTGA 4CZWA 4YBTA 1PBHA 2C2LA 4Q6FA 2Y6EA 1MHWA 3BOWA 3U8EA 5B76A 3OISA 2MT5A 3CH3X 5D1MB 2XB1A 2AU1A 1AU2A 1VD4A 2DZZA 2O6XA 2DJFB 1AYWA 4PPEA 1F2AA 4I05A 5LCWB 2YQMA 1CB5A 4CCGX 1YVBA 3F75A 3P5VA 2DCAA 2R9FA 5KH9A 2DC9A 4HWYA 2YJCA 2FRAA 1ME4A 1V87A 4N79A 3SOXA 2CKLA 5TDWA 5C11A 2PBHA 4CDEB 3PBHA 2MUMA 4ZUXU 2M6MA 1HYJA 5I3LA 3I3TA 1GMYA 2AUXA 2DC8A 3KWZA 2YYRA 5CVNB 2K16A 3EB6A 1T1HA 1YK7A 1WE9A 1CV8A 3S3QA 2D8SA 1WEVA 2YJ2A 3KV5A 4IC3A 3HTKC 3O35A 4X6HA 1BORA 4PI3A 2G8EA 2JMDA 2OZ2A 1IWDA 4AXLA 3M62A 3L1XA 1YT7A 2R9OA 3DF0A 3WXFA 2GFOA 4AYCB 2JQGR 3USVA 1WEQA 5FERA 2AIMA 2NQGA 5H1UA 3MORA 4W5BA 2YJBA 1NPZA 1E4UA 2E6SA 2F1GA 4I7DA 5KH3A 2DCBA 2ARYA 2JQFR 2LGGA 1WEWA 2XU3A 5J94A 3SOUA 3BPFA 4A4BA 4N3WA 4V3KC 3RVXA 1CJLA 2E01A 3HCSA 5DKAA 1NL6A 3IMAA 2R6NA 4I07A 2NQDB 4Q8GA 3N3GA 5K16A 4NN2A 1KFXL 1VSNA 4P6GA 2MNYA 2FRQA 4C9ZA 4S3OB 2DX8A 4L7XA 3EB5A 4MVTA 4ZDTA 2KGGA 3ZYQA 1QDQA 2EA6A 3NG2A 2G45A 1K2FA 3OF9A 2FUIA 1CTEA 3QJ3A 2VPGA 5H9MA 3FL2A 1PXVA 1AU3A 4YYUA 5KH7A 1AYVA 1MM2A 2I50A 4WA6A 1ZBDB 3KWBX 4GNDA 5FB1A 5TRBA 4PTBA 3RPGC 4R8PK 1IYMA 1MDWA 4LLBA 2ECTA 2BDLA 2CIOA 2HHNA 2OP3A 3IHPA 1F2BA 2ECVA 1CQDA 2XEUA 2NQIA 4AXMA 3IOQA 4G54A 3SHBA 2JMIA 1TU6A 1YALA 4I7CA 2Y43A 3C6WA 1STFE 1S4VA 3M99A 4WZ3B 2MD7B 3U5PA 3CH2X 1POPA 3KQIA 2R9CA 1RMDA 4I04A 2PNSA 3PURA 3N9MA 1EWPA 2VHSA 3L1ZB 2E6RA 4OEMA 6PADA 1AIMA 2YSMA 5FB0A 2LRIC 5G05B 4A49A 1WFKA 4AVXA 1ICFA 2Y1MA 1PPOA 3E1ZB 4BS5A 4A4CA 3V6EA 2G43A 4QH6A 5FPWA 2F6NA 2HH5A 3BPMA 4O64A 5FEYA 5LKTA 1GCBA 2LGLA 4PADA 3RVVA 1Q6KA 3H8CA 4YADA 3K24A 3PDFA 2ACTA 4P6EA 5CHVA 4QF2A 1N87A 3F5VA 1TLOA 4FO9A 2B1NA 1EWMA 2LGKA 3ZPVE 1MEMA 3PHDA 5D1KB 1CHCA 1DF0A 1GECE 2HDPA 2IPPB 2CKLB 3O70A 2YU4A 3GL6A 2KU3A 3LXSA 4XR7A 1NB3A 2HD5A 3QSDA 3MHHA 5LKZA 3BWKA 2F42A 1VFYA 3ZUAA 2E02A 4FIPA 3O34A 3KW9A 1Y4HA 3C5KA 1NB5A 4F52B 1JM7A 3RPGB 1FBVA 4RY2A 4N8WA 5TBNA 4WZ2A 4CA1A 1ME3A 5CVMA 1F29A 3SOWA 5EYAF 1GLOA 1TL9A 2FT2A 2RSDA 4UI9B 1WEPA 1CVZA 1X4UA 4XI1A 1Y08A 4YBSA 2VPBA 4PP1A 5H1VA 3HCUA 1EF7A 3VK6A 2FQ9A 1QOLA 5JH3A 2AYNA 1XKGA 1AU0A 4R2YA 2VJEA 3N9QA 3HD3A 4LADB 3O33A 4A0CD 3L11A 8PCHA 4QRVA 2KR4A 4LK9A 2KE1A 4X3GA 1U9WA 4OELA 3GCBA 2G6DA 2FUUA 1THEA 5EGWA 2NAAA 3WXGA 4CDFB 4YYQA 3ERVA 2DC7A 1HUCB 4P5OB 2EODA 3N9OA 5B79A 2OULA 2M1RA 4GNGA 2KWOA 4UP0A 2VPEA 2R9NA 1FP0A 3DQVR 3HCTA 3ZNIA 2DZYA 5F02A 3P5XA 1O0EA 3T6RA 5LKXA 4DMYA 5PADA 3CBJA 1EWLA 2K17A 2L0BA 3OF8A 1WGMA 3ZPV1 4ZQLA 3S3RA 4AUQB 1WIMA 2E00A 3TNXA 2CT2A 2K4DA 1BQIA 4BPVA 1A6RA 1M6DA 1Z60A 4B86C 2LQ6A 3M63A 2YUCA 2YT5A 3PNRA 3H89A 4WZ0A 1CS8A 2L43A 1Z6UA 1Z2QA 5J3XA 4YATA 2UZGA 5JG6A 5TABA 2YQLA 2FTDA 2YHOA 5D1LB 1PPNA 4W4UA 1WEEA 1F2CA 4TKPB 5B75A 3DPLR 2G8JA 3LFYA 2H0DA 1FH0A 1HYIA 2KWNA 3K8UA 5CVOB 1U9XA 2ATOA 1XWHA 2VNFA 2P7UA 3IV2A 3LRQA 4GNFA 4PP2E 2FSAA 1CSBB 3B79A 2YW8A 4YAXA 3O0UA 4GNEA 2P86A 2JRJA 2YURA 2LXPC 3LQIA 5G0FA 1BGOA 3O7AA 3V43A 2HXZA 5JA7A 3I2DA 3MHSA 4YC9A 4MZOA 2K1JA 2KREA 3KNVA 3K9MA 2Y5BA 5A24A 4QRGA 3CBKA 1QXPA 2AYOA 2QICA 2LXHC 4UP5A 2YJ8A 2B1MA 3BC3A 2XU4A 2E03A 1AU4A 2DC6A 3KSEA 2FYEA 1VJVA 2ZETC 1F62A 2AUZA 3GV4A 4YYSA 4IC2A 2ECGA 4X6IA 1WEMA 2MA5A 2PREA 4N4FA 9PAPA 2ECNA 1MS6A 4AP4A 4YABA 3RTRB 2MNZA 3HHAA 2G6QA 4CDDB 2R9MA 1WILA 3OVZA 1WEUA 1KXRA 4GB0A 2VHFA 4BHWA 1ITOA 1PE6A 3ZVZB 3OVXA 1KHPA 4BSQA 4YYVA 2VJFA 2ECWA 3O36A 2IDAA 4YV8A 4I7BA 2LN0A 2CB5A 3KKUA 1CPJA 4LJNA 1G25A 3LQJA 5DINA 3PW3A 2YHNA 4K7CA 4LKAA 3P5WA 2KWKA 2EGPA 2XU1A 2VJFB 4FK5A 1X9YA 3KFQA 2MIQA 2HYED 1KHQA 5LKUA 2FUDA 4X6JA 2G7YA 5CHTA 2QIZA 1U9VA 2XU5A 1VYXA 3U5MA 3IUTA 2PADA 5C13A 1LDJB 2LDRA 5AIUA 1JM7B 2RI7A 2VP7A 4AYCA 4DMXA 2P0RA 1U6GB 3AI8A 4QBBA 1WEOA 2ECIA 2WBFX 1QMYA 1ZIVA 3MTNA 2YREA 1DEUA 3QT4A 2VJEB 2OXQC 4Q8HA 1BP4A 3D6SA 3T7LA 2Y1NA 1MIRA 2F7DA 2YJ9A 4YYWA 2CSYA 4N4ZA 1YK8A 4MSXA 2PUYA 2FO5A 5B77A 1X4JA 5B8DA 1NQCA 2DCCA 2DCDA 2ECJA 3ASLA 4V3LC 1EWOA 2DJGB 3NHEA 3N9LA 1PPPA 2L75A 2MD8C 3HWNA 3N9PA 1WESA 4MZSA 1PIPA 3U5OA 1MM3A 1NLJA 2MA6A 1X4IA 1LDKC 2KYUA 1PADA 2C0YA 3QZVA 1K3BB 3HHIA 4KLBA 2JMJA 1WENA 2KIZA 2CSZA 2M3HA 1SNKA 3H6SA 3P5UA 4YVAA 2L80A 2LV9A 2PNXA 2C2VS 3ZVYA 3V6CA 2F6JA 5B78A 1DVPA 3C9EA 2AS8A 3WXEA 1SP4B 1JOCA 3H7DA 2KGIA 7PCKA 2KWJA 3KV6A 3PUQA 4YBMA 4BQVA 2AN6A 3H8BA 3O1GA 5EF4A 2VPDA 3I06A 1U9QX 1PPDA 2H7JA 3N4CA 2LGVA 3LQHA 3O37A 5G04B 1U5IA 1ZCMA 1JQPA 1KFUL 1PCIA 1ATKA 3IEJA 1MEGA 2L5UA 3U5NA 1AECA 2BAYA 4XUIA 5H1TA 3N3KA 2H0DB 4QF3A 4BS6A 4L58A 4YYRA 4BBQA 2YSJA 1BY8A 2GHUA 3RVWA 2BDZA 2KFTA 4W5CA 4R7EA 2QJ0A 3KX1A 3N9NA
chains in the Genus database with same CATH superfamily
1AYUA 2AVWA 2KKYA 2DSMA 1YZBA 2M85A 3PLWA 4FJCA 3JUEA 4B7YC 4MI7A 5TDRA 3BCNA 4CDCB 4QRXA 2NQAA 2IBIA 4S3OC 5AITA 2DJAA 3ZTGA 4CZWA 4YBTA 1PBHA 2B0OE 2C2LA 4Q6FA 1MHWA 2Y6EA 3BOWA 3KDEC 5B76A 3U8EA 3OISA 4OVZA 2MT5A 3CH3X 5D1MB 2XB1A 2AU1A 1AU2A 1VD4A 2DZZA 2O6XA 2DJFB 1AYWA 4PPEA 1F2AA 4I05A 5LCWB 2YQMA 1CB5A 4CCGX 1YVBA 3F75A 3P5VA 2DCAA 2R9FA 5KH9A 2DC9A 4HWYA 2YJCA 2FRAA 4OVZB 1ME4A 1V87A 2M13A 4N79A 3FM8C 2CKLA 5TDWA 3SOXA 5C11A 2JRIA 2PBHA 3PBHA 4OGEA 3M7KA 4CDEB 2MUMA 4ZUXU 2M6MA 1HYJA 5I3LA 3I3TA 2JUNA 1GMYA 1DCQA 4O62A 2AUXA 4P16A 3OQCA 2DC8A 2DOSA 3KWZA 2YYRA 5CVNB 2K16A 3EB6A 1T1HA 1YK7A 1WE9A 1CV8A 3S3QA 2D8SA 1WEVA 2YJ2A 3KV5A 4IC3A 3HTKC 3O35A 4X6HA 1BORA 4PI3A 2IQJA 5SVXA 2G8EA 2JMDA 2OZ2A 1IWDA 4AXLA 3M62A 4M0WA 3L1XA 2XP0A 1YT7A 2R9OA 3DF0A 3WXFA 2GFOA 4AYCB 2JQGR 3USVA 1WEQA 3MP2A 5FERA 2AIMA 2NQGA 5H1UA 3MORA 4W5BA 2YJBA 1NPZA 2RR4A 1E4UA 2E6SA 2F1GA 4I7DA 5KH3A 2DCBA 2ARYA 2JQFR 2LGGA 1WEWA 2XU3A 5J94A 3SOUA 3BPFA 4ZTBA 4A4BA 4N3WA 4V3KC 3RVXA 1CJLA 2E01A 3HCSA 5DKAA 4MM3B 1NL6A 3IMAA 2R6NA 4I07A 2NQDB 4Q8GA 3N3GA 5K16A 4D8IA 4NN2A 2P57A 1KFXL 1VSNA 4P6GA 2MNYA 4D8EA 2FRQA 4C9ZA 4RF1A 4S3OB 2DX8A 3PSEA 4L7XA 3EB5A 2MKEA 3LVQE 4MVTA 4ZDTA 2KGGA 3ZYQA 1QDQA 2EA6A 3NG2A 4WURA 2G45A 1K2FA 3OF9A 2FUIA 1CTEA 3QJ3A 2VPGA 5SVIA 5H9MA 3FL2A 1PXVA 3O65A 1AU3A 4YYUA 5KH7A 1PVJA 1AYVA 1MM2A 2I50A 4WA6A 1ZBDB 5K3QA 3KWBX 4GNDA 5EZQA 5FB1A 5TRBA 4PTBA 3RPGC 4R8PK 1IYMA 1MDWA 4LLBA 2ECTA 2BDLA 2CIOA 2AGAA 2HHNA 3IHPA 1F2BA 2OP3A 2JM3A 2ECVA 1CQDA 2XEUA 2NQIA 4AXMA 2BTWA 3IOQA 4G54A 3SHBA 2JMIA 1TU6A 1YALA 4I7CA 2Y43A 3C6WA 1STFE 3DDTA 1S4VA 4D8BA 3M99A 4WZ3B 2MD7B 3U5PA 5EZSA 4A5UA 3FEHA 4RKXA 3CH2X 1POPA 3KQIA 2R9CA 1RMDA 4I04A 2PNSA 3PURA 3N9MA 1EWPA 2VHSA 3L1ZB 2E6RA 5E6JA 4OEMA 6PADA 4R3DA 1AIMA 2YSMA 5FB0A 2LRIC 5G05B 4A49A 4BOSA 4BOUA 1WFKA 4AVXA 1ICFA 2Y1MA 1PPOA 3BY4A 3E1ZB 4BS5A 4A4CA 3V6EA 2G43A 4QH6A 5FPWA 2F6NA 2HH5A 3BBAA 1DKIA 3BPMA 4O64A 5FEYA 5LKTA 1GCBA 2LGLA 4PADA 3RVVA 2E61A 2XOZA 3MJ5A 1Q6KA 3H8CA 4YADA 3K24A 3PDFA 2ACTA 4P6EA 5CHVA 4QF2A 1N87A 3F5VA 1TLOA 4FO9A 2B1NA 4OGCA 1EWMA 2LGKA 3ZPVE 1MEMA 3PHDA 5D1KB 1CHCA 1DF0A 1GECE 3W30A 2HDPA 2IPPB 2CKLB 3O70A 2YU4A 3GL6A 2KU3A 3LXSA 4XR7A 1NB3A 2HD5A 3QSDA 3MHHA 5LKZA 3BWKA 2F42A 4PT5A 1VFYA 3ZUAA 2E02A 4FIPA 3O34A 3KW9A 1Y4HA 3C5KA 1NB5A 3PRPA 4F52B 1JM7A 2KKXA 3RPGB 1FBVA 4RY2A 4N8WA 5TBNA 2OWAA 4WZ2A 4CA1A 1ME3A 2YVRA 5CVMA 2L7PA 3SOWA 1F29A 4IUMA 5EYAF 1GLOA 1TL9A 2FT2A 2RSDA 4UI9B 1WEPA 1CVZA 1X4UA 4XI1A 1Y08A 4BOZA 4YBSA 2VPBA 4PP1A 5H1VA 3HCUA 1EF7A 3VK6A 3LJUX 2FQ9A 3PHXA 1QOLA 5JH3A 2AYNA 1XKGA 1AU0A 4R2YA 2VJEA 3LDYA 2FE8A 4RF0A 3N9QA 3HD3A 4LADB 3O33A 4A0CD 3L11A 8PCHA 4QRVA 2KR4A 4LK9A 2KE1A 4X3GA 1U9WA 4OELA 3GCBA 2G6DA 3E9SA 2CRWA 2FUUA 1THEA 5EGWA 2NAAA 3WXGA 4CDFB 4YYQA 3ERVA 2DC7A 1HUCB 4P5OB 2EODA 4IP3A 3N9OA 5B79A 2OULA 2M1RA 4GNGA 2KWOA 4UP0A 3PHWA 2VPEA 2R9NA 3TRKA 1FP0A 3DQVR 3HCTA 3ZNIA 2DZYA 5F02A 3P5XA 1O0EA 3T6RA 3O47A 5LKXA 4DMYA 5PADA 2JTCA 3BB7A 3CBJA 1EWLA 3MDBC 2K17A 2L0BA 3OF8A 1WGMA 3ZPV1 4ZQLA 3S3RA 5KO3A 4AUQB 1WIMA 2E00A 3TNXA 2CT2A 2K4DA 1BQIA 4BPVA 1A6RA 1M6DA 1Z60A 4B86C 2LQ6A 3M63A 2YUCA 3ZNHA 2YT5A 5SVIB 3PNRA 3H89A 4WZ0A 1CS8A 2L43A 1Z6UA 1Z2QA 2LAUA 5J3XA 3PHUA 4YATA 2HWKA 2UZGA 5JG6A 2EXUA 3PT2A 5TABA 2YQLA 2FTDA 2YHOA 5D1LB 1PPNA 4W4UA 4H9DA 4BOQA 1WEEA 1F2CA 4TKPB 4RNAA 5B75A 2J7QC 3DPLR 2G8JA 3LFYA 2H0DA 1FH0A 1HYIA 2BTWB 2KWNA 3K8UA 5CVOB 5SVYA 4QQ4A 1U9XA 2ATOA 1XWHA 2VNFA 2P7UA 3IV2A 3LRQA 4GNFA 4PP2E 2FSAA 4OW0A 1CSBB 3B79A 2YW8A 3FAOA 4YAXA 3O0UA 3IFUA 4GNEA 2P86A 2JRJA 2YURA 2LXPC 3LQIA 5G0FA 1BGOA 3O7AA 3V43A 2HXZA 2Z84A 5JA7A 3I2DA 3MHSA 4YC9A 4MZOA 2K1JA 2KREA 3KNVA 3K9MA 2Y5BA 5A24A 4QRGA 2CSVA 3CBKA 1MBMA 1QXPA 2QICA 2LXHC 4UP5A 2AYOA 2B1MA 2YJ8A 3BC3A 2XU4A 2E03A 1AU4A 2DC6A 3KSEA 2FYEA 4F1PA 1VJVA 2ZETC 1F62A 2AUZA 3GV4A 4YYSA 4IC2A 2ECGA 4X6IA 1WEMA 2MA5A 2FD4A 2PREA 4N4FA 9PAPA 2ECNA 1MS6A 4AP4A 4YABA 3RTRB 2MNZA 1UKFA 3HHAA 2G6QA 4CDDB 2R9MA 1WILA 3Q1DA 3OVZA 1WEUA 1KXRA 4GB0A 2VHFA 4BHWA 1ITOA 2CONA 1PE6A 3FANA 3ZVZB 3DWDA 3OVXA 1KHPA 4BSQA 4YYVA 2VJFA 2ECWA 3O36A 2EGMA 2IDAA 4YV8A 2XOCA 4I7BA 2LN0A 2CB5A 3KKUA 1CPJA 4LJNA 3H7HA 1G25A 3LQJA 5DINA 3PW3A 2YHNA 4K7CA 4LKAA 3P5WA 2KWKA 2EGPA 3FJUB 2XU1A 2VJFB 4FK5A 1X9YA 3KFQA 2MIQA 2HYED 1KHQA 5LKUA 2FUDA 4X6JA 3LVRE 3SUBA 2G7YA 5CHTA 2QIZA 2J7QA 1U9VA 2XU5A 1VYXA 3U5MA 3IUTA 2PADA 5C13A 1LDJB 2LDRA 5AIUA 1JM7B 2RI7A 2VP7A 4Z0OA 4AYCA 4DMXA 2P0RA 1U6GB 3AI8A 4QBBA 5JZEA 1WEOA 2ECIA 2WBFX 1QMYA 1ZIVA 3MTNA 2YREA 1DEUA 3QT4A 2FFWA 2VJEB 2OXQC 4Q8HA 1BP4A 3D6SA 3T7LA 2Y1NA 1MIRA 2F7DA 2YJ9A 4YYWA 2CSYA 4N4ZA 1YK8A 4MSXA 2PUYA 2FO5A 5B77A 3W31A 1X4JA 5B8DA 2D8UA 1NQCA 2DCCA 2DCDA 2ECJA 3ASLA 4V3LC 1EWOA 2DJGB 3NHEA 3N9LA 1PPPA 3MTVA 2L75A 2MD8C 3HWNA 3N9PA 1WESA 4MZSA 1PIPA 3U5OA 1MM3A 1NLJA 2MA6A 1X4IA 1LDKC 2KYUA 1PADA 2C0YA 3QZVA 1K3BB 3HHIA 4KLBA 2JMJA 1WENA 2XOYA 3PRMA 2KIZA 2CSZA 2M3HA 1SNKA 3H6SA 3P5UA 4YVAA 4HXDB 2L80A 2LV9A 2UZJA 2PNXA 2C2VS 3ZVYA 3V6CA 2F6JA 5B78A 1DVPA 3C9EA 2AS8A 3WXEA 1SP4B 1JOCA 3H7DA 2KGIA 3C0RA 2KWJA 3KV6A 4REZA 7PCKA 3PUQA 4YBMA 4BQVA 2AN6A 3RNVA 3H8BA 3O1GA 4XZXA 2VPDA 5EF4A 3I06A 1U9QX 1PPDA 2H7JA 3N4CA 2BU3A 2LGVA 3LQHA 3O37A 2CRRA 5G04B 1U5IA 1ZCMA 1JQPA 1KFUL 1PCIA 1ATKA 4BOPA 3IEJA 1MEGA 2L5UA 3U5NA 3T9KA 1AECA 2BAYA 3B21A 4GUAA 4XUIA 5H1TA 4Z0RA 3N3KA 2H0DB 4QF3A 3E2DA 4BS6A 4L58A 4YYRA 3TMPA 4BBQA 2YSJA 1BY8A 2GHUA 3RVWA 2BDZA 2KFTA 4W5CA 4R7EA 2QJ0A 3KX1A 3N9NA
chains in the Genus database with same CATH topology
1AYUA 2AVWA 2M85A 4FJCA 4B7YC 5TDRA 3BCNA 4CDCB 4QRXA 2NQAA 2IBIA 4S3OC 5AITA 3ZTGA 4CZWA 4YBTA 1PBHA 2C2LA 4Q6FA 2Y6EA 1MHWA 3BOWA 3U8EA 5B76A 3OISA 2MT5A 3CH3X 5D1MB 2XB1A 2AU1A 1AU2A 1VD4A 2DZZA 2O6XA 2DJFB 1AYWA 4PPEA 1F2AA 4I05A 5LCWB 2YQMA 1CB5A 4CCGX 1YVBA 3F75A 3P5VA 2DCAA 2R9FA 5KH9A 2DC9A 4HWYA 2YJCA 2FRAA 1ME4A 1V87A 4N79A 3SOXA 2CKLA 5TDWA 5C11A 2PBHA 4CDEB 3PBHA 2MUMA 4ZUXU 2M6MA 1HYJA 5I3LA 3I3TA 1GMYA 2AUXA 2DC8A 3KWZA 2VFBA 2YYRA 5CVNB 2K16A 3EB6A 1T1HA 1YK7A 1WE9A 1CV8A 3S3QA 2D8SA 1WEVA 2YJ2A 3KV5A 4IC3A 3HTKC 3O35A 4X6HA 1BORA 4PI3A 2G8EA 2JMDA 2OZ2A 1IWDA 4AXLA 3M62A 3L1XA 1YT7A 2R9OA 3DF0A 3WXFA 2GFOA 4AYCB 2JQGR 3USVA 1WEQA 5FERA 2AIMA 2NQGA 5H1UA 3MORA 4W5BA 2YJBA 1NPZA 1E4UA 2E6SA 2F1GA 4I7DA 5KH3A 2DCBA 2ARYA 2JQFR 2LGGA 1WEWA 2XU3A 5J94A 3SOUA 3BPFA 4A4BA 4N3WA 4V3KC 3RVXA 1CJLA 2E01A 3HCSA 5DKAA 1NL6A 3IMAA 2R6NA 4I07A 2NQDB 4Q8GA 3N3GA 5K16A 4NN2A 1KFXL 1VSNA 4P6GA 2MNYA 2FRQA 4C9ZA 4S3OB 2DX8A 4L7XA 3EB5A 4MVTA 4ZDTA 2KGGA 3ZYQA 1QDQA 2EA6A 3NG2A 2G45A 1K2FA 3OF9A 2FUIA 1CTEA 3QJ3A 2VPGA 5H9MA 3FL2A 1PXVA 1AU3A 4YYUA 5KH7A 1AYVA 1MM2A 2I50A 4WA6A 1ZBDB 3KWBX 4GNDA 5FB1A 5TRBA 4PTBA 3RPGC 4R8PK 1IYMA 1MDWA 4LLBA 2ECTA 2BDLA 2CIOA 2HHNA 2OP3A 3IHPA 1F2BA 2ECVA 1CQDA 3LTWA 2XEUA 2NQIA 4AXMA 3IOQA 4G54A 3SHBA 2JMIA 1TU6A 1YALA 4I7CA 2Y43A 3C6WA 1STFE 1S4VA 3M99A 4WZ3B 2MD7B 3U5PA 3CH2X 1POPA 3KQIA 2R9CA 1GX3A 1RMDA 4I04A 2PNSA 3PURA 3N9MA 1EWPA 2VHSA 3L1ZB 2E6RA 4OEMA 6PADA 1AIMA 2YSMA 5FB0A 2LRIC 5G05B 4A49A 1WFKA 4AVXA 1ICFA 2Y1MA 1PPOA 3E1ZB 4BS5A 4A4CA 3V6EA 4NV8A 2G43A 4QH6A 4NV7A 5FPWA 2F6NA 2HH5A 3BPMA 4O64A 5FEYA 5LKTA 1GCBA 2LGLA 4PADA 3RVVA 1Q6KA 3H8CA 4YADA 3K24A 3PDFA 2ACTA 4P6EA 5CHVA 4QF2A 1N87A 3F5VA 1TLOA 4FO9A 2B1NA 1EWMA 2LGKA 3ZPVE 1MEMA 3PHDA 5D1KB 1CHCA 1DF0A 1GECE 2HDPA 2IPPB 2CKLB 3O70A 2YU4A 3GL6A 2KU3A 3LXSA 4XR7A 1NB3A 2HD5A 3QSDA 3MHHA 5LKZA 3BWKA 2F42A 1VFYA 3ZUAA 2E02A 4FIPA 1E2TA 3O34A 3KW9A 1Y4HA 3C5KA 1NB5A 4F52B 1JM7A 3RPGB 1FBVA 4RY2A 4N8WA 5TBNA 4WZ2A 4CA1A 1ME3A 5CVMA 1F29A 3SOWA 5EYAF 1GLOA 1TL9A 2FT2A 2RSDA 4UI9B 1WEPA 1CVZA 1X4UA 4XI1A 1Y08A 4YBSA 2VPBA 4PP1A 5H1VA 3HCUA 1EF7A 3VK6A 2FQ9A 1QOLA 4B55A 5JH3A 2AYNA 1XKGA 1AU0A 4R2YA 2VJEA 3N9QA 3HD3A 4LADB 3O33A 4A0CD 3L11A 8PCHA 4QRVA 2KR4A 4LK9A 2KE1A 4X3GA 1U9WA 4OELA 3GCBA 2G6DA 2FUUA 1THEA 5EGWA 2NAAA 3WXGA 4CDFB 4YYQA 3ERVA 2DC7A 1HUCB 4P5OB 2EODA 3N9OA 5B79A 2OULA 2M1RA 4GNGA 2KWOA 4UP0A 2VPEA 2R9NA 1FP0A 3DQVR 3HCTA 3ZNIA 2DZYA 5F02A 3P5XA 1O0EA 3T6RA 5LKXA 4DMYA 5PADA 3CBJA 1EWLA 2K17A 2L0BA 3OF8A 1W5RA 1WGMA 3ZPV1 4ZQLA 3S3RA 4AUQB 1WIMA 2E00A 3TNXA 2CT2A 2K4DA 1BQIA 4BPVA 1A6RA 1M6DA 1Z60A 2VFCA 4B86C 2LQ6A 3M63A 2YUCA 2YT5A 3PNRA 3H89A 4WZ0A 1CS8A 2L43A 1Z6UA 1Z2QA 5J3XA 4YATA 2BSZA 2UZGA 5JG6A 5TABA 2YQLA 2FTDA 2YHOA 5D1LB 1PPNA 4W4UA 1WEEA 1F2CA 4TKPB 1W6FA 5B75A 3DPLR 2G8JA 3LFYA 2H0DA 1FH0A 1HYIA 2KWNA 3K8UA 5CVOB 1U9XA 2ATOA 1XWHA 4C5PA 2VNFA 2P7UA 3IV2A 3LRQA 4GNFA 4PP2E 2FSAA 1CSBB 3B79A 2YW8A 4YAXA 3O0UA 4GNEA 2P86A 2JRJA 2YURA 2LXPC 3LQIA 5G0FA 1BGOA 3O7AA 3V43A 2HXZA 5JA7A 3I2DA 3MHSA 4YC9A 4MZOA 2K1JA 2KREA 3KNVA 3K9MA 2Y5BA 5A24A 4QRGA 3CBKA 1QXPA 2AYOA 2QICA 2LXHC 4UP5A 2YJ8A 2B1MA 3BC3A 2XU4A 2E03A 1AU4A 2DC6A 3KSEA 2FYEA 1VJVA 2ZETC 1F62A 2AUZA 3GV4A 4YYSA 4IC2A 2ECGA 4X6IA 1WEMA 2MA5A 2PREA 4N4FA 9PAPA 2ECNA 1MS6A 4AP4A 4YABA 3RTRB 2MNZA 3HHAA 2G6QA 4CDDB 2R9MA 1WILA 3OVZA 1WEUA 1KXRA 4GB0A 2VHFA 4BHWA 1ITOA 1PE6A 3ZVZB 3OVXA 1KHPA 4BSQA 4YYVA 2VJFA 2ECWA 3O36A 2IDAA 4YV8A 4I7BA 2LN0A 2CB5A 3KKUA 1CPJA 4LJNA 1G25A 3LQJA 5DINA 3PW3A 2YHNA 4K7CA 4LKAA 3P5WA 2KWKA 2EGPA 2XU1A 2VJFB 4FK5A 1X9YA 3KFQA 2MIQA 2HYED 1KHQA 5LKUA 2FUDA 4X6JA 2G7YA 5CHTA 2QIZA 1U9VA 2XU5A 1VYXA 3U5MA 3IUTA 2PADA 5C13A 1LDJB 2LDRA 5AIUA 1JM7B 2RI7A 2VP7A 4AYCA 4DMXA 2P0RA 1U6GB 3AI8A 4QBBA 1WEOA 4BGFA 2ECIA 2WBFX 1QMYA 1ZIVA 3MTNA 2YREA 1DEUA 3QT4A 2VJEB 2OXQC 4Q8HA 1BP4A 3D6SA 3T7LA 2Y1NA 1MIRA 2F7DA 2YJ9A 4YYWA 2CSYA 4N4ZA 1YK8A 4MSXA 2PUYA 2FO5A 5B77A 1X4JA 5B8DA 1NQCA 2DCCA 4GUZA 2DCDA 2ECJA 3ASLA 4V3LC 1EWOA 2DJGB 3NHEA 3N9LA 1PPPA 2L75A 2MD8C 3HWNA 3N9PA 1WESA 4MZSA 1PIPA 3U5OA 1MM3A 1NLJA 2MA6A 1X4IA 1LDKC 2KYUA 1PADA 2C0YA 3QZVA 1K3BB 3HHIA 4KLBA 2JMJA 1WENA 1W4TA 2KIZA 2CSZA 2M3HA 1SNKA 3H6SA 3P5UA 4YVAA 2L80A 2LV9A 2PNXA 2C2VS 3ZVYA 3V6CA 2F6JA 5B78A 1DVPA 3C9EA 2AS8A 3WXEA 1SP4B 1JOCA 3H7DA 2KGIA 7PCKA 2KWJA 3KV6A 3PUQA 4YBMA 4BQVA 2AN6A 3H8BA 3O1GA 5EF4A 2VPDA 3D9WA 3I06A 1U9QX 1PPDA 2H7JA 3N4CA 2LGVA 3LQHA 3O37A 5G04B 1U5IA 1ZCMA 1JQPA 1KFUL 1PCIA 1ATKA 3IEJA 1MEGA 2L5UA 3U5NA 1AECA 2BAYA 4XUIA 5H1TA 3N3KA 2H0DB 4QF3A 4BS6A 4L58A 4YYRA 4BBQA 2YSJA 1BY8A 2GHUA 3RVWA 2BDZA 2KFTA 4W5CA 4R7EA 2QJ0A 3KX1A 3N9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AYU A;  2AVW A;  2M85 A;  4FJC A;  4B7Y C;  5TDR A;  3BCN A;  4CDC B;  4QRX A;  2NQA A;  2IBI A;  4S3O C;  5AIT A;  3ZTG A;  4CZW A;  4YBT A;  1PBH A;  2C2L A;  4Q6F A;  2Y6E A;  1MHW A;  3BOW A;  3U8E A;  5B76 A;  3OIS A;  2MT5 A;  3CH3 X;  5D1M B;  2XB1 A;  2AU1 A;  1AU2 A;  1VD4 A;  2DZZ A;  2O6X A;  2DJF B;  1AYW A;  4PPE A;  1F2A A;  4I05 A;  5LCW B;  2YQM A;  1CB5 A;  4CCG X;  1YVB A;  3F75 A;  3P5V A;  2DCA A;  2R9F A;  5KH9 A;  2DC9 A;  4HWY A;  2YJC A;  2FRA A;  1ME4 A;  1V87 A;  4N79 A;  3SOX A;  2CKL A;  5TDW A;  5C11 A;  2PBH A;  4CDE B;  3PBH A;  2MUM A;  4ZUX U;  2M6M A;  1HYJ A;  5I3L A;  3I3T A;  1GMY A;  2AUX A;  2DC8 A;  3KWZ A;  2YYR A;  5CVN B;  2K16 A;  3EB6 A;  1T1H A;  1YK7 A;  1WE9 A;  1CV8 A;  3S3Q A;  2D8S A;  1WEV A;  2YJ2 A;  3KV5 A;  4IC3 A;  3HTK C;  3O35 A;  4X6H A;  1BOR A;  4PI3 A;  2G8E A;  2JMD A;  2OZ2 A;  1IWD A;  4AXL A;  3M62 A;  3L1X A;  1YT7 A;  2R9O A;  3DF0 A;  3WXF A;  2GFO A;  4AYC B;  2JQG R;  3USV A;  1WEQ A;  5FER A;  2AIM A;  2NQG A;  5H1U A;  3MOR A;  4W5B A;  2YJB A;  1NPZ A;  1E4U A;  2E6S A;  2F1G A;  4I7D A;  5KH3 A;  2DCB A;  2ARY A;  2JQF R;  2LGG A;  1WEW A;  2XU3 A;  5J94 A;  3SOU A;  3BPF A;  4A4B A;  4N3W A;  4V3K C;  3RVX A;  1CJL A;  2E01 A;  3HCS A;  5DKA A;  1NL6 A;  3IMA A;  2R6N A;  4I07 A;  2NQD B;  4Q8G A;  3N3G A;  5K16 A;  4NN2 A;  1KFX L;  1VSN A;  4P6G A;  2MNY A;  2FRQ A;  4C9Z A;  4S3O B;  2DX8 A;  4L7X A;  3EB5 A;  4MVT A;  4ZDT A;  2KGG A;  3ZYQ A;  1QDQ A;  2EA6 A;  3NG2 A;  2G45 A;  1K2F A;  3OF9 A;  2FUI A;  1CTE A;  3QJ3 A;  2VPG A;  5H9M A;  3FL2 A;  1PXV A;  1AU3 A;  4YYU A;  5KH7 A;  1AYV A;  1MM2 A;  2I50 A;  4WA6 A;  1ZBD B;  3KWB X;  4GND A;  5FB1 A;  5TRB A;  4PTB A;  3RPG C;  4R8P K;  1IYM A;  1MDW A;  4LLB A;  2ECT A;  2BDL A;  2CIO A;  2HHN A;  2OP3 A;  3IHP A;  1F2B A;  2ECV A;  1CQD A;  2XEU A;  2NQI A;  4AXM A;  3IOQ A;  4G54 A;  3SHB A;  2JMI A;  1TU6 A;  1YAL A;  4I7C A;  2Y43 A;  3C6W A;  1STF E;  1S4V A;  3M99 A;  4WZ3 B;  2MD7 B;  3U5P A;  3CH2 X;  1POP A;  3KQI A;  2R9C A;  1RMD A;  4I04 A;  2PNS A;  3PUR A;  3N9M A;  1EWP A;  2VHS A;  3L1Z B;  2E6R A;  4OEM A;  6PAD A;  1AIM A;  2YSM A;  5FB0 A;  2LRI C;  5G05 B;  4A49 A;  1WFK A;  4AVX A;  1ICF A;  2Y1M A;  1PPO A;  3E1Z B;  4BS5 A;  4A4C A;  3V6E A;  2G43 A;  4QH6 A;  5FPW A;  2F6N A;  2HH5 A;  3BPM A;  4O64 A;  5FEY A;  5LKT A;  1GCB A;  2LGL A;  4PAD A;  3RVV A;  1Q6K A;  3H8C A;  4YAD A;  3K24 A;  3PDF A;  2ACT A;  4P6E A;  5CHV A;  4QF2 A;  1N87 A;  3F5V A;  1TLO A;  4FO9 A;  2B1N A;  1EWM A;  2LGK A;  3ZPV E;  1MEM A;  3PHD A;  5D1K B;  1CHC A;  1DF0 A;  1GEC E;  2HDP A;  2IPP B;  2CKL B;  3O70 A;  2YU4 A;  3GL6 A;  2KU3 A;  3LXS A;  4XR7 A;  1NB3 A;  2HD5 A;  3QSD A;  3MHH A;  5LKZ A;  3BWK A;  2F42 A;  1VFY A;  3ZUA A;  2E02 A;  4FIP A;  3O34 A;  3KW9 A;  1Y4H A;  3C5K A;  1NB5 A;  4F52 B;  1JM7 A;  3RPG B;  1FBV A;  4RY2 A;  4N8W A;  5TBN A;  4WZ2 A;  4CA1 A;  1ME3 A;  5CVM A;  1F29 A;  3SOW A;  5EYA F;  1GLO A;  1TL9 A;  2FT2 A;  2RSD A;  4UI9 B;  1WEP A;  1CVZ A;  1X4U A;  4XI1 A;  1Y08 A;  4YBS A;  2VPB A;  4PP1 A;  5H1V A;  3HCU A;  1EF7 A;  3VK6 A;  2FQ9 A;  1QOL A;  5JH3 A;  2AYN A;  1XKG A;  1AU0 A;  4R2Y A;  2VJE A;  3N9Q A;  3HD3 A;  4LAD B;  3O33 A;  4A0C D;  3L11 A;  8PCH A;  4QRV A;  2KR4 A;  4LK9 A;  2KE1 A;  4X3G A;  1U9W A;  4OEL A;  3GCB A;  2G6D A;  2FUU A;  1THE A;  5EGW A;  2NAA A;  3WXG A;  4CDF B;  4YYQ A;  3ERV A;  2DC7 A;  1HUC B;  4P5O B;  2EOD A;  3N9O A;  5B79 A;  2OUL A;  2M1R A;  4GNG A;  2KWO A;  4UP0 A;  2VPE A;  2R9N A;  1FP0 A;  3DQV R;  3HCT A;  3ZNI A;  2DZY A;  5F02 A;  3P5X A;  1O0E A;  3T6R A;  5LKX A;  4DMY A;  5PAD A;  3CBJ A;  1EWL A;  2K17 A;  2L0B A;  3OF8 A;  1WGM A;  3ZPV 1;  4ZQL A;  3S3R A;  4AUQ B;  1WIM A;  2E00 A;  3TNX A;  2CT2 A;  2K4D A;  1BQI A;  4BPV A;  1A6R A;  1M6D A;  1Z60 A;  4B86 C;  2LQ6 A;  3M63 A;  2YUC A;  2YT5 A;  3PNR A;  3H89 A;  4WZ0 A;  1CS8 A;  2L43 A;  1Z6U A;  1Z2Q A;  5J3X A;  4YAT A;  2UZG A;  5JG6 A;  5TAB A;  2YQL A;  2FTD A;  2YHO A;  5D1L B;  1PPN A;  4W4U A;  1WEE A;  1F2C A;  4TKP B;  5B75 A;  3DPL R;  2G8J A;  3LFY A;  2H0D A;  1FH0 A;  1HYI A;  2KWN A;  3K8U A;  5CVO B;  1U9X A;  2ATO A;  1XWH A;  2VNF A;  2P7U A;  3IV2 A;  3LRQ A;  4GNF A;  4PP2 E;  2FSA A;  1CSB B;  3B79 A;  2YW8 A;  4YAX A;  3O0U A;  4GNE A;  2P86 A;  2JRJ A;  2YUR A;  2LXP C;  3LQI A;  5G0F A;  1BGO A;  3O7A A;  3V43 A;  2HXZ A;  5JA7 A;  3I2D A;  3MHS A;  4YC9 A;  4MZO A;  2K1J A;  2KRE A;  3KNV A;  3K9M A;  2Y5B A;  5A24 A;  4QRG A;  3CBK A;  1QXP A;  2AYO A;  2QIC A;  2LXH C;  4UP5 A;  2YJ8 A;  2B1M A;  3BC3 A;  2XU4 A;  2E03 A;  1AU4 A;  2DC6 A;  3KSE A;  2FYE A;  1VJV A;  2ZET C;  1F62 A;  2AUZ A;  3GV4 A;  4YYS A;  4IC2 A;  2ECG A;  4X6I A;  1WEM A;  2MA5 A;  2PRE A;  4N4F A;  9PAP A;  2ECN A;  1MS6 A;  4AP4 A;  4YAB A;  3RTR B;  2MNZ A;  3HHA A;  2G6Q A;  4CDD B;  2R9M A;  1WIL A;  3OVZ A;  1WEU A;  1KXR A;  4GB0 A;  2VHF A;  4BHW A;  1ITO A;  1PE6 A;  3ZVZ B;  3OVX A;  1KHP A;  4BSQ A;  4YYV A;  2VJF A;  2ECW A;  3O36 A;  2IDA A;  4YV8 A;  4I7B A;  2LN0 A;  2CB5 A;  3KKU A;  1CPJ A;  4LJN A;  1G25 A;  3LQJ A;  5DIN A;  3PW3 A;  2YHN A;  4K7C A;  4LKA A;  3P5W A;  2KWK A;  2EGP A;  2XU1 A;  2VJF B;  4FK5 A;  1X9Y A;  3KFQ A;  2MIQ A;  2HYE D;  1KHQ A;  5LKU A;  2FUD A;  4X6J A;  2G7Y A;  5CHT A;  2QIZ A;  1U9V A;  2XU5 A;  1VYX A;  3U5M A;  3IUT A;  2PAD A;  5C13 A;  1LDJ B;  2LDR A;  5AIU A;  1JM7 B;  2RI7 A;  2VP7 A;  4AYC A;  4DMX A;  2P0R A;  1U6G B;  3AI8 A;  4QBB A;  1WEO A;  2ECI A;  2WBF X;  1QMY A;  1ZIV A;  3MTN A;  2YRE A;  1DEU A;  3QT4 A;  2VJE B;  2OXQ C;  4Q8H A;  1BP4 A;  3D6S A;  3T7L A;  2Y1N A;  1MIR A;  2F7D A;  2YJ9 A;  4YYW A;  2CSY A;  4N4Z A;  1YK8 A;  4MSX A;  2PUY A;  2FO5 A;  5B77 A;  1X4J A;  5B8D A;  1NQC A;  2DCC A;  2DCD A;  2ECJ A;  3ASL A;  4V3L C;  1EWO A;  2DJG B;  3NHE A;  3N9L A;  1PPP A;  2L75 A;  2MD8 C;  3HWN A;  3N9P A;  1WES A;  4MZS A;  1PIP A;  3U5O A;  1MM3 A;  1NLJ A;  2MA6 A;  1X4I A;  1LDK C;  2KYU A;  1PAD A;  2C0Y A;  3QZV A;  1K3B B;  3HHI A;  4KLB A;  2JMJ A;  1WEN A;  2KIZ A;  2CSZ A;  2M3H A;  1SNK A;  3H6S A;  3P5U A;  4YVA A;  2L80 A;  2LV9 A;  2PNX A;  2C2V S;  3ZVY A;  3V6C A;  2F6J A;  5B78 A;  1DVP A;  3C9E A;  2AS8 A;  3WXE A;  1SP4 B;  1JOC A;  3H7D A;  2KGI A;  7PCK A;  2KWJ A;  3KV6 A;  3PUQ A;  4YBM A;  4BQV A;  2AN6 A;  3H8B A;  3O1G A;  5EF4 A;  2VPD A;  3I06 A;  1U9Q X;  1PPD A;  2H7J A;  3N4C A;  2LGV A;  3LQH A;  3O37 A;  5G04 B;  1U5I A;  1ZCM A;  1JQP A;  1KFU L;  1PCI A;  1ATK A;  3IEJ A;  1MEG A;  2L5U A;  3U5N A;  1AEC A;  2BAY A;  4XUI A;  5H1T A;  3N3K A;  2H0D B;  4QF3 A;  4BS6 A;  4L58 A;  4YYR A;  4BBQ A;  2YSJ A;  1BY8 A;  2GHU A;  3RVW A;  2BDZ A;  2KFT A;  4W5C A;  4R7E A;  2QJ0 A;  3KX1 A;  3N9N A; 
#chains in the Genus database with same CATH topology
 1AYU A;  2AVW A;  2KKY A;  2DSM A;  1YZB A;  2M85 A;  3PLW A;  4FJC A;  3JUE A;  4B7Y C;  4MI7 A;  5TDR A;  3BCN A;  4CDC B;  4QRX A;  2NQA A;  2IBI A;  4S3O C;  5AIT A;  2DJA A;  3ZTG A;  4CZW A;  4YBT A;  1PBH A;  2B0O E;  2C2L A;  4Q6F A;  1MHW A;  2Y6E A;  3BOW A;  3KDE C;  5B76 A;  3U8E A;  3OIS A;  4OVZ A;  2MT5 A;  3CH3 X;  5D1M B;  2XB1 A;  2AU1 A;  1AU2 A;  1VD4 A;  2DZZ A;  2O6X A;  2DJF B;  1AYW A;  4PPE A;  1F2A A;  4I05 A;  5LCW B;  2YQM A;  1CB5 A;  4CCG X;  1YVB A;  3F75 A;  3P5V A;  2DCA A;  2R9F A;  5KH9 A;  2DC9 A;  4HWY A;  2YJC A;  2FRA A;  4OVZ B;  1ME4 A;  1V87 A;  2M13 A;  4N79 A;  3FM8 C;  2CKL A;  5TDW A;  3SOX A;  5C11 A;  2JRI A;  2PBH A;  3PBH A;  4OGE A;  3M7K A;  4CDE B;  2MUM A;  4ZUX U;  2M6M A;  1HYJ A;  5I3L A;  3I3T A;  2JUN A;  1GMY A;  1DCQ A;  4O62 A;  2AUX A;  4P16 A;  3OQC A;  2DC8 A;  2DOS A;  3KWZ A;  2YYR A;  5CVN B;  2K16 A;  3EB6 A;  1T1H A;  1YK7 A;  1WE9 A;  1CV8 A;  3S3Q A;  2D8S A;  1WEV A;  2YJ2 A;  3KV5 A;  4IC3 A;  3HTK C;  3O35 A;  4X6H A;  1BOR A;  4PI3 A;  2IQJ A;  5SVX A;  2G8E A;  2JMD A;  2OZ2 A;  1IWD A;  4AXL A;  3M62 A;  4M0W A;  3L1X A;  2XP0 A;  1YT7 A;  2R9O A;  3DF0 A;  3WXF A;  2GFO A;  4AYC B;  2JQG R;  3USV A;  1WEQ A;  3MP2 A;  5FER A;  2AIM A;  2NQG A;  5H1U A;  3MOR A;  4W5B A;  2YJB A;  1NPZ A;  2RR4 A;  1E4U A;  2E6S A;  2F1G A;  4I7D A;  5KH3 A;  2DCB A;  2ARY A;  2JQF R;  2LGG A;  1WEW A;  2XU3 A;  5J94 A;  3SOU A;  3BPF A;  4ZTB A;  4A4B A;  4N3W A;  4V3K C;  3RVX A;  1CJL A;  2E01 A;  3HCS A;  5DKA A;  4MM3 B;  1NL6 A;  3IMA A;  2R6N A;  4I07 A;  2NQD B;  4Q8G A;  3N3G A;  5K16 A;  4D8I A;  4NN2 A;  2P57 A;  1KFX L;  1VSN A;  4P6G A;  2MNY A;  4D8E A;  2FRQ A;  4C9Z A;  4RF1 A;  4S3O B;  2DX8 A;  3PSE A;  4L7X A;  3EB5 A;  2MKE A;  3LVQ E;  4MVT A;  4ZDT A;  2KGG A;  3ZYQ A;  1QDQ A;  2EA6 A;  3NG2 A;  4WUR A;  2G45 A;  1K2F A;  3OF9 A;  2FUI A;  1CTE A;  3QJ3 A;  2VPG A;  5SVI A;  5H9M A;  3FL2 A;  1PXV A;  3O65 A;  1AU3 A;  4YYU A;  5KH7 A;  1PVJ A;  1AYV A;  1MM2 A;  2I50 A;  4WA6 A;  1ZBD B;  5K3Q A;  3KWB X;  4GND A;  5EZQ A;  5FB1 A;  5TRB A;  4PTB A;  3RPG C;  4R8P K;  1IYM A;  1MDW A;  4LLB A;  2ECT A;  2BDL A;  2CIO A;  2AGA A;  2HHN A;  3IHP A;  1F2B A;  2OP3 A;  2JM3 A;  2ECV A;  1CQD A;  2XEU A;  2NQI A;  4AXM A;  2BTW A;  3IOQ A;  4G54 A;  3SHB A;  2JMI A;  1TU6 A;  1YAL A;  4I7C A;  2Y43 A;  3C6W A;  1STF E;  3DDT A;  1S4V A;  4D8B A;  3M99 A;  4WZ3 B;  2MD7 B;  3U5P A;  5EZS A;  4A5U A;  3FEH A;  4RKX A;  3CH2 X;  1POP A;  3KQI A;  2R9C A;  1RMD A;  4I04 A;  2PNS A;  3PUR A;  3N9M A;  1EWP A;  2VHS A;  3L1Z B;  2E6R A;  5E6J A;  4OEM A;  6PAD A;  4R3D A;  1AIM A;  2YSM A;  5FB0 A;  2LRI C;  5G05 B;  4A49 A;  4BOS A;  4BOU A;  1WFK A;  4AVX A;  1ICF A;  2Y1M A;  1PPO A;  3BY4 A;  3E1Z B;  4BS5 A;  4A4C A;  3V6E A;  2G43 A;  4QH6 A;  5FPW A;  2F6N A;  2HH5 A;  3BBA A;  1DKI A;  3BPM A;  4O64 A;  5FEY A;  5LKT A;  1GCB A;  2LGL A;  4PAD A;  3RVV A;  2E61 A;  2XOZ A;  3MJ5 A;  1Q6K A;  3H8C A;  4YAD A;  3K24 A;  3PDF A;  2ACT A;  4P6E A;  5CHV A;  4QF2 A;  1N87 A;  3F5V A;  1TLO A;  4FO9 A;  2B1N A;  4OGC A;  1EWM A;  2LGK A;  3ZPV E;  1MEM A;  3PHD A;  5D1K B;  1CHC A;  1DF0 A;  1GEC E;  3W30 A;  2HDP A;  2IPP B;  2CKL B;  3O70 A;  2YU4 A;  3GL6 A;  2KU3 A;  3LXS A;  4XR7 A;  1NB3 A;  2HD5 A;  3QSD A;  3MHH A;  5LKZ A;  3BWK A;  2F42 A;  4PT5 A;  1VFY A;  3ZUA A;  2E02 A;  4FIP A;  3O34 A;  3KW9 A;  1Y4H A;  3C5K A;  1NB5 A;  3PRP A;  4F52 B;  1JM7 A;  2KKX A;  3RPG B;  1FBV A;  4RY2 A;  4N8W A;  5TBN A;  2OWA A;  4WZ2 A;  4CA1 A;  1ME3 A;  2YVR A;  5CVM A;  2L7P A;  3SOW A;  1F29 A;  4IUM A;  5EYA F;  1GLO A;  1TL9 A;  2FT2 A;  2RSD A;  4UI9 B;  1WEP A;  1CVZ A;  1X4U A;  4XI1 A;  1Y08 A;  4BOZ A;  4YBS A;  2VPB A;  4PP1 A;  5H1V A;  3HCU A;  1EF7 A;  3VK6 A;  3LJU X;  2FQ9 A;  3PHX A;  1QOL A;  5JH3 A;  2AYN A;  1XKG A;  1AU0 A;  4R2Y A;  2VJE A;  3LDY A;  2FE8 A;  4RF0 A;  3N9Q A;  3HD3 A;  4LAD B;  3O33 A;  4A0C D;  3L11 A;  8PCH A;  4QRV A;  2KR4 A;  4LK9 A;  2KE1 A;  4X3G A;  1U9W A;  4OEL A;  3GCB A;  2G6D A;  3E9S A;  2CRW A;  2FUU A;  1THE A;  5EGW A;  2NAA A;  3WXG A;  4CDF B;  4YYQ A;  3ERV A;  2DC7 A;  1HUC B;  4P5O B;  2EOD A;  4IP3 A;  3N9O A;  5B79 A;  2OUL A;  2M1R A;  4GNG A;  2KWO A;  4UP0 A;  3PHW A;  2VPE A;  2R9N A;  3TRK A;  1FP0 A;  3DQV R;  3HCT A;  3ZNI A;  2DZY A;  5F02 A;  3P5X A;  1O0E A;  3T6R A;  3O47 A;  5LKX A;  4DMY A;  5PAD A;  2JTC A;  3BB7 A;  3CBJ A;  1EWL A;  3MDB C;  2K17 A;  2L0B A;  3OF8 A;  1WGM A;  3ZPV 1;  4ZQL A;  3S3R A;  5KO3 A;  4AUQ B;  1WIM A;  2E00 A;  3TNX A;  2CT2 A;  2K4D A;  1BQI A;  4BPV A;  1A6R A;  1M6D A;  1Z60 A;  4B86 C;  2LQ6 A;  3M63 A;  2YUC A;  3ZNH A;  2YT5 A;  5SVI B;  3PNR A;  3H89 A;  4WZ0 A;  1CS8 A;  2L43 A;  1Z6U A;  1Z2Q A;  2LAU A;  5J3X A;  3PHU A;  4YAT A;  2HWK A;  2UZG A;  5JG6 A;  2EXU A;  3PT2 A;  5TAB A;  2YQL A;  2FTD A;  2YHO A;  5D1L B;  1PPN A;  4W4U A;  4H9D A;  4BOQ A;  1WEE A;  1F2C A;  4TKP B;  4RNA A;  5B75 A;  2J7Q C;  3DPL R;  2G8J A;  3LFY A;  2H0D A;  1FH0 A;  1HYI A;  2BTW B;  2KWN A;  3K8U A;  5CVO B;  5SVY A;  4QQ4 A;  1U9X A;  2ATO A;  1XWH A;  2VNF A;  2P7U A;  3IV2 A;  3LRQ A;  4GNF A;  4PP2 E;  2FSA A;  4OW0 A;  1CSB B;  3B79 A;  2YW8 A;  3FAO A;  4YAX A;  3O0U A;  3IFU A;  4GNE A;  2P86 A;  2JRJ A;  2YUR A;  2LXP C;  3LQI A;  5G0F A;  1BGO A;  3O7A A;  3V43 A;  2HXZ A;  2Z84 A;  5JA7 A;  3I2D A;  3MHS A;  4YC9 A;  4MZO A;  2K1J A;  2KRE A;  3KNV A;  3K9M A;  2Y5B A;  5A24 A;  4QRG A;  2CSV A;  3CBK A;  1MBM A;  1QXP A;  2QIC A;  2LXH C;  4UP5 A;  2AYO A;  2B1M A;  2YJ8 A;  3BC3 A;  2XU4 A;  2E03 A;  1AU4 A;  2DC6 A;  3KSE A;  2FYE A;  4F1P A;  1VJV A;  2ZET C;  1F62 A;  2AUZ A;  3GV4 A;  4YYS A;  4IC2 A;  2ECG A;  4X6I A;  1WEM A;  2MA5 A;  2FD4 A;  2PRE A;  4N4F A;  9PAP A;  2ECN A;  1MS6 A;  4AP4 A;  4YAB A;  3RTR B;  2MNZ A;  1UKF A;  3HHA A;  2G6Q A;  4CDD B;  2R9M A;  1WIL A;  3Q1D A;  3OVZ A;  1WEU A;  1KXR A;  4GB0 A;  2VHF A;  4BHW A;  1ITO A;  2CON A;  1PE6 A;  3FAN A;  3ZVZ B;  3DWD A;  3OVX A;  1KHP A;  4BSQ A;  4YYV A;  2VJF A;  2ECW A;  3O36 A;  2EGM A;  2IDA A;  4YV8 A;  2XOC A;  4I7B A;  2LN0 A;  2CB5 A;  3KKU A;  1CPJ A;  4LJN A;  3H7H A;  1G25 A;  3LQJ A;  5DIN A;  3PW3 A;  2YHN A;  4K7C A;  4LKA A;  3P5W A;  2KWK A;  2EGP A;  3FJU B;  2XU1 A;  2VJF B;  4FK5 A;  1X9Y A;  3KFQ A;  2MIQ A;  2HYE D;  1KHQ A;  5LKU A;  2FUD A;  4X6J A;  3LVR E;  3SUB A;  2G7Y A;  5CHT A;  2QIZ A;  2J7Q A;  1U9V A;  2XU5 A;  1VYX A;  3U5M A;  3IUT A;  2PAD A;  5C13 A;  1LDJ B;  2LDR A;  5AIU A;  1JM7 B;  2RI7 A;  2VP7 A;  4Z0O A;  4AYC A;  4DMX A;  2P0R A;  1U6G B;  3AI8 A;  4QBB A;  5JZE A;  1WEO A;  2ECI A;  2WBF X;  1QMY A;  1ZIV A;  3MTN A;  2YRE A;  1DEU A;  3QT4 A;  2FFW A;  2VJE B;  2OXQ C;  4Q8H A;  1BP4 A;  3D6S A;  3T7L A;  2Y1N A;  1MIR A;  2F7D A;  2YJ9 A;  4YYW A;  2CSY A;  4N4Z A;  1YK8 A;  4MSX A;  2PUY A;  2FO5 A;  5B77 A;  3W31 A;  1X4J A;  5B8D A;  2D8U A;  1NQC A;  2DCC A;  2DCD A;  2ECJ A;  3ASL A;  4V3L C;  1EWO A;  2DJG B;  3NHE A;  3N9L A;  1PPP A;  3MTV A;  2L75 A;  2MD8 C;  3HWN A;  3N9P A;  1WES A;  4MZS A;  1PIP A;  3U5O A;  1MM3 A;  1NLJ A;  2MA6 A;  1X4I A;  1LDK C;  2KYU A;  1PAD A;  2C0Y A;  3QZV A;  1K3B B;  3HHI A;  4KLB A;  2JMJ A;  1WEN A;  2XOY A;  3PRM A;  2KIZ A;  2CSZ A;  2M3H A;  1SNK A;  3H6S A;  3P5U A;  4YVA A;  4HXD B;  2L80 A;  2LV9 A;  2UZJ A;  2PNX A;  2C2V S;  3ZVY A;  3V6C A;  2F6J A;  5B78 A;  1DVP A;  3C9E A;  2AS8 A;  3WXE A;  1SP4 B;  1JOC A;  3H7D A;  2KGI A;  3C0R A;  2KWJ A;  3KV6 A;  4REZ A;  7PCK A;  3PUQ A;  4YBM A;  4BQV A;  2AN6 A;  3RNV A;  3H8B A;  3O1G A;  4XZX A;  2VPD A;  5EF4 A;  3I06 A;  1U9Q X;  1PPD A;  2H7J A;  3N4C A;  2BU3 A;  2LGV A;  3LQH A;  3O37 A;  2CRR A;  5G04 B;  1U5I A;  1ZCM A;  1JQP A;  1KFU L;  1PCI A;  1ATK A;  4BOP A;  3IEJ A;  1MEG A;  2L5U A;  3U5N A;  3T9K A;  1AEC A;  2BAY A;  3B21 A;  4GUA A;  4XUI A;  5H1T A;  4Z0R A;  3N3K A;  2H0D B;  4QF3 A;  3E2D A;  4BS6 A;  4L58 A;  4YYR A;  3TMP A;  4BBQ A;  2YSJ A;  1BY8 A;  2GHU A;  3RVW A;  2BDZ A;  2KFT A;  4W5C A;  4R7E A;  2QJ0 A;  3KX1 A;  3N9N A; 
#chains in the Genus database with same CATH homology
 1AYU A;  2AVW A;  2M85 A;  4FJC A;  4B7Y C;  5TDR A;  3BCN A;  4CDC B;  4QRX A;  2NQA A;  2IBI A;  4S3O C;  5AIT A;  3ZTG A;  4CZW A;  4YBT A;  1PBH A;  2C2L A;  4Q6F A;  2Y6E A;  1MHW A;  3BOW A;  3U8E A;  5B76 A;  3OIS A;  2MT5 A;  3CH3 X;  5D1M B;  2XB1 A;  2AU1 A;  1AU2 A;  1VD4 A;  2DZZ A;  2O6X A;  2DJF B;  1AYW A;  4PPE A;  1F2A A;  4I05 A;  5LCW B;  2YQM A;  1CB5 A;  4CCG X;  1YVB A;  3F75 A;  3P5V A;  2DCA A;  2R9F A;  5KH9 A;  2DC9 A;  4HWY A;  2YJC A;  2FRA A;  1ME4 A;  1V87 A;  4N79 A;  3SOX A;  2CKL A;  5TDW A;  5C11 A;  2PBH A;  4CDE B;  3PBH A;  2MUM A;  4ZUX U;  2M6M A;  1HYJ A;  5I3L A;  3I3T A;  1GMY A;  2AUX A;  2DC8 A;  3KWZ A;  2VFB A;  2YYR A;  5CVN B;  2K16 A;  3EB6 A;  1T1H A;  1YK7 A;  1WE9 A;  1CV8 A;  3S3Q A;  2D8S A;  1WEV A;  2YJ2 A;  3KV5 A;  4IC3 A;  3HTK C;  3O35 A;  4X6H A;  1BOR A;  4PI3 A;  2G8E A;  2JMD A;  2OZ2 A;  1IWD A;  4AXL A;  3M62 A;  3L1X A;  1YT7 A;  2R9O A;  3DF0 A;  3WXF A;  2GFO A;  4AYC B;  2JQG R;  3USV A;  1WEQ A;  5FER A;  2AIM A;  2NQG A;  5H1U A;  3MOR A;  4W5B A;  2YJB A;  1NPZ A;  1E4U A;  2E6S A;  2F1G A;  4I7D A;  5KH3 A;  2DCB A;  2ARY A;  2JQF R;  2LGG A;  1WEW A;  2XU3 A;  5J94 A;  3SOU A;  3BPF A;  4A4B A;  4N3W A;  4V3K C;  3RVX A;  1CJL A;  2E01 A;  3HCS A;  5DKA A;  1NL6 A;  3IMA A;  2R6N A;  4I07 A;  2NQD B;  4Q8G A;  3N3G A;  5K16 A;  4NN2 A;  1KFX L;  1VSN A;  4P6G A;  2MNY A;  2FRQ A;  4C9Z A;  4S3O B;  2DX8 A;  4L7X A;  3EB5 A;  4MVT A;  4ZDT A;  2KGG A;  3ZYQ A;  1QDQ A;  2EA6 A;  3NG2 A;  2G45 A;  1K2F A;  3OF9 A;  2FUI A;  1CTE A;  3QJ3 A;  2VPG A;  5H9M A;  3FL2 A;  1PXV A;  1AU3 A;  4YYU A;  5KH7 A;  1AYV A;  1MM2 A;  2I50 A;  4WA6 A;  1ZBD B;  3KWB X;  4GND A;  5FB1 A;  5TRB A;  4PTB A;  3RPG C;  4R8P K;  1IYM A;  1MDW A;  4LLB A;  2ECT A;  2BDL A;  2CIO A;  2HHN A;  2OP3 A;  3IHP A;  1F2B A;  2ECV A;  1CQD A;  3LTW A;  2XEU A;  2NQI A;  4AXM A;  3IOQ A;  4G54 A;  3SHB A;  2JMI A;  1TU6 A;  1YAL A;  4I7C A;  2Y43 A;  3C6W A;  1STF E;  1S4V A;  3M99 A;  4WZ3 B;  2MD7 B;  3U5P A;  3CH2 X;  1POP A;  3KQI A;  2R9C A;  1GX3 A;  1RMD A;  4I04 A;  2PNS A;  3PUR A;  3N9M A;  1EWP A;  2VHS A;  3L1Z B;  2E6R A;  4OEM A;  6PAD A;  1AIM A;  2YSM A;  5FB0 A;  2LRI C;  5G05 B;  4A49 A;  1WFK A;  4AVX A;  1ICF A;  2Y1M A;  1PPO A;  3E1Z B;  4BS5 A;  4A4C A;  3V6E A;  4NV8 A;  2G43 A;  4QH6 A;  4NV7 A;  5FPW A;  2F6N A;  2HH5 A;  3BPM A;  4O64 A;  5FEY A;  5LKT A;  1GCB A;  2LGL A;  4PAD A;  3RVV A;  1Q6K A;  3H8C A;  4YAD A;  3K24 A;  3PDF A;  2ACT A;  4P6E A;  5CHV A;  4QF2 A;  1N87 A;  3F5V A;  1TLO A;  4FO9 A;  2B1N A;  1EWM A;  2LGK A;  3ZPV E;  1MEM A;  3PHD A;  5D1K B;  1CHC A;  1DF0 A;  1GEC E;  2HDP A;  2IPP B;  2CKL B;  3O70 A;  2YU4 A;  3GL6 A;  2KU3 A;  3LXS A;  4XR7 A;  1NB3 A;  2HD5 A;  3QSD A;  3MHH A;  5LKZ A;  3BWK A;  2F42 A;  1VFY A;  3ZUA A;  2E02 A;  4FIP A;  1E2T A;  3O34 A;  3KW9 A;  1Y4H A;  3C5K A;  1NB5 A;  4F52 B;  1JM7 A;  3RPG B;  1FBV A;  4RY2 A;  4N8W A;  5TBN A;  4WZ2 A;  4CA1 A;  1ME3 A;  5CVM A;  1F29 A;  3SOW A;  5EYA F;  1GLO A;  1TL9 A;  2FT2 A;  2RSD A;  4UI9 B;  1WEP A;  1CVZ A;  1X4U A;  4XI1 A;  1Y08 A;  4YBS A;  2VPB A;  4PP1 A;  5H1V A;  3HCU A;  1EF7 A;  3VK6 A;  2FQ9 A;  1QOL A;  4B55 A;  5JH3 A;  2AYN A;  1XKG A;  1AU0 A;  4R2Y A;  2VJE A;  3N9Q A;  3HD3 A;  4LAD B;  3O33 A;  4A0C D;  3L11 A;  8PCH A;  4QRV A;  2KR4 A;  4LK9 A;  2KE1 A;  4X3G A;  1U9W A;  4OEL A;  3GCB A;  2G6D A;  2FUU A;  1THE A;  5EGW A;  2NAA A;  3WXG A;  4CDF B;  4YYQ A;  3ERV A;  2DC7 A;  1HUC B;  4P5O B;  2EOD A;  3N9O A;  5B79 A;  2OUL A;  2M1R A;  4GNG A;  2KWO A;  4UP0 A;  2VPE A;  2R9N A;  1FP0 A;  3DQV R;  3HCT A;  3ZNI A;  2DZY A;  5F02 A;  3P5X A;  1O0E A;  3T6R A;  5LKX A;  4DMY A;  5PAD A;  3CBJ A;  1EWL A;  2K17 A;  2L0B A;  3OF8 A;  1W5R A;  1WGM A;  3ZPV 1;  4ZQL A;  3S3R A;  4AUQ B;  1WIM A;  2E00 A;  3TNX A;  2CT2 A;  2K4D A;  1BQI A;  4BPV A;  1A6R A;  1M6D A;  1Z60 A;  2VFC A;  4B86 C;  2LQ6 A;  3M63 A;  2YUC A;  2YT5 A;  3PNR A;  3H89 A;  4WZ0 A;  1CS8 A;  2L43 A;  1Z6U A;  1Z2Q A;  5J3X A;  4YAT A;  2BSZ A;  2UZG A;  5JG6 A;  5TAB A;  2YQL A;  2FTD A;  2YHO A;  5D1L B;  1PPN A;  4W4U A;  1WEE A;  1F2C A;  4TKP B;  1W6F A;  5B75 A;  3DPL R;  2G8J A;  3LFY A;  2H0D A;  1FH0 A;  1HYI A;  2KWN A;  3K8U A;  5CVO B;  1U9X A;  2ATO A;  1XWH A;  4C5P A;  2VNF A;  2P7U A;  3IV2 A;  3LRQ A;  4GNF A;  4PP2 E;  2FSA A;  1CSB B;  3B79 A;  2YW8 A;  4YAX A;  3O0U A;  4GNE A;  2P86 A;  2JRJ A;  2YUR A;  2LXP C;  3LQI A;  5G0F A;  1BGO A;  3O7A A;  3V43 A;  2HXZ A;  5JA7 A;  3I2D A;  3MHS A;  4YC9 A;  4MZO A;  2K1J A;  2KRE A;  3KNV A;  3K9M A;  2Y5B A;  5A24 A;  4QRG A;  3CBK A;  1QXP A;  2AYO A;  2QIC A;  2LXH C;  4UP5 A;  2YJ8 A;  2B1M A;  3BC3 A;  2XU4 A;  2E03 A;  1AU4 A;  2DC6 A;  3KSE A;  2FYE A;  1VJV A;  2ZET C;  1F62 A;  2AUZ A;  3GV4 A;  4YYS A;  4IC2 A;  2ECG A;  4X6I A;  1WEM A;  2MA5 A;  2PRE A;  4N4F A;  9PAP A;  2ECN A;  1MS6 A;  4AP4 A;  4YAB A;  3RTR B;  2MNZ A;  3HHA A;  2G6Q A;  4CDD B;  2R9M A;  1WIL A;  3OVZ A;  1WEU A;  1KXR A;  4GB0 A;  2VHF A;  4BHW A;  1ITO A;  1PE6 A;  3ZVZ B;  3OVX A;  1KHP A;  4BSQ A;  4YYV A;  2VJF A;  2ECW A;  3O36 A;  2IDA A;  4YV8 A;  4I7B A;  2LN0 A;  2CB5 A;  3KKU A;  1CPJ A;  4LJN A;  1G25 A;  3LQJ A;  5DIN A;  3PW3 A;  2YHN A;  4K7C A;  4LKA A;  3P5W A;  2KWK A;  2EGP A;  2XU1 A;  2VJF B;  4FK5 A;  1X9Y A;  3KFQ A;  2MIQ A;  2HYE D;  1KHQ A;  5LKU A;  2FUD A;  4X6J A;  2G7Y A;  5CHT A;  2QIZ A;  1U9V A;  2XU5 A;  1VYX A;  3U5M A;  3IUT A;  2PAD A;  5C13 A;  1LDJ B;  2LDR A;  5AIU A;  1JM7 B;  2RI7 A;  2VP7 A;  4AYC A;  4DMX A;  2P0R A;  1U6G B;  3AI8 A;  4QBB A;  1WEO A;  4BGF A;  2ECI A;  2WBF X;  1QMY A;  1ZIV A;  3MTN A;  2YRE A;  1DEU A;  3QT4 A;  2VJE B;  2OXQ C;  4Q8H A;  1BP4 A;  3D6S A;  3T7L A;  2Y1N A;  1MIR A;  2F7D A;  2YJ9 A;  4YYW A;  2CSY A;  4N4Z A;  1YK8 A;  4MSX A;  2PUY A;  2FO5 A;  5B77 A;  1X4J A;  5B8D A;  1NQC A;  2DCC A;  4GUZ A;  2DCD A;  2ECJ A;  3ASL A;  4V3L C;  1EWO A;  2DJG B;  3NHE A;  3N9L A;  1PPP A;  2L75 A;  2MD8 C;  3HWN A;  3N9P A;  1WES A;  4MZS A;  1PIP A;  3U5O A;  1MM3 A;  1NLJ A;  2MA6 A;  1X4I A;  1LDK C;  2KYU A;  1PAD A;  2C0Y A;  3QZV A;  1K3B B;  3HHI A;  4KLB A;  2JMJ A;  1WEN A;  1W4T A;  2KIZ A;  2CSZ A;  2M3H A;  1SNK A;  3H6S A;  3P5U A;  4YVA A;  2L80 A;  2LV9 A;  2PNX A;  2C2V S;  3ZVY A;  3V6C A;  2F6J A;  5B78 A;  1DVP A;  3C9E A;  2AS8 A;  3WXE A;  1SP4 B;  1JOC A;  3H7D A;  2KGI A;  7PCK A;  2KWJ A;  3KV6 A;  3PUQ A;  4YBM A;  4BQV A;  2AN6 A;  3H8B A;  3O1G A;  5EF4 A;  2VPD A;  3D9W A;  3I06 A;  1U9Q X;  1PPD A;  2H7J A;  3N4C A;  2LGV A;  3LQH A;  3O37 A;  5G04 B;  1U5I A;  1ZCM A;  1JQP A;  1KFU L;  1PCI A;  1ATK A;  3IEJ A;  1MEG A;  2L5U A;  3U5N A;  1AEC A;  2BAY A;  4XUI A;  5H1T A;  3N3K A;  2H0D B;  4QF3 A;  4BS6 A;  4L58 A;  4YYR A;  4BBQ A;  2YSJ A;  1BY8 A;  2GHU A;  3RVW A;  2BDZ A;  2KFT A;  4W5C A;  4R7E A;  2QJ0 A;  3KX1 A;  3N9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...