4W4UA

Structure of yeast saga dubm with sgf73 y57a mutant at 2.8 angstroms resolution
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
471
structure length
438
Chain Sequence
MSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALRQTGFIYLLTCAWKIQDAHEFWQFIINQIHQSYVLDLPNAKEVSRANNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNYHCGECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Uncovering the role of Sgf73 in maintaining SAGA deubiquitinating module structure and activity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase
total genus 135
structure length 438
sequence length 471
chains with identical sequence D
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2014-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4w4uA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4w4uA02
1WEQA 2MNYA 2CKLA 1RMDA 3PUQA 3LQIA 2JQFR 2MUMA 1POPA 3I2DA 3LQJA 1WENA 5D1KB 4Q6FA 3ZPVE 2HDPA 3N9NA 1YVBA 1U5IA 2R9MA 4GB0A 4X6IA 3O70A 4YYSA 2IBIA 3C9EA 4MZOA 4YBTA 5B8DA 1EF7A 1WGMA 2G8EA 1GECE 2I50A 4P5OB 2PUYA 1WEUA 4UP5A 2UZGA 5FB0A 2FRQA 2YT5A 4YYUA 4PI3A 1NB5A 3L1ZB 4FO9A 2G43A 4OELA 1WEOA 4AP4A 2FUIA 2KGIA 4YBSA 1ICFA 2DCDA 2K16A 3T7LA 2G6QA 3H8BA 3HCTA 5TDWA 2LGLA 3O7AA 2NQGA 5JG6A 3PDFA 4X6JA 2ECIA 5CHVA 2B1NA 3RVVA 3CBKA 2AUZA 1ATKA 5H1UA 2AN6A 4BHWA 4K7CA 3DQVR 2AYNA 1CV8A 1MS6A 2LN0A 1VD4A 3DPLR 3HHAA 1BY8A 4N79A 5A24A 2YJ9A 2C0YA 3HD3A 2QIZA 2R9FA 2BDLA 3C5KA 1X4UA 2YJCA 3D6SA 2Y6EA 2NQAA 2E6SA 5C13A 1F2AA 2H7JA 4HWYA 3AI8A 5TDRA 4O64A 2DC6A 2R9CA 2WBFX 2JMIA 4W4UA 4A0CD 2B1MA 2E02A 2XU4A 1F2BA 4I05A 4AVXA 1TU6A 2KWJA 3SOWA 2LXPC 3L1XA 2F6JA 5TRBA 2YSJA 2E03A 2FQ9A 4Q8GA 1WILA 4YADA 2DJGB 3ZUAA 1PBHA 5JA7A 4TKPB 4N4FA 3VK6A 3N3KA 4G54A 1BGOA 1VSNA 2YJ8A 3V6EA 3IHPA 4R7EA 5KH3A 1CPJA 2YQLA 4XI1A 5CVMA 2KWOA 3MHHA 2DZZA 4CZWA 1NPZA 1NLJA 4A4CA 2DZYA 3CBJA 5H1TA 4BBQA 2HHNA 2KFTA 1FBVA 3H7DA 2ECTA 4PADA 2HXZA 2LGKA 5D1MB 3QSDA 1G25A 3RPGB 1K2FA 1KHQA 2E01A 3OVZA 2JRJA 3LFYA 6PADA 4BSQA 2JMDA 1M6DA 3N9QA 2KIZA 3ZPV1 5FEYA 2AVWA 2CSYA 1SNKA 4FIPA 1MM3A 3KW9A 1WEEA 2E00A 3I06A 4X3GA 2L0BA 5B76A 4I04A 2YHNA 4QRXA 5DINA 1STFE 2LGGA 2JMJA 4WZ2A 1SP4B 2VPGA 4YBMA 1WESA 2YQMA 4QRVA 3K24A 1PPDA 1WEVA 1CVZA 4CDCB 4LADB 3ZYQA 2R6NA 2G45A 3O36A 2K1JA 5CVNB 4A4BA 3V43A 3PW3A 1YALA 5EYAF 2C2VS 1EWPA 2VJFA 3KWBX 1DVPA 3I3TA 2ECVA 2O6XA 4CCGX 2PBHA 3BOWA 3V6CA 3C6WA 5FERA 2RSDA 2AUXA 5D1LB 3K8UA 1N87A 2GFOA 2R9OA 1Z2QA 2HD5A 2R9NA 4QRGA 3NHEA 3HCUA 3HHIA 1WE9A 2AIMA 5LKTA 4QF2A 5LKZA 1FH0A 2KE1A 3KV5A 3KV6A 2CB5A 3PNRA 1F2CA 1BQIA 2MIQA 3H8CA 1Z60A 5FPWA 2KREA 2K17A 4S3OC 1ZCMA 1PPOA 4Q8HA 2IDAA 3ZVYA 1JQPA 4R2YA 3P5VA 4CDFB 2GHUA 4PP2E 3FL2A 5AIUA 1PPPA 1XKGA 5EGWA 2HYED 3WXFA 5B78A 1X9YA 3N9PA 3KX1A 2KYUA 3LXSA 3EB5A 1AYUA 4WZ0A 3CH3X 4N3WA 1DEUA 5H9MA 1EWOA 2M85A 2KGGA 2FT2A 3MORA 1WEWA 2F1GA 2P7UA 2YW8A 7PCKA 2H0DB 3N9OA 1Y4HA 4GNEA 2FUUA 4MVTA 1NQCA 1PXVA 3BC3A 2KWNA 3S3QA 1MDWA 4FJCA 4UI9B 5LKXA 3O37A 3BPMA 5TBNA 2ZETC 2FO5A 2NQIA 1TL9A 3S3RA 4DMYA 2Y43A 1IWDA 2L43A 2Y1NA 5G0FA 2M3HA 1VJVA 2M1RA 3GL6A 5TABA 1BORA 1EWMA 4L58A 4BS6A 2NAAA 1GMYA 3PBHA 3KKUA 3NG2A 4C9ZA 1CS8A 2RI7A 2YJBA 2DJFB 1S4VA 4V3KC 2L5UA 3WXGA 1X4IA 1U9WA 4IC2A 2MD8C 1AIMA 2MA6A 3BWKA 3ERVA 1AU4A 4YYQA 3PHDA 1T1HA 2BAYA 2CT2A 4BS5A 4BQVA 3P5WA 4MZSA 1WFKA 3MTNA 2YU4A 3HCSA 4GNFA 3OISA 2AS8A 3QT4A 4CDDB 1JM7A 1AYVA 3OF9A 2XU3A 4I7DA 5H1VA 4QH6A 4W5BA 2DC7A 3O33A 4YABA 3ASLA 3GCBA 1HYJA 8PCHA 1KHPA 1U6GB 1O0EA 1CSBB 5PADA 2ATOA 5G04B 2E6RA 4UP0A 3N3GA 5DKAA 5KH9A 2FTDA 2FSAA 1VFYA 2K4DA 3F75A 4GNGA 4AXLA 1YT7A 2HH5A 1JOCA 1WEPA 4LK9A 4BPVA 3LRQA 2CSZA 2ACTA 2DCCA 3O34A 1MIRA 1BP4A 2MNZA 4AYCA 1V87A 1Q6KA 2G8JA 4A49A 4I07A 2VPBA 3MHSA 4GNDA 1GLOA 4P6GA 1LDKC 2L80A 3EB6A 1MEMA 4CDEB 4YVAA 1THEA 2VNFA 2DCBA 3BPFA 1U9QX 2PNXA 2KU3A 2VJFB 4LLBA 2KR4A 4RY2A 2DC8A 2LDRA 1AU3A 1MEGA 4AUQB 3N9LA 3P5XA 4S3OB 4OEMA 3L11A 3SHBA 2IPPB 2DC9A 1AU2A 3U8EA 4IC3A 3IOQA 4WZ3B 2VJEA 5CVOB 1Z6UA 3GV4A 3USVA 1TLOA 1QMYA 2VHSA 3TNXA 3O35A 5LKUA 5B79A 2FYEA 5J94A 3ZNIA 5EF4A 1GCBA 4NN2A 2PADA 4XUIA 2ECGA 4P6EA 1MM2A 2L75A 2XEUA 2YUCA 1CJLA 2Y5BA 4YYVA 1NB3A 3OVXA 1QOLA 3IMAA 2BDZA 4YYWA 3M63A 3T6RA 1U9VA 1XWHA 2F6NA 4I7CA 1HYIA 2YSMA 1IYMA 1AU0A 2G6DA 3RVWA 3OF8A 4QF3A 4DMXA 4B7YC 1KFUL 2FRAA 1CHCA 1AYWA 3ZVZB 1PE6A 1WEMA 4YATA 2H0DA 5KH7A 2XB1A 3QJ3A 4ZDTA 4MSXA 4YC9A 3U5NA 5C11A 1YK8A 5F02A 2YYRA 1VYXA 2MA5A 3QZVA 4WA6A 3N4CA 2C2LA 3E1ZB 2P0RA 1A6RA 2OP3A 3U5OA 2OZ2A 4XR7A 2QICA 3N9MA 3IEJA 3HWNA 4PPEA 3M62A 3DF0A 3IUTA 2YHOA 4LJNA 3KWZA 3P5UA 5AITA 1ZBDB 1DF0A 4N8WA 2ECWA 2DCAA 2VJEB 5FB1A 4PTBA 1CB5A 4I7BA 1ITOA 2VPDA 2YJ2A 2ECJA 5G05B 2F42A 3F5VA 4N4ZA 2MD7B 3SOUA 1NL6A 1PADA 4YYRA 2QJ0A 3ZTGA 1ZIVA 2EGPA 2LGVA 4V3LC 3KFQA 1F62A 2VPEA 3KNVA 2CKLB 1MHWA 1LDJB 1F29A 4X6HA 2LQ6A 1PPNA 1WIMA 2ECNA 5I3LA 2G7YA 5B77A 1YK7A 2VP7A 3IV2A 2XU5A 2NQDB 2DX8A 3LQHA 2D8SA 1CTEA 1CQDA 5LCWB 2YREA 4AXMA 1HUCB 2VHFA 4QBBA 1PIPA 2CIOA 2EA6A 4B86C 3B79A 4PP1A 4ZQLA 4AYCB 2AYOA 2OULA 4KLBA 2ARYA 4R8PK 1ME3A 1Y08A 3K9MA 5CHTA 3KQIA 4YV8A 1KFXL 2F7DA 3U5MA 4F52B 2FUDA 2PNSA 2AU1A 1EWLA 1ME4A 2MT5A 3CH2X 3BCNA 2LXHC 3WXEA 1QXPA 2Y1MA 1E4UA 3RVXA 2PREA 5J3XA 4L7XA 3U5PA 1QDQA 3H89A 1AECA 3H6SA 2OXQC 5B75A 3RPGC 5JH3A 2JQGR 3O0UA 3O1GA 2P86A 3M99A 2LV9A 4ZUXU 1JM7B 9PAPA 2KWKA 3PURA 2M6MA 4W5CA 3SOXA 3HTKC 1FP0A 4LKAA 4FK5A 3RTRB 2XU1A 2EODA 3KSEA 4YAXA 1K3BB 1U9XA 5K16A 1X4JA 1KXRA 1PCIA 2LRIC 4CA1A 2YURA
chains in the Genus database with same CATH superfamily
1WEQA 2MNYA 2CKLA 2EXUA 3SUBA 1RMDA 3PUQA 3LQIA 2JQFR 2MUMA 1POPA 3I2DA 3LQJA 1YZBA 1WENA 2B0OE 5D1KB 4Q6FA 3ZPVE 4OVZA 2HDPA 3N9NA 1YVBA 1U5IA 2R9MA 4GB0A 4BOQA 4X6IA 3O70A 4YYSA 2IBIA 3C9EA 3E2DA 4MZOA 4YBTA 5B8DA 1EF7A 1WGMA 2G8EA 1GECE 2I50A 4P5OB 2PUYA 1WEUA 4UP5A 2UZGA 5FB0A 2FRQA 2YT5A 4YYUA 3LDYA 4PI3A 1NB5A 3L1ZB 2BTWA 4FO9A 2G43A 4OELA 1WEOA 4AP4A 3BBAA 2FUIA 2KGIA 4YBSA 1ICFA 2DCDA 2K16A 3T7LA 2G6QA 3H8BA 3HCTA 5TDWA 2LGLA 3O7AA 2NQGA 5JG6A 3PDFA 4X6JA 2ECIA 5CHVA 2B1NA 3RVVA 3CBKA 2AUZA 1ATKA 5H1UA 1DCQA 3KDEC 2AN6A 4BHWA 2LAUA 4K7CA 3DQVR 2AYNA 2JTCA 1CV8A 2KKXA 1MS6A 2LN0A 1VD4A 3DPLR 3HHAA 1BY8A 5KO3A 1UKFA 4N79A 5A24A 2YJ9A 2C0YA 3HD3A 2QIZA 2R9FA 2BDLA 4MM3B 3C5KA 1X4UA 2YJCA 3D6SA 2Y6EA 2NQAA 2E6SA 5C13A 1F2AA 2H7JA 4HWYA 3AI8A 5TDRA 2CRWA 4O64A 2DC6A 2R9CA 2WBFX 2JMIA 4W4UA 4A0CD 2B1MA 3FJUB 2E02A 2XU4A 1F2BA 4I05A 4AVXA 1TU6A 2KWJA 2LXPC 3L1XA 5TRBA 2F6JA 3SOWA 2YSJA 2E03A 2FQ9A 4Q8GA 2UZJA 1WILA 4YADA 2DJGB 3ZUAA 1PBHA 5JA7A 4TKPB 4N4FA 3VK6A 3N3KA 4G54A 1BGOA 1VSNA 2YJ8A 3V6EA 3IHPA 4R7EA 5KH3A 1CPJA 2YQLA 4XI1A 5CVMA 2KWOA 3MHHA 2DZZA 4CZWA 1NPZA 1NLJA 4A4CA 2DZYA 3CBJA 3E9SA 5H1TA 4BBQA 2HHNA 2J7QA 2KFTA 1FBVA 3H7DA 2ECTA 4PADA 2HXZA 2LGKA 2DSMA 5D1MB 3QSDA 2JM3A 1G25A 3RPGB 1K2FA 1KHQA 2E01A 3OVZA 2JRJA 2CRRA 3LFYA 6PADA 4BSQA 2JMDA 1M6DA 3N9QA 2KIZA 2XOCA 3ZPV1 5FEYA 2AVWA 2CSYA 4XZXA 1SNKA 4FIPA 1MM3A 3KW9A 1WEEA 2E00A 3I06A 2JUNA 4X3GA 2L0BA 5B76A 4I04A 2YHNA 4QRXA 5DINA 1STFE 2LGGA 2JMJA 4WZ2A 1SP4B 2VPGA 4YBMA 3M7KA 1WESA 2YQMA 1MBMA 4QRVA 3K24A 2EGMA 2YVRA 1PPDA 4MI7A 1WEVA 2OWAA 1CVZA 4CDCB 4LADB 3ZYQA 2R6NA 2G45A 3O36A 3LVQE 2K1JA 5CVNB 4A4BA 3V43A 3PW3A 1YALA 5EYAF 2C2VS 1EWPA 2VJFA 3KWBX 1DVPA 3I3TA 2M13A 2ECVA 2O6XA 4CCGX 4Z0OA 5SVIB 2PBHA 3BOWA 3V6CA 3C6WA 5FERA 2RSDA 4Z0RA 5D1LB 2AUXA 3K8UA 1N87A 2GFOA 2R9OA 1Z2QA 2HD5A 2R9NA 4QRGA 3NHEA 3HCUA 3HHIA 1WE9A 2AIMA 2FFWA 5LKTA 4QF2A 5LKZA 3BY4A 1FH0A 2KE1A 3KV5A 3KV6A 2CB5A 3RNVA 3PNRA 3MJ5A 1F2CA 1BQIA 2MIQA 3LJUX 3H8CA 1Z60A 5FPWA 2KREA 2K17A 4S3OC 1ZCMA 1PPOA 4Q8HA 2IDAA 3ZVYA 3MP2A 1JQPA 4R2YA 3P5VA 4CDFB 2GHUA 4PP2E 4RF0A 3PLWA 3FL2A 5AIUA 1PPPA 1XKGA 5EGWA 2HYED 3W31A 3FM8C 3WXFA 4PT5A 5B78A 1X9YA 3N9PA 4P16A 3KX1A 2KYUA 5K3QA 3LXSA 3PHUA 3EB5A 1AYUA 4WZ0A 3CH3X 4N3WA 1DEUA 5H9MA 4F1PA 4HXDB 1EWOA 2XOYA 2M85A 2KGGA 2FT2A 3MORA 1WEWA 3BB7A 2F1GA 2P7UA 2YW8A 7PCKA 2H0DB 3N9OA 3DWDA 1Y4HA 4GNEA 2FUUA 4MVTA 1NQCA 1PXVA 2J7QC 3BC3A 2KWNA 3S3QA 2CSVA 1MDWA 4FJCA 4UI9B 3TMPA 5LKXA 3O37A 3BPMA 5TBNA 2ZETC 2FO5A 2NQIA 1TL9A 4R3DA 3S3RA 4DMYA 2E61A 2Y43A 1IWDA 2L43A 2Y1NA 5G0FA 3LVRE 2M3HA 3PT2A 1VJVA 2M1RA 3GL6A 5TABA 1BORA 4IUMA 1EWMA 4L58A 4RKXA 4BS6A 2NAAA 2D8UA 1GMYA 3PBHA 3KKUA 3NG2A 4C9ZA 1CS8A 2BTWB 2RI7A 2YJBA 2DJFB 1S4VA 4V3KC 2L5UA 3WXGA 1X4IA 1U9WA 4IC2A 2MD8C 1AIMA 2MA6A 3BWKA 3ERVA 1AU4A 4YYQA 3PHDA 1T1HA 2BAYA 2CT2A 4REZA 3MTVA 4BS5A 4BQVA 3P5WA 4MZSA 1WFKA 3MTNA 2YU4A 3HCSA 4GNFA 3OISA 2AS8A 3QT4A 4CDDB 1JM7A 3PRPA 1AYVA 3OF9A 2XU3A 4I7DA 5H1VA 4QH6A 4W5BA 2RR4A 2DC7A 3O33A 4YABA 3ASLA 3GCBA 1HYJA 3FAOA 8PCHA 1KHPA 1U6GB 1O0EA 1CSBB 5PADA 2ATOA 5G04B 2E6RA 4UP0A 3N3GA 5DKAA 5KH9A 2FTDA 2FSAA 1VFYA 2K4DA 3F75A 4GNGA 4AXLA 1YT7A 3PRMA 2HH5A 3JUEA 1JOCA 1WEPA 2DJAA 4LK9A 4BPVA 3LRQA 2IQJA 2CSZA 2ACTA 2DCCA 3C0RA 3O34A 1MIRA 1BP4A 2MNZA 4AYCA 1DKIA 4A5UA 2XOZA 1V87A 4BOZA 1Q6KA 2G8JA 4RNAA 4A49A 4I07A 2VPBA 3DDTA 3MHSA 4ZTBA 4GNDA 2KKYA 1GLOA 4P6GA 1LDKC 2L80A 3EB6A 3O47A 1MEMA 4CDEB 4YVAA 1THEA 2VNFA 2DCBA 3BPFA 1U9QX 2PNXA 2KU3A 2VJFB 4LLBA 2KR4A 4RY2A 2DC8A 2DOSA 2LDRA 1AU3A 1MEGA 4AUQB 3N9LA 3P5XA 4OW0A 4S3OB 4OEMA 3L11A 3SHBA 2IPPB 2DC9A 1AU2A 4RF1A 4WURA 3U8EA 4IC3A 3IOQA 4WZ3B 2VJEA 5CVOB 3PHWA 1Z6UA 3GV4A 3USVA 1TLOA 1QMYA 2VHSA 3OQCA 3TNXA 3O35A 5LKUA 5B79A 2FYEA 5SVXA 5J94A 3ZNIA 5EF4A 1GCBA 4NN2A 2PADA 4XUIA 2ECGA 4P6EA 1MM2A 2L75A 2XEUA 2YUCA 1CJLA 2Y5BA 3MDBC 1NB3A 4YYVA 3OVXA 1QOLA 3IMAA 3IFUA 2BDZA 4YYWA 3M63A 3T6RA 1U9VA 1XWHA 2F6NA 4I7CA 1HYIA 2YSMA 3B21A 3O65A 2FD4A 1IYMA 1AU0A 2G6DA 3RVWA 4D8EA 3OF8A 4QF3A 4DMXA 4B7YC 5E6JA 1KFUL 2FRAA 1CHCA 1AYWA 3ZVZB 1PE6A 2H0DA 4YATA 1WEMA 3PSEA 5KH7A 2MKEA 2XB1A 3QJ3A 4ZDTA 4MSXA 4YC9A 3U5NA 4BOUA 2BU3A 5C11A 1YK8A 2JRIA 5JZEA 3TRKA 5F02A 2YYRA 1VYXA 2MA5A 3QZVA 4WA6A 3N4CA 3W30A 3FEHA 2C2LA 3E1ZB 2P0RA 1A6RA 2OP3A 3U5OA 2OZ2A 4XR7A 2QICA 3N9MA 3IEJA 3HWNA 4PPEA 4IP3A 3M62A 3DF0A 3IUTA 2YHOA 4LJNA 3KWZA 3P5UA 5AITA 1ZBDB 4GUAA 1DF0A 4N8WA 2ECWA 2DCAA 2VJEB 5FB1A 4PTBA 4O62A 1CB5A 3FANA 4I7BA 1ITOA 2CONA 2VPDA 2YJ2A 2ECJA 5G05B 2F42A 3F5VA 4N4ZA 2MD7B 3SOUA 1NL6A 1PADA 4YYRA 2QJ0A 3ZTGA 3T9KA 1ZIVA 2EGPA 2LGVA 4V3LC 3KFQA 4D8IA 4QQ4A 1F62A 3ZNHA 2VPEA 3KNVA 2CKLB 1MHWA 1LDJB 1F29A 4X6HA 2LQ6A 1PPNA 5SVIA 1WIMA 2ECNA 5I3LA 1PVJA 2G7YA 5B77A 1YK7A 4D8BA 2XP0A 2VP7A 3IV2A 2XU5A 2NQDB 2DX8A 3LQHA 2D8SA 5EZSA 1CTEA 1CQDA 5LCWB 5SVYA 2YREA 4AXMA 1HUCB 2VHFA 4QBBA 2Z84A 1PIPA 2CIOA 2EA6A 4B86C 3B79A 4H9DA 4ZQLA 4PP1A 4AYCB 2AYOA 2OULA 4KLBA 2ARYA 4OGCA 4R8PK 1ME3A 1Y08A 3K9MA 5CHTA 3KQIA 4YV8A 2AGAA 1KFXL 2L7PA 2F7DA 3U5MA 2P57A 4F52B 2FUDA 2PNSA 2AU1A 1EWLA 1ME4A 2MT5A 4OVZB 3CH2X 3BCNA 2LXHC 3WXEA 1QXPA 2Y1MA 4BOPA 1E4UA 3RVXA 2PREA 5J3XA 4L7XA 3U5PA 1QDQA 3H89A 1AECA 3H6SA 2FE8A 2OXQC 5B75A 3RPGC 5JH3A 2JQGR 3O0UA 3Q1DA 3O1GA 2P86A 3M99A 2LV9A 4ZUXU 1JM7B 9PAPA 2KWKA 4M0WA 3PURA 4OGEA 2M6MA 4W5CA 3H7HA 3SOXA 3HTKC 1FP0A 2HWKA 4LKAA 4FK5A 3RTRB 2XU1A 2EODA 5EZQA 3KSEA 4YAXA 1K3BB 4BOSA 1U9XA 5K16A 1X4JA 1KXRA 1PCIA 2LRIC 4CA1A 3PHXA 2YURA
chains in the Genus database with same CATH topology
1WEQA 2MNYA 2CKLA 1RMDA 3PUQA 3LQIA 2JQFR 2MUMA 1POPA 3I2DA 3LQJA 1WENA 5D1KB 4Q6FA 3ZPVE 2HDPA 3N9NA 1YVBA 4GUZA 1U5IA 2R9MA 4GB0A 4X6IA 3O70A 4YYSA 2IBIA 3C9EA 4MZOA 4YBTA 5B8DA 1EF7A 1WGMA 1E2TA 2G8EA 1GECE 2I50A 4P5OB 2PUYA 1WEUA 4UP5A 2UZGA 5FB0A 2FRQA 2YT5A 4YYUA 4PI3A 1NB5A 4C5PA 3L1ZB 4FO9A 2G43A 4OELA 1WEOA 4AP4A 2FUIA 2KGIA 4YBSA 1ICFA 2DCDA 2K16A 4B55A 3T7LA 2G6QA 3H8BA 3HCTA 5TDWA 2LGLA 3O7AA 2NQGA 5JG6A 3PDFA 4X6JA 2ECIA 5CHVA 2B1NA 3RVVA 3CBKA 2AUZA 1ATKA 5H1UA 2AN6A 4BHWA 4K7CA 3DQVR 2AYNA 1CV8A 1MS6A 2LN0A 1VD4A 3DPLR 3HHAA 4NV7A 1BY8A 4N79A 5A24A 2YJ9A 2C0YA 3HD3A 2QIZA 2R9FA 2BDLA 3C5KA 1X4UA 2YJCA 3D6SA 2Y6EA 2NQAA 2E6SA 5C13A 1F2AA 2H7JA 4HWYA 3AI8A 5TDRA 4O64A 2DC6A 2R9CA 2WBFX 2JMIA 4W4UA 4A0CD 2B1MA 2E02A 2XU4A 1F2BA 4I05A 4AVXA 1TU6A 2KWJA 3SOWA 2LXPC 3L1XA 2F6JA 5TRBA 2YSJA 2E03A 2FQ9A 4Q8GA 1WILA 4YADA 2DJGB 3ZUAA 1PBHA 5JA7A 4TKPB 4N4FA 3VK6A 3N3KA 4G54A 1BGOA 1VSNA 2YJ8A 3V6EA 3IHPA 4R7EA 5KH3A 1CPJA 2YQLA 4XI1A 5CVMA 2KWOA 3MHHA 2DZZA 4CZWA 1NPZA 1NLJA 4A4CA 2DZYA 3CBJA 5H1TA 4BBQA 2HHNA 2KFTA 1FBVA 3H7DA 2ECTA 4PADA 2HXZA 2LGKA 5D1MB 3QSDA 1G25A 3RPGB 1K2FA 1KHQA 2E01A 3OVZA 2JRJA 3LFYA 6PADA 4BSQA 2JMDA 1M6DA 3N9QA 2KIZA 3ZPV1 5FEYA 2AVWA 2CSYA 1SNKA 4FIPA 1MM3A 3KW9A 1WEEA 2E00A 3I06A 4X3GA 2L0BA 5B76A 4I04A 2YHNA 4QRXA 5DINA 1STFE 2LGGA 2JMJA 4WZ2A 1SP4B 2VPGA 4YBMA 1WESA 2YQMA 4QRVA 3K24A 4NV8A 1PPDA 1WEVA 1CVZA 4CDCB 4LADB 3ZYQA 2R6NA 2G45A 3O36A 2K1JA 5CVNB 4A4BA 3V43A 3PW3A 1YALA 5EYAF 2C2VS 1EWPA 2VJFA 3KWBX 1DVPA 3I3TA 2ECVA 2O6XA 4CCGX 2PBHA 3BOWA 3V6CA 3C6WA 5FERA 2RSDA 2AUXA 5D1LB 3K8UA 1N87A 2GFOA 2R9OA 1Z2QA 2VFBA 2HD5A 2R9NA 4QRGA 3NHEA 3HCUA 3HHIA 1WE9A 2AIMA 5LKTA 4QF2A 5LKZA 1FH0A 2KE1A 3KV5A 3KV6A 2CB5A 3D9WA 3PNRA 1F2CA 1BQIA 2MIQA 3H8CA 1Z60A 5FPWA 2KREA 2K17A 4S3OC 1ZCMA 1PPOA 4Q8HA 2IDAA 3ZVYA 1JQPA 4R2YA 3P5VA 4CDFB 2GHUA 4PP2E 3FL2A 5AIUA 1PPPA 1XKGA 5EGWA 2HYED 3WXFA 5B78A 1X9YA 3N9PA 3KX1A 2KYUA 3LXSA 3EB5A 1AYUA 1GX3A 4WZ0A 3CH3X 4N3WA 1DEUA 5H9MA 1EWOA 2M85A 2KGGA 2FT2A 3MORA 1WEWA 2F1GA 2P7UA 2YW8A 7PCKA 2H0DB 3N9OA 1Y4HA 4GNEA 2FUUA 4MVTA 1NQCA 1PXVA 3BC3A 2KWNA 3S3QA 1MDWA 4FJCA 4UI9B 5LKXA 3O37A 3BPMA 5TBNA 2ZETC 2FO5A 2NQIA 1TL9A 3S3RA 4DMYA 2Y43A 1IWDA 2L43A 2Y1NA 5G0FA 2M3HA 1VJVA 2M1RA 3GL6A 5TABA 1BORA 1W5RA 1EWMA 4L58A 4BS6A 2NAAA 1GMYA 3PBHA 3KKUA 3NG2A 4C9ZA 1CS8A 2RI7A 2YJBA 2DJFB 1S4VA 4V3KC 2L5UA 1W4TA 1X4IA 1U9WA 3WXGA 4IC2A 2MD8C 1AIMA 2MA6A 3BWKA 3ERVA 1AU4A 4YYQA 3PHDA 1T1HA 2BAYA 2CT2A 4BS5A 4BQVA 3P5WA 4MZSA 1WFKA 3MTNA 2YU4A 3HCSA 4GNFA 3OISA 2AS8A 3QT4A 4CDDB 1JM7A 1AYVA 3OF9A 2XU3A 4I7DA 5H1VA 4QH6A 4W5BA 2DC7A 3O33A 4YABA 3ASLA 3GCBA 1HYJA 8PCHA 1KHPA 1U6GB 1O0EA 1CSBB 5PADA 2ATOA 4BGFA 5G04B 2E6RA 4UP0A 3N3GA 5DKAA 5KH9A 2FTDA 2FSAA 1VFYA 2K4DA 3F75A 4GNGA 4AXLA 1YT7A 2HH5A 1JOCA 1WEPA 4LK9A 4BPVA 3LRQA 2CSZA 2ACTA 2DCCA 3O34A 1MIRA 1BP4A 2MNZA 4AYCA 1V87A 1Q6KA 2G8JA 4A49A 4I07A 2VPBA 3MHSA 4GNDA 1GLOA 4P6GA 1LDKC 2L80A 3EB6A 1MEMA 4CDEB 4YVAA 1THEA 2VNFA 2DCBA 3BPFA 1U9QX 2PNXA 2KU3A 2VJFB 4LLBA 2KR4A 4RY2A 2DC8A 2LDRA 1AU3A 1MEGA 4AUQB 3N9LA 3P5XA 4S3OB 4OEMA 3L11A 3SHBA 2IPPB 3LTWA 2DC9A 1AU2A 3U8EA 4IC3A 3IOQA 4WZ3B 2VJEA 5CVOB 1Z6UA 3GV4A 3USVA 1TLOA 1QMYA 2BSZA 2VHSA 3TNXA 3O35A 5LKUA 5B79A 2FYEA 5J94A 3ZNIA 5EF4A 1GCBA 4NN2A 2PADA 4XUIA 2ECGA 4P6EA 1MM2A 2L75A 2XEUA 2YUCA 1CJLA 2Y5BA 4YYVA 1NB3A 3OVXA 1QOLA 3IMAA 2BDZA 4YYWA 3M63A 3T6RA 1U9VA 1XWHA 2F6NA 4I7CA 1HYIA 2YSMA 1IYMA 1AU0A 2G6DA 3RVWA 3OF8A 4QF3A 4DMXA 4B7YC 1KFUL 2FRAA 1CHCA 1AYWA 3ZVZB 1PE6A 1WEMA 4YATA 2H0DA 5KH7A 2XB1A 3QJ3A 4ZDTA 4MSXA 4YC9A 3U5NA 5C11A 1YK8A 5F02A 2YYRA 1VYXA 2MA5A 3QZVA 4WA6A 3N4CA 2C2LA 3E1ZB 2P0RA 1A6RA 2OP3A 3U5OA 2OZ2A 4XR7A 2QICA 3N9MA 3IEJA 3HWNA 4PPEA 3M62A 3DF0A 3IUTA 2YHOA 4LJNA 3KWZA 3P5UA 5AITA 1ZBDB 1DF0A 4N8WA 2ECWA 2DCAA 2VJEB 5FB1A 4PTBA 1CB5A 4I7BA 2VFCA 1ITOA 2VPDA 2YJ2A 2ECJA 5G05B 2F42A 3F5VA 4N4ZA 2MD7B 3SOUA 1NL6A 1PADA 4YYRA 2QJ0A 3ZTGA 1ZIVA 2EGPA 2LGVA 4V3LC 3KFQA 1F62A 2VPEA 3KNVA 2CKLB 1MHWA 1LDJB 1F29A 4X6HA 2LQ6A 1PPNA 1W6FA 1WIMA 2ECNA 5I3LA 2G7YA 5B77A 1YK7A 2VP7A 3IV2A 2XU5A 2NQDB 2DX8A 3LQHA 2D8SA 1CTEA 1CQDA 5LCWB 2YREA 4AXMA 1HUCB 2VHFA 4QBBA 1PIPA 2CIOA 2EA6A 4B86C 3B79A 4PP1A 4ZQLA 4AYCB 2AYOA 2OULA 4KLBA 2ARYA 4R8PK 1ME3A 1Y08A 3K9MA 5CHTA 3KQIA 4YV8A 1KFXL 2F7DA 3U5MA 4F52B 2FUDA 2PNSA 2AU1A 1EWLA 1ME4A 2MT5A 3CH2X 3BCNA 2LXHC 3WXEA 1QXPA 2Y1MA 1E4UA 3RVXA 2PREA 5J3XA 4L7XA 3U5PA 1QDQA 3H89A 1AECA 3H6SA 2OXQC 5B75A 3RPGC 5JH3A 2JQGR 3O0UA 3O1GA 2P86A 3M99A 2LV9A 4ZUXU 1JM7B 9PAPA 2KWKA 3PURA 2M6MA 4W5CA 3SOXA 3HTKC 1FP0A 4LKAA 4FK5A 3RTRB 2XU1A 2EODA 3KSEA 4YAXA 1K3BB 1U9XA 5K16A 1X4JA 1KXRA 1PCIA 2LRIC 4CA1A 2YURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WEQ A;  2MNY A;  2CKL A;  1RMD A;  3PUQ A;  3LQI A;  2JQF R;  2MUM A;  1POP A;  3I2D A;  3LQJ A;  1WEN A;  5D1K B;  4Q6F A;  3ZPV E;  2HDP A;  3N9N A;  1YVB A;  1U5I A;  2R9M A;  4GB0 A;  4X6I A;  3O70 A;  4YYS A;  2IBI A;  3C9E A;  4MZO A;  4YBT A;  5B8D A;  1EF7 A;  1WGM A;  2G8E A;  1GEC E;  2I50 A;  4P5O B;  2PUY A;  1WEU A;  4UP5 A;  2UZG A;  5FB0 A;  2FRQ A;  2YT5 A;  4YYU A;  4PI3 A;  1NB5 A;  3L1Z B;  4FO9 A;  2G43 A;  4OEL A;  1WEO A;  4AP4 A;  2FUI A;  2KGI A;  4YBS A;  1ICF A;  2DCD A;  2K16 A;  3T7L A;  2G6Q A;  3H8B A;  3HCT A;  5TDW A;  2LGL A;  3O7A A;  2NQG A;  5JG6 A;  3PDF A;  4X6J A;  2ECI A;  5CHV A;  2B1N A;  3RVV A;  3CBK A;  2AUZ A;  1ATK A;  5H1U A;  2AN6 A;  4BHW A;  4K7C A;  3DQV R;  2AYN A;  1CV8 A;  1MS6 A;  2LN0 A;  1VD4 A;  3DPL R;  3HHA A;  1BY8 A;  4N79 A;  5A24 A;  2YJ9 A;  2C0Y A;  3HD3 A;  2QIZ A;  2R9F A;  2BDL A;  3C5K A;  1X4U A;  2YJC A;  3D6S A;  2Y6E A;  2NQA A;  2E6S A;  5C13 A;  1F2A A;  2H7J A;  4HWY A;  3AI8 A;  5TDR A;  4O64 A;  2DC6 A;  2R9C A;  2WBF X;  2JMI A;  4W4U A;  4A0C D;  2B1M A;  2E02 A;  2XU4 A;  1F2B A;  4I05 A;  4AVX A;  1TU6 A;  2KWJ A;  3SOW A;  2LXP C;  3L1X A;  2F6J A;  5TRB A;  2YSJ A;  2E03 A;  2FQ9 A;  4Q8G A;  1WIL A;  4YAD A;  2DJG B;  3ZUA A;  1PBH A;  5JA7 A;  4TKP B;  4N4F A;  3VK6 A;  3N3K A;  4G54 A;  1BGO A;  1VSN A;  2YJ8 A;  3V6E A;  3IHP A;  4R7E A;  5KH3 A;  1CPJ A;  2YQL A;  4XI1 A;  5CVM A;  2KWO A;  3MHH A;  2DZZ A;  4CZW A;  1NPZ A;  1NLJ A;  4A4C A;  2DZY A;  3CBJ A;  5H1T A;  4BBQ A;  2HHN A;  2KFT A;  1FBV A;  3H7D A;  2ECT A;  4PAD A;  2HXZ A;  2LGK A;  5D1M B;  3QSD A;  1G25 A;  3RPG B;  1K2F A;  1KHQ A;  2E01 A;  3OVZ A;  2JRJ A;  3LFY A;  6PAD A;  4BSQ A;  2JMD A;  1M6D A;  3N9Q A;  2KIZ A;  3ZPV 1;  5FEY A;  2AVW A;  2CSY A;  1SNK A;  4FIP A;  1MM3 A;  3KW9 A;  1WEE A;  2E00 A;  3I06 A;  4X3G A;  2L0B A;  5B76 A;  4I04 A;  2YHN A;  4QRX A;  5DIN A;  1STF E;  2LGG A;  2JMJ A;  4WZ2 A;  1SP4 B;  2VPG A;  4YBM A;  1WES A;  2YQM A;  4QRV A;  3K24 A;  1PPD A;  1WEV A;  1CVZ A;  4CDC B;  4LAD B;  3ZYQ A;  2R6N A;  2G45 A;  3O36 A;  2K1J A;  5CVN B;  4A4B A;  3V43 A;  3PW3 A;  1YAL A;  5EYA F;  2C2V S;  1EWP A;  2VJF A;  3KWB X;  1DVP A;  3I3T A;  2ECV A;  2O6X A;  4CCG X;  2PBH A;  3BOW A;  3V6C A;  3C6W A;  5FER A;  2RSD A;  2AUX A;  5D1L B;  3K8U A;  1N87 A;  2GFO A;  2R9O A;  1Z2Q A;  2HD5 A;  2R9N A;  4QRG A;  3NHE A;  3HCU A;  3HHI A;  1WE9 A;  2AIM A;  5LKT A;  4QF2 A;  5LKZ A;  1FH0 A;  2KE1 A;  3KV5 A;  3KV6 A;  2CB5 A;  3PNR A;  1F2C A;  1BQI A;  2MIQ A;  3H8C A;  1Z60 A;  5FPW A;  2KRE A;  2K17 A;  4S3O C;  1ZCM A;  1PPO A;  4Q8H A;  2IDA A;  3ZVY A;  1JQP A;  4R2Y A;  3P5V A;  4CDF B;  2GHU A;  4PP2 E;  3FL2 A;  5AIU A;  1PPP A;  1XKG A;  5EGW A;  2HYE D;  3WXF A;  5B78 A;  1X9Y A;  3N9P A;  3KX1 A;  2KYU A;  3LXS A;  3EB5 A;  1AYU A;  4WZ0 A;  3CH3 X;  4N3W A;  1DEU A;  5H9M A;  1EWO A;  2M85 A;  2KGG A;  2FT2 A;  3MOR A;  1WEW A;  2F1G A;  2P7U A;  2YW8 A;  7PCK A;  2H0D B;  3N9O A;  1Y4H A;  4GNE A;  2FUU A;  4MVT A;  1NQC A;  1PXV A;  3BC3 A;  2KWN A;  3S3Q A;  1MDW A;  4FJC A;  4UI9 B;  5LKX A;  3O37 A;  3BPM A;  5TBN A;  2ZET C;  2FO5 A;  2NQI A;  1TL9 A;  3S3R A;  4DMY A;  2Y43 A;  1IWD A;  2L43 A;  2Y1N A;  5G0F A;  2M3H A;  1VJV A;  2M1R A;  3GL6 A;  5TAB A;  1BOR A;  1EWM A;  4L58 A;  4BS6 A;  2NAA A;  1GMY A;  3PBH A;  3KKU A;  3NG2 A;  4C9Z A;  1CS8 A;  2RI7 A;  2YJB A;  2DJF B;  1S4V A;  4V3K C;  2L5U A;  3WXG A;  1X4I A;  1U9W A;  4IC2 A;  2MD8 C;  1AIM A;  2MA6 A;  3BWK A;  3ERV A;  1AU4 A;  4YYQ A;  3PHD A;  1T1H A;  2BAY A;  2CT2 A;  4BS5 A;  4BQV A;  3P5W A;  4MZS A;  1WFK A;  3MTN A;  2YU4 A;  3HCS A;  4GNF A;  3OIS A;  2AS8 A;  3QT4 A;  4CDD B;  1JM7 A;  1AYV A;  3OF9 A;  2XU3 A;  4I7D A;  5H1V A;  4QH6 A;  4W5B A;  2DC7 A;  3O33 A;  4YAB A;  3ASL A;  3GCB A;  1HYJ A;  8PCH A;  1KHP A;  1U6G B;  1O0E A;  1CSB B;  5PAD A;  2ATO A;  5G04 B;  2E6R A;  4UP0 A;  3N3G A;  5DKA A;  5KH9 A;  2FTD A;  2FSA A;  1VFY A;  2K4D A;  3F75 A;  4GNG A;  4AXL A;  1YT7 A;  2HH5 A;  1JOC A;  1WEP A;  4LK9 A;  4BPV A;  3LRQ A;  2CSZ A;  2ACT A;  2DCC A;  3O34 A;  1MIR A;  1BP4 A;  2MNZ A;  4AYC A;  1V87 A;  1Q6K A;  2G8J A;  4A49 A;  4I07 A;  2VPB A;  3MHS A;  4GND A;  1GLO A;  4P6G A;  1LDK C;  2L80 A;  3EB6 A;  1MEM A;  4CDE B;  4YVA A;  1THE A;  2VNF A;  2DCB A;  3BPF A;  1U9Q X;  2PNX A;  2KU3 A;  2VJF B;  4LLB A;  2KR4 A;  4RY2 A;  2DC8 A;  2LDR A;  1AU3 A;  1MEG A;  4AUQ B;  3N9L A;  3P5X A;  4S3O B;  4OEM A;  3L11 A;  3SHB A;  2IPP B;  2DC9 A;  1AU2 A;  3U8E A;  4IC3 A;  3IOQ A;  4WZ3 B;  2VJE A;  5CVO B;  1Z6U A;  3GV4 A;  3USV A;  1TLO A;  1QMY A;  2VHS A;  3TNX A;  3O35 A;  5LKU A;  5B79 A;  2FYE A;  5J94 A;  3ZNI A;  5EF4 A;  1GCB A;  4NN2 A;  2PAD A;  4XUI A;  2ECG A;  4P6E A;  1MM2 A;  2L75 A;  2XEU A;  2YUC A;  1CJL A;  2Y5B A;  4YYV A;  1NB3 A;  3OVX A;  1QOL A;  3IMA A;  2BDZ A;  4YYW A;  3M63 A;  3T6R A;  1U9V A;  1XWH A;  2F6N A;  4I7C A;  1HYI A;  2YSM A;  1IYM A;  1AU0 A;  2G6D A;  3RVW A;  3OF8 A;  4QF3 A;  4DMX A;  4B7Y C;  1KFU L;  2FRA A;  1CHC A;  1AYW A;  3ZVZ B;  1PE6 A;  1WEM A;  4YAT A;  2H0D A;  5KH7 A;  2XB1 A;  3QJ3 A;  4ZDT A;  4MSX A;  4YC9 A;  3U5N A;  5C11 A;  1YK8 A;  5F02 A;  2YYR A;  1VYX A;  2MA5 A;  3QZV A;  4WA6 A;  3N4C A;  2C2L A;  3E1Z B;  2P0R A;  1A6R A;  2OP3 A;  3U5O A;  2OZ2 A;  4XR7 A;  2QIC A;  3N9M A;  3IEJ A;  3HWN A;  4PPE A;  3M62 A;  3DF0 A;  3IUT A;  2YHO A;  4LJN A;  3KWZ A;  3P5U A;  5AIT A;  1ZBD B;  1DF0 A;  4N8W A;  2ECW A;  2DCA A;  2VJE B;  5FB1 A;  4PTB A;  1CB5 A;  4I7B A;  1ITO A;  2VPD A;  2YJ2 A;  2ECJ A;  5G05 B;  2F42 A;  3F5V A;  4N4Z A;  2MD7 B;  3SOU A;  1NL6 A;  1PAD A;  4YYR A;  2QJ0 A;  3ZTG A;  1ZIV A;  2EGP A;  2LGV A;  4V3L C;  3KFQ A;  1F62 A;  2VPE A;  3KNV A;  2CKL B;  1MHW A;  1LDJ B;  1F29 A;  4X6H A;  2LQ6 A;  1PPN A;  1WIM A;  2ECN A;  5I3L A;  2G7Y A;  5B77 A;  1YK7 A;  2VP7 A;  3IV2 A;  2XU5 A;  2NQD B;  2DX8 A;  3LQH A;  2D8S A;  1CTE A;  1CQD A;  5LCW B;  2YRE A;  4AXM A;  1HUC B;  2VHF A;  4QBB A;  1PIP A;  2CIO A;  2EA6 A;  4B86 C;  3B79 A;  4PP1 A;  4ZQL A;  4AYC B;  2AYO A;  2OUL A;  4KLB A;  2ARY A;  4R8P K;  1ME3 A;  1Y08 A;  3K9M A;  5CHT A;  3KQI A;  4YV8 A;  1KFX L;  2F7D A;  3U5M A;  4F52 B;  2FUD A;  2PNS A;  2AU1 A;  1EWL A;  1ME4 A;  2MT5 A;  3CH2 X;  3BCN A;  2LXH C;  3WXE A;  1QXP A;  2Y1M A;  1E4U A;  3RVX A;  2PRE A;  5J3X A;  4L7X A;  3U5P A;  1QDQ A;  3H89 A;  1AEC A;  3H6S A;  2OXQ C;  5B75 A;  3RPG C;  5JH3 A;  2JQG R;  3O0U A;  3O1G A;  2P86 A;  3M99 A;  2LV9 A;  4ZUX U;  1JM7 B;  9PAP A;  2KWK A;  3PUR A;  2M6M A;  4W5C A;  3SOX A;  3HTK C;  1FP0 A;  4LKA A;  4FK5 A;  3RTR B;  2XU1 A;  2EOD A;  3KSE A;  4YAX A;  1K3B B;  1U9X A;  5K16 A;  1X4J A;  1KXR A;  1PCI A;  2LRI C;  4CA1 A;  2YUR A; 
#chains in the Genus database with same CATH topology
 1WEQ A;  2MNY A;  2CKL A;  2EXU A;  3SUB A;  1RMD A;  3PUQ A;  3LQI A;  2JQF R;  2MUM A;  1POP A;  3I2D A;  3LQJ A;  1YZB A;  1WEN A;  2B0O E;  5D1K B;  4Q6F A;  3ZPV E;  4OVZ A;  2HDP A;  3N9N A;  1YVB A;  1U5I A;  2R9M A;  4GB0 A;  4BOQ A;  4X6I A;  3O70 A;  4YYS A;  2IBI A;  3C9E A;  3E2D A;  4MZO A;  4YBT A;  5B8D A;  1EF7 A;  1WGM A;  2G8E A;  1GEC E;  2I50 A;  4P5O B;  2PUY A;  1WEU A;  4UP5 A;  2UZG A;  5FB0 A;  2FRQ A;  2YT5 A;  4YYU A;  3LDY A;  4PI3 A;  1NB5 A;  3L1Z B;  2BTW A;  4FO9 A;  2G43 A;  4OEL A;  1WEO A;  4AP4 A;  3BBA A;  2FUI A;  2KGI A;  4YBS A;  1ICF A;  2DCD A;  2K16 A;  3T7L A;  2G6Q A;  3H8B A;  3HCT A;  5TDW A;  2LGL A;  3O7A A;  2NQG A;  5JG6 A;  3PDF A;  4X6J A;  2ECI A;  5CHV A;  2B1N A;  3RVV A;  3CBK A;  2AUZ A;  1ATK A;  5H1U A;  1DCQ A;  3KDE C;  2AN6 A;  4BHW A;  2LAU A;  4K7C A;  3DQV R;  2AYN A;  2JTC A;  1CV8 A;  2KKX A;  1MS6 A;  2LN0 A;  1VD4 A;  3DPL R;  3HHA A;  1BY8 A;  5KO3 A;  1UKF A;  4N79 A;  5A24 A;  2YJ9 A;  2C0Y A;  3HD3 A;  2QIZ A;  2R9F A;  2BDL A;  4MM3 B;  3C5K A;  1X4U A;  2YJC A;  3D6S A;  2Y6E A;  2NQA A;  2E6S A;  5C13 A;  1F2A A;  2H7J A;  4HWY A;  3AI8 A;  5TDR A;  2CRW A;  4O64 A;  2DC6 A;  2R9C A;  2WBF X;  2JMI A;  4W4U A;  4A0C D;  2B1M A;  3FJU B;  2E02 A;  2XU4 A;  1F2B A;  4I05 A;  4AVX A;  1TU6 A;  2KWJ A;  2LXP C;  3L1X A;  5TRB A;  2F6J A;  3SOW A;  2YSJ A;  2E03 A;  2FQ9 A;  4Q8G A;  2UZJ A;  1WIL A;  4YAD A;  2DJG B;  3ZUA A;  1PBH A;  5JA7 A;  4TKP B;  4N4F A;  3VK6 A;  3N3K A;  4G54 A;  1BGO A;  1VSN A;  2YJ8 A;  3V6E A;  3IHP A;  4R7E A;  5KH3 A;  1CPJ A;  2YQL A;  4XI1 A;  5CVM A;  2KWO A;  3MHH A;  2DZZ A;  4CZW A;  1NPZ A;  1NLJ A;  4A4C A;  2DZY A;  3CBJ A;  3E9S A;  5H1T A;  4BBQ A;  2HHN A;  2J7Q A;  2KFT A;  1FBV A;  3H7D A;  2ECT A;  4PAD A;  2HXZ A;  2LGK A;  2DSM A;  5D1M B;  3QSD A;  2JM3 A;  1G25 A;  3RPG B;  1K2F A;  1KHQ A;  2E01 A;  3OVZ A;  2JRJ A;  2CRR A;  3LFY A;  6PAD A;  4BSQ A;  2JMD A;  1M6D A;  3N9Q A;  2KIZ A;  2XOC A;  3ZPV 1;  5FEY A;  2AVW A;  2CSY A;  4XZX A;  1SNK A;  4FIP A;  1MM3 A;  3KW9 A;  1WEE A;  2E00 A;  3I06 A;  2JUN A;  4X3G A;  2L0B A;  5B76 A;  4I04 A;  2YHN A;  4QRX A;  5DIN A;  1STF E;  2LGG A;  2JMJ A;  4WZ2 A;  1SP4 B;  2VPG A;  4YBM A;  3M7K A;  1WES A;  2YQM A;  1MBM A;  4QRV A;  3K24 A;  2EGM A;  2YVR A;  1PPD A;  4MI7 A;  1WEV A;  2OWA A;  1CVZ A;  4CDC B;  4LAD B;  3ZYQ A;  2R6N A;  2G45 A;  3O36 A;  3LVQ E;  2K1J A;  5CVN B;  4A4B A;  3V43 A;  3PW3 A;  1YAL A;  5EYA F;  2C2V S;  1EWP A;  2VJF A;  3KWB X;  1DVP A;  3I3T A;  2M13 A;  2ECV A;  2O6X A;  4CCG X;  4Z0O A;  5SVI B;  2PBH A;  3BOW A;  3V6C A;  3C6W A;  5FER A;  2RSD A;  4Z0R A;  5D1L B;  2AUX A;  3K8U A;  1N87 A;  2GFO A;  2R9O A;  1Z2Q A;  2HD5 A;  2R9N A;  4QRG A;  3NHE A;  3HCU A;  3HHI A;  1WE9 A;  2AIM A;  2FFW A;  5LKT A;  4QF2 A;  5LKZ A;  3BY4 A;  1FH0 A;  2KE1 A;  3KV5 A;  3KV6 A;  2CB5 A;  3RNV A;  3PNR A;  3MJ5 A;  1F2C A;  1BQI A;  2MIQ A;  3LJU X;  3H8C A;  1Z60 A;  5FPW A;  2KRE A;  2K17 A;  4S3O C;  1ZCM A;  1PPO A;  4Q8H A;  2IDA A;  3ZVY A;  3MP2 A;  1JQP A;  4R2Y A;  3P5V A;  4CDF B;  2GHU A;  4PP2 E;  4RF0 A;  3PLW A;  3FL2 A;  5AIU A;  1PPP A;  1XKG A;  5EGW A;  2HYE D;  3W31 A;  3FM8 C;  3WXF A;  4PT5 A;  5B78 A;  1X9Y A;  3N9P A;  4P16 A;  3KX1 A;  2KYU A;  5K3Q A;  3LXS A;  3PHU A;  3EB5 A;  1AYU A;  4WZ0 A;  3CH3 X;  4N3W A;  1DEU A;  5H9M A;  4F1P A;  4HXD B;  1EWO A;  2XOY A;  2M85 A;  2KGG A;  2FT2 A;  3MOR A;  1WEW A;  3BB7 A;  2F1G A;  2P7U A;  2YW8 A;  7PCK A;  2H0D B;  3N9O A;  3DWD A;  1Y4H A;  4GNE A;  2FUU A;  4MVT A;  1NQC A;  1PXV A;  2J7Q C;  3BC3 A;  2KWN A;  3S3Q A;  2CSV A;  1MDW A;  4FJC A;  4UI9 B;  3TMP A;  5LKX A;  3O37 A;  3BPM A;  5TBN A;  2ZET C;  2FO5 A;  2NQI A;  1TL9 A;  4R3D A;  3S3R A;  4DMY A;  2E61 A;  2Y43 A;  1IWD A;  2L43 A;  2Y1N A;  5G0F A;  3LVR E;  2M3H A;  3PT2 A;  1VJV A;  2M1R A;  3GL6 A;  5TAB A;  1BOR A;  4IUM A;  1EWM A;  4L58 A;  4RKX A;  4BS6 A;  2NAA A;  2D8U A;  1GMY A;  3PBH A;  3KKU A;  3NG2 A;  4C9Z A;  1CS8 A;  2BTW B;  2RI7 A;  2YJB A;  2DJF B;  1S4V A;  4V3K C;  2L5U A;  3WXG A;  1X4I A;  1U9W A;  4IC2 A;  2MD8 C;  1AIM A;  2MA6 A;  3BWK A;  3ERV A;  1AU4 A;  4YYQ A;  3PHD A;  1T1H A;  2BAY A;  2CT2 A;  4REZ A;  3MTV A;  4BS5 A;  4BQV A;  3P5W A;  4MZS A;  1WFK A;  3MTN A;  2YU4 A;  3HCS A;  4GNF A;  3OIS A;  2AS8 A;  3QT4 A;  4CDD B;  1JM7 A;  3PRP A;  1AYV A;  3OF9 A;  2XU3 A;  4I7D A;  5H1V A;  4QH6 A;  4W5B A;  2RR4 A;  2DC7 A;  3O33 A;  4YAB A;  3ASL A;  3GCB A;  1HYJ A;  3FAO A;  8PCH A;  1KHP A;  1U6G B;  1O0E A;  1CSB B;  5PAD A;  2ATO A;  5G04 B;  2E6R A;  4UP0 A;  3N3G A;  5DKA A;  5KH9 A;  2FTD A;  2FSA A;  1VFY A;  2K4D A;  3F75 A;  4GNG A;  4AXL A;  1YT7 A;  3PRM A;  2HH5 A;  3JUE A;  1JOC A;  1WEP A;  2DJA A;  4LK9 A;  4BPV A;  3LRQ A;  2IQJ A;  2CSZ A;  2ACT A;  2DCC A;  3C0R A;  3O34 A;  1MIR A;  1BP4 A;  2MNZ A;  4AYC A;  1DKI A;  4A5U A;  2XOZ A;  1V87 A;  4BOZ A;  1Q6K A;  2G8J A;  4RNA A;  4A49 A;  4I07 A;  2VPB A;  3DDT A;  3MHS A;  4ZTB A;  4GND A;  2KKY A;  1GLO A;  4P6G A;  1LDK C;  2L80 A;  3EB6 A;  3O47 A;  1MEM A;  4CDE B;  4YVA A;  1THE A;  2VNF A;  2DCB A;  3BPF A;  1U9Q X;  2PNX A;  2KU3 A;  2VJF B;  4LLB A;  2KR4 A;  4RY2 A;  2DC8 A;  2DOS A;  2LDR A;  1AU3 A;  1MEG A;  4AUQ B;  3N9L A;  3P5X A;  4OW0 A;  4S3O B;  4OEM A;  3L11 A;  3SHB A;  2IPP B;  2DC9 A;  1AU2 A;  4RF1 A;  4WUR A;  3U8E A;  4IC3 A;  3IOQ A;  4WZ3 B;  2VJE A;  5CVO B;  3PHW A;  1Z6U A;  3GV4 A;  3USV A;  1TLO A;  1QMY A;  2VHS A;  3OQC A;  3TNX A;  3O35 A;  5LKU A;  5B79 A;  2FYE A;  5SVX A;  5J94 A;  3ZNI A;  5EF4 A;  1GCB A;  4NN2 A;  2PAD A;  4XUI A;  2ECG A;  4P6E A;  1MM2 A;  2L75 A;  2XEU A;  2YUC A;  1CJL A;  2Y5B A;  3MDB C;  1NB3 A;  4YYV A;  3OVX A;  1QOL A;  3IMA A;  3IFU A;  2BDZ A;  4YYW A;  3M63 A;  3T6R A;  1U9V A;  1XWH A;  2F6N A;  4I7C A;  1HYI A;  2YSM A;  3B21 A;  3O65 A;  2FD4 A;  1IYM A;  1AU0 A;  2G6D A;  3RVW A;  4D8E A;  3OF8 A;  4QF3 A;  4DMX A;  4B7Y C;  5E6J A;  1KFU L;  2FRA A;  1CHC A;  1AYW A;  3ZVZ B;  1PE6 A;  2H0D A;  4YAT A;  1WEM A;  3PSE A;  5KH7 A;  2MKE A;  2XB1 A;  3QJ3 A;  4ZDT A;  4MSX A;  4YC9 A;  3U5N A;  4BOU A;  2BU3 A;  5C11 A;  1YK8 A;  2JRI A;  5JZE A;  3TRK A;  5F02 A;  2YYR A;  1VYX A;  2MA5 A;  3QZV A;  4WA6 A;  3N4C A;  3W30 A;  3FEH A;  2C2L A;  3E1Z B;  2P0R A;  1A6R A;  2OP3 A;  3U5O A;  2OZ2 A;  4XR7 A;  2QIC A;  3N9M A;  3IEJ A;  3HWN A;  4PPE A;  4IP3 A;  3M62 A;  3DF0 A;  3IUT A;  2YHO A;  4LJN A;  3KWZ A;  3P5U A;  5AIT A;  1ZBD B;  4GUA A;  1DF0 A;  4N8W A;  2ECW A;  2DCA A;  2VJE B;  5FB1 A;  4PTB A;  4O62 A;  1CB5 A;  3FAN A;  4I7B A;  1ITO A;  2CON A;  2VPD A;  2YJ2 A;  2ECJ A;  5G05 B;  2F42 A;  3F5V A;  4N4Z A;  2MD7 B;  3SOU A;  1NL6 A;  1PAD A;  4YYR A;  2QJ0 A;  3ZTG A;  3T9K A;  1ZIV A;  2EGP A;  2LGV A;  4V3L C;  3KFQ A;  4D8I A;  4QQ4 A;  1F62 A;  3ZNH A;  2VPE A;  3KNV A;  2CKL B;  1MHW A;  1LDJ B;  1F29 A;  4X6H A;  2LQ6 A;  1PPN A;  5SVI A;  1WIM A;  2ECN A;  5I3L A;  1PVJ A;  2G7Y A;  5B77 A;  1YK7 A;  4D8B A;  2XP0 A;  2VP7 A;  3IV2 A;  2XU5 A;  2NQD B;  2DX8 A;  3LQH A;  2D8S A;  5EZS A;  1CTE A;  1CQD A;  5LCW B;  5SVY A;  2YRE A;  4AXM A;  1HUC B;  2VHF A;  4QBB A;  2Z84 A;  1PIP A;  2CIO A;  2EA6 A;  4B86 C;  3B79 A;  4H9D A;  4ZQL A;  4PP1 A;  4AYC B;  2AYO A;  2OUL A;  4KLB A;  2ARY A;  4OGC A;  4R8P K;  1ME3 A;  1Y08 A;  3K9M A;  5CHT A;  3KQI A;  4YV8 A;  2AGA A;  1KFX L;  2L7P A;  2F7D A;  3U5M A;  2P57 A;  4F52 B;  2FUD A;  2PNS A;  2AU1 A;  1EWL A;  1ME4 A;  2MT5 A;  4OVZ B;  3CH2 X;  3BCN A;  2LXH C;  3WXE A;  1QXP A;  2Y1M A;  4BOP A;  1E4U A;  3RVX A;  2PRE A;  5J3X A;  4L7X A;  3U5P A;  1QDQ A;  3H89 A;  1AEC A;  3H6S A;  2FE8 A;  2OXQ C;  5B75 A;  3RPG C;  5JH3 A;  2JQG R;  3O0U A;  3Q1D A;  3O1G A;  2P86 A;  3M99 A;  2LV9 A;  4ZUX U;  1JM7 B;  9PAP A;  2KWK A;  4M0W A;  3PUR A;  4OGE A;  2M6M A;  4W5C A;  3H7H A;  3SOX A;  3HTK C;  1FP0 A;  2HWK A;  4LKA A;  4FK5 A;  3RTR B;  2XU1 A;  2EOD A;  5EZQ A;  3KSE A;  4YAX A;  1K3B B;  4BOS A;  1U9X A;  5K16 A;  1X4J A;  1KXR A;  1PCI A;  2LRI C;  4CA1 A;  3PHX A;  2YUR A; 
#chains in the Genus database with same CATH homology
 1WEQ A;  2MNY A;  2CKL A;  1RMD A;  3PUQ A;  3LQI A;  2JQF R;  2MUM A;  1POP A;  3I2D A;  3LQJ A;  1WEN A;  5D1K B;  4Q6F A;  3ZPV E;  2HDP A;  3N9N A;  1YVB A;  4GUZ A;  1U5I A;  2R9M A;  4GB0 A;  4X6I A;  3O70 A;  4YYS A;  2IBI A;  3C9E A;  4MZO A;  4YBT A;  5B8D A;  1EF7 A;  1WGM A;  1E2T A;  2G8E A;  1GEC E;  2I50 A;  4P5O B;  2PUY A;  1WEU A;  4UP5 A;  2UZG A;  5FB0 A;  2FRQ A;  2YT5 A;  4YYU A;  4PI3 A;  1NB5 A;  4C5P A;  3L1Z B;  4FO9 A;  2G43 A;  4OEL A;  1WEO A;  4AP4 A;  2FUI A;  2KGI A;  4YBS A;  1ICF A;  2DCD A;  2K16 A;  4B55 A;  3T7L A;  2G6Q A;  3H8B A;  3HCT A;  5TDW A;  2LGL A;  3O7A A;  2NQG A;  5JG6 A;  3PDF A;  4X6J A;  2ECI A;  5CHV A;  2B1N A;  3RVV A;  3CBK A;  2AUZ A;  1ATK A;  5H1U A;  2AN6 A;  4BHW A;  4K7C A;  3DQV R;  2AYN A;  1CV8 A;  1MS6 A;  2LN0 A;  1VD4 A;  3DPL R;  3HHA A;  4NV7 A;  1BY8 A;  4N79 A;  5A24 A;  2YJ9 A;  2C0Y A;  3HD3 A;  2QIZ A;  2R9F A;  2BDL A;  3C5K A;  1X4U A;  2YJC A;  3D6S A;  2Y6E A;  2NQA A;  2E6S A;  5C13 A;  1F2A A;  2H7J A;  4HWY A;  3AI8 A;  5TDR A;  4O64 A;  2DC6 A;  2R9C A;  2WBF X;  2JMI A;  4W4U A;  4A0C D;  2B1M A;  2E02 A;  2XU4 A;  1F2B A;  4I05 A;  4AVX A;  1TU6 A;  2KWJ A;  3SOW A;  2LXP C;  3L1X A;  2F6J A;  5TRB A;  2YSJ A;  2E03 A;  2FQ9 A;  4Q8G A;  1WIL A;  4YAD A;  2DJG B;  3ZUA A;  1PBH A;  5JA7 A;  4TKP B;  4N4F A;  3VK6 A;  3N3K A;  4G54 A;  1BGO A;  1VSN A;  2YJ8 A;  3V6E A;  3IHP A;  4R7E A;  5KH3 A;  1CPJ A;  2YQL A;  4XI1 A;  5CVM A;  2KWO A;  3MHH A;  2DZZ A;  4CZW A;  1NPZ A;  1NLJ A;  4A4C A;  2DZY A;  3CBJ A;  5H1T A;  4BBQ A;  2HHN A;  2KFT A;  1FBV A;  3H7D A;  2ECT A;  4PAD A;  2HXZ A;  2LGK A;  5D1M B;  3QSD A;  1G25 A;  3RPG B;  1K2F A;  1KHQ A;  2E01 A;  3OVZ A;  2JRJ A;  3LFY A;  6PAD A;  4BSQ A;  2JMD A;  1M6D A;  3N9Q A;  2KIZ A;  3ZPV 1;  5FEY A;  2AVW A;  2CSY A;  1SNK A;  4FIP A;  1MM3 A;  3KW9 A;  1WEE A;  2E00 A;  3I06 A;  4X3G A;  2L0B A;  5B76 A;  4I04 A;  2YHN A;  4QRX A;  5DIN A;  1STF E;  2LGG A;  2JMJ A;  4WZ2 A;  1SP4 B;  2VPG A;  4YBM A;  1WES A;  2YQM A;  4QRV A;  3K24 A;  4NV8 A;  1PPD A;  1WEV A;  1CVZ A;  4CDC B;  4LAD B;  3ZYQ A;  2R6N A;  2G45 A;  3O36 A;  2K1J A;  5CVN B;  4A4B A;  3V43 A;  3PW3 A;  1YAL A;  5EYA F;  2C2V S;  1EWP A;  2VJF A;  3KWB X;  1DVP A;  3I3T A;  2ECV A;  2O6X A;  4CCG X;  2PBH A;  3BOW A;  3V6C A;  3C6W A;  5FER A;  2RSD A;  2AUX A;  5D1L B;  3K8U A;  1N87 A;  2GFO A;  2R9O A;  1Z2Q A;  2VFB A;  2HD5 A;  2R9N A;  4QRG A;  3NHE A;  3HCU A;  3HHI A;  1WE9 A;  2AIM A;  5LKT A;  4QF2 A;  5LKZ A;  1FH0 A;  2KE1 A;  3KV5 A;  3KV6 A;  2CB5 A;  3D9W A;  3PNR A;  1F2C A;  1BQI A;  2MIQ A;  3H8C A;  1Z60 A;  5FPW A;  2KRE A;  2K17 A;  4S3O C;  1ZCM A;  1PPO A;  4Q8H A;  2IDA A;  3ZVY A;  1JQP A;  4R2Y A;  3P5V A;  4CDF B;  2GHU A;  4PP2 E;  3FL2 A;  5AIU A;  1PPP A;  1XKG A;  5EGW A;  2HYE D;  3WXF A;  5B78 A;  1X9Y A;  3N9P A;  3KX1 A;  2KYU A;  3LXS A;  3EB5 A;  1AYU A;  1GX3 A;  4WZ0 A;  3CH3 X;  4N3W A;  1DEU A;  5H9M A;  1EWO A;  2M85 A;  2KGG A;  2FT2 A;  3MOR A;  1WEW A;  2F1G A;  2P7U A;  2YW8 A;  7PCK A;  2H0D B;  3N9O A;  1Y4H A;  4GNE A;  2FUU A;  4MVT A;  1NQC A;  1PXV A;  3BC3 A;  2KWN A;  3S3Q A;  1MDW A;  4FJC A;  4UI9 B;  5LKX A;  3O37 A;  3BPM A;  5TBN A;  2ZET C;  2FO5 A;  2NQI A;  1TL9 A;  3S3R A;  4DMY A;  2Y43 A;  1IWD A;  2L43 A;  2Y1N A;  5G0F A;  2M3H A;  1VJV A;  2M1R A;  3GL6 A;  5TAB A;  1BOR A;  1W5R A;  1EWM A;  4L58 A;  4BS6 A;  2NAA A;  1GMY A;  3PBH A;  3KKU A;  3NG2 A;  4C9Z A;  1CS8 A;  2RI7 A;  2YJB A;  2DJF B;  1S4V A;  4V3K C;  2L5U A;  1W4T A;  1X4I A;  1U9W A;  3WXG A;  4IC2 A;  2MD8 C;  1AIM A;  2MA6 A;  3BWK A;  3ERV A;  1AU4 A;  4YYQ A;  3PHD A;  1T1H A;  2BAY A;  2CT2 A;  4BS5 A;  4BQV A;  3P5W A;  4MZS A;  1WFK A;  3MTN A;  2YU4 A;  3HCS A;  4GNF A;  3OIS A;  2AS8 A;  3QT4 A;  4CDD B;  1JM7 A;  1AYV A;  3OF9 A;  2XU3 A;  4I7D A;  5H1V A;  4QH6 A;  4W5B A;  2DC7 A;  3O33 A;  4YAB A;  3ASL A;  3GCB A;  1HYJ A;  8PCH A;  1KHP A;  1U6G B;  1O0E A;  1CSB B;  5PAD A;  2ATO A;  4BGF A;  5G04 B;  2E6R A;  4UP0 A;  3N3G A;  5DKA A;  5KH9 A;  2FTD A;  2FSA A;  1VFY A;  2K4D A;  3F75 A;  4GNG A;  4AXL A;  1YT7 A;  2HH5 A;  1JOC A;  1WEP A;  4LK9 A;  4BPV A;  3LRQ A;  2CSZ A;  2ACT A;  2DCC A;  3O34 A;  1MIR A;  1BP4 A;  2MNZ A;  4AYC A;  1V87 A;  1Q6K A;  2G8J A;  4A49 A;  4I07 A;  2VPB A;  3MHS A;  4GND A;  1GLO A;  4P6G A;  1LDK C;  2L80 A;  3EB6 A;  1MEM A;  4CDE B;  4YVA A;  1THE A;  2VNF A;  2DCB A;  3BPF A;  1U9Q X;  2PNX A;  2KU3 A;  2VJF B;  4LLB A;  2KR4 A;  4RY2 A;  2DC8 A;  2LDR A;  1AU3 A;  1MEG A;  4AUQ B;  3N9L A;  3P5X A;  4S3O B;  4OEM A;  3L11 A;  3SHB A;  2IPP B;  3LTW A;  2DC9 A;  1AU2 A;  3U8E A;  4IC3 A;  3IOQ A;  4WZ3 B;  2VJE A;  5CVO B;  1Z6U A;  3GV4 A;  3USV A;  1TLO A;  1QMY A;  2BSZ A;  2VHS A;  3TNX A;  3O35 A;  5LKU A;  5B79 A;  2FYE A;  5J94 A;  3ZNI A;  5EF4 A;  1GCB A;  4NN2 A;  2PAD A;  4XUI A;  2ECG A;  4P6E A;  1MM2 A;  2L75 A;  2XEU A;  2YUC A;  1CJL A;  2Y5B A;  4YYV A;  1NB3 A;  3OVX A;  1QOL A;  3IMA A;  2BDZ A;  4YYW A;  3M63 A;  3T6R A;  1U9V A;  1XWH A;  2F6N A;  4I7C A;  1HYI A;  2YSM A;  1IYM A;  1AU0 A;  2G6D A;  3RVW A;  3OF8 A;  4QF3 A;  4DMX A;  4B7Y C;  1KFU L;  2FRA A;  1CHC A;  1AYW A;  3ZVZ B;  1PE6 A;  1WEM A;  4YAT A;  2H0D A;  5KH7 A;  2XB1 A;  3QJ3 A;  4ZDT A;  4MSX A;  4YC9 A;  3U5N A;  5C11 A;  1YK8 A;  5F02 A;  2YYR A;  1VYX A;  2MA5 A;  3QZV A;  4WA6 A;  3N4C A;  2C2L A;  3E1Z B;  2P0R A;  1A6R A;  2OP3 A;  3U5O A;  2OZ2 A;  4XR7 A;  2QIC A;  3N9M A;  3IEJ A;  3HWN A;  4PPE A;  3M62 A;  3DF0 A;  3IUT A;  2YHO A;  4LJN A;  3KWZ A;  3P5U A;  5AIT A;  1ZBD B;  1DF0 A;  4N8W A;  2ECW A;  2DCA A;  2VJE B;  5FB1 A;  4PTB A;  1CB5 A;  4I7B A;  2VFC A;  1ITO A;  2VPD A;  2YJ2 A;  2ECJ A;  5G05 B;  2F42 A;  3F5V A;  4N4Z A;  2MD7 B;  3SOU A;  1NL6 A;  1PAD A;  4YYR A;  2QJ0 A;  3ZTG A;  1ZIV A;  2EGP A;  2LGV A;  4V3L C;  3KFQ A;  1F62 A;  2VPE A;  3KNV A;  2CKL B;  1MHW A;  1LDJ B;  1F29 A;  4X6H A;  2LQ6 A;  1PPN A;  1W6F A;  1WIM A;  2ECN A;  5I3L A;  2G7Y A;  5B77 A;  1YK7 A;  2VP7 A;  3IV2 A;  2XU5 A;  2NQD B;  2DX8 A;  3LQH A;  2D8S A;  1CTE A;  1CQD A;  5LCW B;  2YRE A;  4AXM A;  1HUC B;  2VHF A;  4QBB A;  1PIP A;  2CIO A;  2EA6 A;  4B86 C;  3B79 A;  4PP1 A;  4ZQL A;  4AYC B;  2AYO A;  2OUL A;  4KLB A;  2ARY A;  4R8P K;  1ME3 A;  1Y08 A;  3K9M A;  5CHT A;  3KQI A;  4YV8 A;  1KFX L;  2F7D A;  3U5M A;  4F52 B;  2FUD A;  2PNS A;  2AU1 A;  1EWL A;  1ME4 A;  2MT5 A;  3CH2 X;  3BCN A;  2LXH C;  3WXE A;  1QXP A;  2Y1M A;  1E4U A;  3RVX A;  2PRE A;  5J3X A;  4L7X A;  3U5P A;  1QDQ A;  3H89 A;  1AEC A;  3H6S A;  2OXQ C;  5B75 A;  3RPG C;  5JH3 A;  2JQG R;  3O0U A;  3O1G A;  2P86 A;  3M99 A;  2LV9 A;  4ZUX U;  1JM7 B;  9PAP A;  2KWK A;  3PUR A;  2M6M A;  4W5C A;  3SOX A;  3HTK C;  1FP0 A;  4LKA A;  4FK5 A;  3RTR B;  2XU1 A;  2EOD A;  3KSE A;  4YAX A;  1K3B B;  1U9X A;  5K16 A;  1X4J A;  1KXR A;  1PCI A;  2LRI C;  4CA1 A;  2YUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...