1GLOA

Crystal structure of cys25ser mutant of human cathepsin s
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGASWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDLKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CATHEPSIN S
publication title Structure of a Cys25->Ser Mutant of Human Cathepsin Cathepsin S
pubmed doi rcsb
source organism Homo sapiens
total genus 72
structure length 217
sequence length 217
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2001-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1gloA00
2P0RA 3P5WA 5JA7A 2ATOA 3BCNA 3RVVA 2HHNA 2BDZA 1QDQA 4PP1A 3HHAA 3S3QA 4RY2A 4P6GA 1ME4A 1CSBB 1MIRA 1KFXL 3WXFA 2FRQA 1BY8A 5EGWA 3K9MA 4K7CA 3MHSA 4FK5A 5JH3A 2DJGB 4BQVA 1PE6A 1YALA 1ATKA 1DF0A 1PADA 1AYVA 3KX1A 2AYOA 4Q8HA 1IWDA 1NLJA 1PXVA 1CTEA 1PPNA 2AYNA 1U5IA 4WA6A 2FT2A 4ZUXU 2F7DA 3DF0A 3USVA 1Y08A 3KSEA 4QRGA 4YVAA 1AU3A 2Y5BA 5CVOB 3N3GA 4OEMA 3HWNA 2Y6EA 1TLOA 2NQAA 2WBFX 1ICFA 1PPDA 1S4VA 3S3RA 3I3TA 1ME3A 2OP3A 9PAPA 1GLOA 1CPJA 2E02A 4BS6A 1F2BA 2AIMA 1STFE 1YK7A 4OELA 4YYRA 4QH6A 4X6JA 4AXLA 1CJLA 1POPA 4XUIA 2JQFR 3OISA 6PADA 1A6RA 4W5BA 3RVWA 2PADA 2R9MA 1EF7A 3H7DA 1X9YA 1PBHA 3H6SA 2NQGA 2DC7A 4I04A 4DMYA 4KLBA 3WXEA 1BP4A 1U9QX 4QRVA 1QOLA 4PI3A 4YV8A 1PCIA 4I07A 5K16A 1F29A 4YYWA 2JQGR 3KWBX 3ZUAA 4CDCB 3OF8A 1EWLA 4FIPA 2DCAA 4CDEB 2AU1A 3PBHA 3CBJA 2H7JA 3BPFA 1K3BB 3OF9A 2B1MA 1MEGA 3CBKA 2YJ8A 4N4ZA 1GCBA 3QT4A 2GHUA 2AVWA 1MDWA 1CVZA 3M99A 1YVBA 2DCCA 1BQIA 3LFYA 1HUCB 1QMYA 2DC8A 2AS8A 1AECA 1EWPA 4YYSA 2FRAA 2YJ2A 1SNKA 4QBBA 1F2AA 1AU0A 3BOWA 4X6IA 1DEUA 3K24A 2R9NA 1AU2A 1O0EA 4AXMA 2G8JA 3RVXA 2E03A 2DCDA 3CH2X 1AU4A 1KHQA 1YK8A 3H8BA 7PCKA 3OVZA 1JQPA 5FPWA 1MHWA 3MORA 1EWMA 1AYUA 3MTNA 2FO5A 1AIMA 2ACTA 2YJ9A 2DC6A 2E00A 2DZZA 2G7YA 3QJ3A 3LXSA 2FUDA 3PW3A 3IUTA 3E1ZB 3PNRA 4PP2E 1NB3A 3KWZA 2BDLA 2F1GA 3O0UA 3TNXA 3OVXA 1CB5A 2E01A 4HWYA 1FH0A 1Y4HA 3AI8A 3GCBA 2PBHA 1SP4B 1THEA 3U8EA 3CH3X 4CDDB 4DMXA 3N4CA 3PDFA 3MHHA 1ITOA 3C9EA 2YJBA 4I05A 2AUZA 2XU5A 2FYEA 5F02A 2XU1A 3IHPA 2IPPB 1TU6A 1NL6A 2DZYA 3HD3A 4MZOA 2CB5A 2PNSA 3N3KA 4CZWA 2YJCA 4Q8GA 1YT7A 1MEMA 1KXRA 4YYVA 2XU4A 3BWKA 1NB5A 2FTDA 5CHTA 8PCHA 1TL9A 3H8CA 2NQDB 3IV2A 4W4UA 2DCBA 5A24A 1XKGA 2HH5A 1GECE 4YYUA 3WXGA 3D6SA 2CIOA 2VHSA 3F75A 1ZIVA 1MS6A 4P6EA 1BGOA 1M6DA 2NQIA 3KKUA 2O6XA 4BSQA 2HXZA 1AYWA 3O1GA 3KFQA 4PADA 3K8UA 2R9OA 4CDFB 1Q6KA 1KHPA 3BPMA 4YYQA 4XR7A 1CV8A 1EWOA 2G6DA 1CQDA 4MSXA 4X6HA 1U9WA 2B1NA 4QRXA 2P86A 2AUXA 1GMYA 2OZ2A 1KFUL 3HHIA 1NPZA 3NHEA 3B79A 2VHFA 2FQ9A 1ZCMA 4FJCA 2DJFB 5CVNB 1PIPA 1CS8A 5J94A 3F5VA 2IBIA 1PPPA 2R9FA 3P5XA 3QSDA 3H89A 4BPVA 2R6NA 1U9XA 3V6CA 3P5VA 2XU3A 5PADA 3I06A 4MZSA 2G8EA 1F2CA 2P7UA 4N8WA 2PREA 1PPOA 2OULA 3ERVA 4BS5A 3V6EA 3IMAA 3KW9A 2HD5A 1U9VA 5CHVA 5CVMA 3P5UA 1QXPA 2GFOA 3IEJA 4G54A 4N79A 5EF4A 2R9CA 1VSNA 4W5CA 2DC9A 3BC3A 2ARYA 1VJVA 1NQCA 2C0YA 3IOQA
chains in the Genus database with same CATH superfamily
2P0RA 3P5WA 5JA7A 2ATOA 3BCNA 5E6JA 3RVVA 2JRIA 2HHNA 2BDZA 1QDQA 4PP1A 3HHAA 3S3QA 4RF1A 4RY2A 4P6GA 1ME4A 1CSBB 1MIRA 1KFXL 3WXFA 2FRQA 1BY8A 5EGWA 3K9MA 4K7CA 3MHSA 4FK5A 5JH3A 2DJGB 2DOSA 4BQVA 1PE6A 1YALA 1ATKA 1DF0A 1PADA 1AYVA 3KX1A 3PHUA 2AYOA 3O65A 4Q8HA 1IWDA 3PHWA 1NLJA 1PXVA 3PSEA 4HXDB 1CTEA 1PPNA 2AYNA 1DKIA 1U5IA 4WA6A 2FT2A 4ZUXU 2F7DA 3DF0A 3USVA 1Y08A 3KSEA 4QRGA 2JTCA 3B21A 4YVAA 1AU3A 2Y5BA 5CVOB 3N3GA 4OEMA 3HWNA 2Y6EA 1TLOA 2NQAA 3BB7A 2WBFX 3OQCA 1ICFA 1PPDA 1S4VA 3S3RA 3I3TA 1ME3A 2OP3A 2HWKA 9PAPA 3BBAA 1GLOA 1CPJA 2E02A 4BS6A 5EZSA 1F2BA 2AIMA 1STFE 1YK7A 4ZTBA 4OELA 4YYRA 4QH6A 4X6JA 4AXLA 3E9SA 1CJLA 1POPA 4XUIA 2JQFR 4MI7A 3OISA 6PADA 1A6RA 4W5BA 3RVWA 2PADA 2R9MA 1EF7A 3H7DA 4D8IA 1X9YA 1PBHA 3H6SA 4IP3A 2NQGA 1UKFA 4A5UA 2AGAA 2DC7A 4I04A 4DMYA 4KLBA 2BTWB 4RKXA 3WXEA 1BP4A 1U9QX 4QRVA 1QOLA 4PI3A 4YV8A 1PCIA 4I07A 5K16A 1F29A 2FE8A 4YYWA 2JQGR 3KWBX 3ZUAA 4CDCB 3OF8A 1EWLA 4FIPA 4BOUA 4D8BA 2DCAA 4CDEB 2AU1A 3PBHA 3CBJA 2H7JA 3BPFA 4R3DA 1K3BB 3OF9A 2B1MA 1MEGA 3CBKA 2YJ8A 4N4ZA 1GCBA 3QT4A 3W30A 2GHUA 2AVWA 3TMPA 1MDWA 1CVZA 3M99A 4PT5A 1YVBA 4IUMA 2DCCA 1BQIA 3LFYA 1HUCB 1QMYA 2DC8A 2AS8A 2Z84A 1AECA 1EWPA 4BOZA 4YYSA 2FRAA 2YJ2A 1SNKA 4QBBA 1F2AA 1AU0A 3BOWA 3PRPA 3RNVA 4X6IA 1DEUA 3K24A 1YZBA 2R9NA 1AU2A 1O0EA 4AXMA 2G8JA 3RVXA 2E03A 5KO3A 2DCDA 3CH2X 1AU4A 3MJ5A 1KHQA 1YK8A 3H8BA 7PCKA 3OVZA 1JQPA 1PVJA 5JZEA 5FPWA 1MHWA 3MORA 1EWMA 1AYUA 3MTNA 2FO5A 1AIMA 2ACTA 2YJ9A 4BOQA 2DC6A 2E00A 3IFUA 2DZZA 2G7YA 3PT2A 3QJ3A 3LXSA 2FUDA 3PW3A 3IUTA 3E1ZB 3PNRA 4PP2E 5EZQA 4OVZA 1NB3A 3KWZA 2BDLA 2F1GA 3O0UA 3TNXA 3OVXA 1CB5A 2E01A 4HWYA 1FH0A 4WURA 1Y4HA 4RF0A 3AI8A 3GCBA 2PBHA 1SP4B 1THEA 3U8EA 3CH3X 4CDDB 4DMXA 3N4CA 3PDFA 3MHHA 1ITOA 3C9EA 2YJBA 4I05A 2AUZA 2XU5A 2FYEA 5F02A 2XU1A 3IHPA 2IPPB 3C0RA 1TU6A 1NL6A 2DZYA 3HD3A 4MZOA 2CB5A 2PNSA 3N3KA 4CZWA 4XZXA 2YJCA 4Q8GA 1YT7A 1MEMA 1KXRA 4YYVA 2XU4A 3BWKA 1NB5A 2FTDA 4GUAA 5CHTA 8PCHA 1TL9A 3H8CA 4M0WA 2NQDB 3IV2A 4W4UA 2DCBA 3W31A 5A24A 1XKGA 2HH5A 3ZNHA 1GECE 4YYUA 3WXGA 3D6SA 2CIOA 3MTVA 2VHSA 3F75A 1ZIVA 1MS6A 4P6EA 1BGOA 1M6DA 2NQIA 3KKUA 2O6XA 4OW0A 4BSQA 2HXZA 1AYWA 3O1GA 3KFQA 4PADA 3PHXA 3K8UA 2R9OA 4CDFB 1Q6KA 1KHPA 3BPMA 4YYQA 4RNAA 4XR7A 1CV8A 1EWOA 2BU3A 2G6DA 1CQDA 4MM3B 4MSXA 4X6HA 1U9WA 2B1NA 4QRXA 2P86A 3PRMA 2AUXA 1GMYA 2OZ2A 4P16A 1KFUL 3HHIA 1NPZA 3NHEA 3B79A 2VHFA 2FQ9A 1ZCMA 4D8EA 4FJCA 2DJFB 5CVNB 1PIPA 3BY4A 1CS8A 5J94A 3F5VA 4BOPA 3MP2A 2IBIA 1PPPA 2R9FA 3P5XA 3QSDA 3H89A 3TRKA 4BPVA 2R6NA 1U9XA 3V6CA 3P5VA 2J7QC 2XU3A 5PADA 2J7QA 3I06A 2BTWA 4MZSA 2G8EA 4BOSA 1F2CA 2P7UA 4N8WA 4OVZB 2PREA 1PPOA 2OULA 3ERVA 4BS5A 3V6EA 3IMAA 3KW9A 2HD5A 1U9VA 5CHVA 5CVMA 3P5UA 1QXPA 2GFOA 3IEJA 4G54A 4N79A 5EF4A 2R9CA 1VSNA 4W5CA 2DC9A 3BC3A 2ARYA 1VJVA 2UZJA 1NQCA 2C0YA 3IOQA 4REZA
chains in the Genus database with same CATH topology
2P0RA 3P5WA 5JA7A 2ATOA 3BCNA 3RVVA 4B55A 2HHNA 2BDZA 1QDQA 4PP1A 3HHAA 3S3QA 4RY2A 4P6GA 1ME4A 1CSBB 1MIRA 1KFXL 3WXFA 2FRQA 1BY8A 5EGWA 3K9MA 4K7CA 3MHSA 4FK5A 5JH3A 2DJGB 4BQVA 1PE6A 1YALA 1ATKA 1DF0A 1PADA 1AYVA 3KX1A 2AYOA 4Q8HA 1IWDA 1NLJA 1PXVA 1CTEA 1PPNA 2AYNA 1U5IA 4WA6A 2FT2A 4ZUXU 2F7DA 3DF0A 3USVA 1Y08A 3KSEA 4QRGA 4YVAA 1AU3A 2Y5BA 5CVOB 2VFCA 3N3GA 4OEMA 3HWNA 2Y6EA 1TLOA 2NQAA 2WBFX 1ICFA 1PPDA 1S4VA 3S3RA 1W4TA 3I3TA 1ME3A 1W6FA 2OP3A 9PAPA 1GLOA 1CPJA 2E02A 4BS6A 1F2BA 2AIMA 1STFE 1YK7A 4OELA 4YYRA 4QH6A 4X6JA 4AXLA 1CJLA 1POPA 4XUIA 2JQFR 3OISA 6PADA 1A6RA 4W5BA 3RVWA 2PADA 2R9MA 1EF7A 3H7DA 1X9YA 1PBHA 3H6SA 2NQGA 2DC7A 4I04A 4DMYA 4KLBA 4BGFA 3WXEA 1BP4A 1U9QX 4QRVA 1QOLA 4PI3A 4YV8A 1PCIA 4I07A 5K16A 1F29A 4YYWA 2JQGR 3KWBX 3ZUAA 4CDCB 3OF8A 1EWLA 4FIPA 2DCAA 4CDEB 2AU1A 3PBHA 3CBJA 2H7JA 3BPFA 1K3BB 3OF9A 2B1MA 1MEGA 3CBKA 2YJ8A 4N4ZA 1GCBA 3QT4A 2GHUA 2AVWA 1MDWA 1CVZA 3M99A 4NV7A 1YVBA 3LTWA 2DCCA 1BQIA 3LFYA 1HUCB 1QMYA 2DC8A 2AS8A 1AECA 1EWPA 4YYSA 2FRAA 2YJ2A 1SNKA 4QBBA 1F2AA 1AU0A 3BOWA 4X6IA 1DEUA 3K24A 2R9NA 1AU2A 4NV8A 1O0EA 4AXMA 1W5RA 2G8JA 3RVXA 2E03A 2DCDA 3CH2X 1AU4A 1KHQA 1YK8A 3H8BA 7PCKA 3OVZA 1JQPA 5FPWA 1MHWA 3MORA 1EWMA 1AYUA 3MTNA 2FO5A 1AIMA 2ACTA 2YJ9A 2DC6A 2E00A 2DZZA 2G7YA 3QJ3A 3LXSA 2FUDA 3PW3A 3IUTA 3E1ZB 3PNRA 4PP2E 1NB3A 3KWZA 2BDLA 2F1GA 3O0UA 3TNXA 3OVXA 1CB5A 2E01A 4HWYA 1FH0A 1Y4HA 3AI8A 3GCBA 2PBHA 1SP4B 1THEA 3U8EA 3CH3X 4CDDB 4DMXA 3N4CA 3PDFA 3MHHA 1ITOA 3C9EA 2YJBA 4I05A 2AUZA 2XU5A 2FYEA 5F02A 2XU1A 3IHPA 2IPPB 1TU6A 1NL6A 2DZYA 3HD3A 4MZOA 2CB5A 2PNSA 3N3KA 4CZWA 2YJCA 4Q8GA 1YT7A 1MEMA 1KXRA 4YYVA 2XU4A 3BWKA 1NB5A 2FTDA 5CHTA 8PCHA 1TL9A 3H8CA 2NQDB 3IV2A 4W4UA 2DCBA 5A24A 1XKGA 2HH5A 2BSZA 1GECE 4YYUA 3WXGA 3D6SA 2CIOA 2VHSA 3F75A 1ZIVA 1MS6A 4P6EA 1BGOA 1M6DA 2NQIA 3KKUA 2O6XA 4BSQA 2HXZA 1AYWA 3O1GA 3KFQA 4PADA 3K8UA 2R9OA 4CDFB 1Q6KA 1KHPA 3BPMA 4YYQA 1GX3A 4XR7A 1CV8A 1EWOA 2G6DA 1CQDA 4MSXA 4X6HA 1U9WA 2B1NA 4QRXA 2P86A 3D9WA 2AUXA 1GMYA 2OZ2A 1KFUL 4C5PA 3HHIA 1NPZA 3NHEA 3B79A 2VHFA 2FQ9A 1ZCMA 4FJCA 2DJFB 5CVNB 1PIPA 1E2TA 1CS8A 5J94A 3F5VA 2IBIA 1PPPA 2R9FA 3P5XA 3QSDA 2VFBA 3H89A 4BPVA 2R6NA 1U9XA 3V6CA 3P5VA 2XU3A 5PADA 3I06A 4MZSA 2G8EA 1F2CA 2P7UA 4N8WA 2PREA 3ERVA 1PPOA 2OULA 4BS5A 3V6EA 4GUZA 3IMAA 3KW9A 2HD5A 1U9VA 5CHVA 5CVMA 3P5UA 1QXPA 2GFOA 3IEJA 4G54A 4N79A 5EF4A 2R9CA 1VSNA 4W5CA 2DC9A 3BC3A 2ARYA 1VJVA 1NQCA 2C0YA 3IOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0R A;  3P5W A;  5JA7 A;  2ATO A;  3BCN A;  3RVV A;  2HHN A;  2BDZ A;  1QDQ A;  4PP1 A;  3HHA A;  3S3Q A;  4RY2 A;  4P6G A;  1ME4 A;  1CSB B;  1MIR A;  1KFX L;  3WXF A;  2FRQ A;  1BY8 A;  5EGW A;  3K9M A;  4K7C A;  3MHS A;  4FK5 A;  5JH3 A;  2DJG B;  4BQV A;  1PE6 A;  1YAL A;  1ATK A;  1DF0 A;  1PAD A;  1AYV A;  3KX1 A;  2AYO A;  4Q8H A;  1IWD A;  1NLJ A;  1PXV A;  1CTE A;  1PPN A;  2AYN A;  1U5I A;  4WA6 A;  2FT2 A;  4ZUX U;  2F7D A;  3DF0 A;  3USV A;  1Y08 A;  3KSE A;  4QRG A;  4YVA A;  1AU3 A;  2Y5B A;  5CVO B;  3N3G A;  4OEM A;  3HWN A;  2Y6E A;  1TLO A;  2NQA A;  2WBF X;  1ICF A;  1PPD A;  1S4V A;  3S3R A;  3I3T A;  1ME3 A;  2OP3 A;  9PAP A;  1GLO A;  1CPJ A;  2E02 A;  4BS6 A;  1F2B A;  2AIM A;  1STF E;  1YK7 A;  4OEL A;  4YYR A;  4QH6 A;  4X6J A;  4AXL A;  1CJL A;  1POP A;  4XUI A;  2JQF R;  3OIS A;  6PAD A;  1A6R A;  4W5B A;  3RVW A;  2PAD A;  2R9M A;  1EF7 A;  3H7D A;  1X9Y A;  1PBH A;  3H6S A;  2NQG A;  2DC7 A;  4I04 A;  4DMY A;  4KLB A;  3WXE A;  1BP4 A;  1U9Q X;  4QRV A;  1QOL A;  4PI3 A;  4YV8 A;  1PCI A;  4I07 A;  5K16 A;  1F29 A;  4YYW A;  2JQG R;  3KWB X;  3ZUA A;  4CDC B;  3OF8 A;  1EWL A;  4FIP A;  2DCA A;  4CDE B;  2AU1 A;  3PBH A;  3CBJ A;  2H7J A;  3BPF A;  1K3B B;  3OF9 A;  2B1M A;  1MEG A;  3CBK A;  2YJ8 A;  4N4Z A;  1GCB A;  3QT4 A;  2GHU A;  2AVW A;  1MDW A;  1CVZ A;  3M99 A;  1YVB A;  2DCC A;  1BQI A;  3LFY A;  1HUC B;  1QMY A;  2DC8 A;  2AS8 A;  1AEC A;  1EWP A;  4YYS A;  2FRA A;  2YJ2 A;  1SNK A;  4QBB A;  1F2A A;  1AU0 A;  3BOW A;  4X6I A;  1DEU A;  3K24 A;  2R9N A;  1AU2 A;  1O0E A;  4AXM A;  2G8J A;  3RVX A;  2E03 A;  2DCD A;  3CH2 X;  1AU4 A;  1KHQ A;  1YK8 A;  3H8B A;  7PCK A;  3OVZ A;  1JQP A;  5FPW A;  1MHW A;  3MOR A;  1EWM A;  1AYU A;  3MTN A;  2FO5 A;  1AIM A;  2ACT A;  2YJ9 A;  2DC6 A;  2E00 A;  2DZZ A;  2G7Y A;  3QJ3 A;  3LXS A;  2FUD A;  3PW3 A;  3IUT A;  3E1Z B;  3PNR A;  4PP2 E;  1NB3 A;  3KWZ A;  2BDL A;  2F1G A;  3O0U A;  3TNX A;  3OVX A;  1CB5 A;  2E01 A;  4HWY A;  1FH0 A;  1Y4H A;  3AI8 A;  3GCB A;  2PBH A;  1SP4 B;  1THE A;  3U8E A;  3CH3 X;  4CDD B;  4DMX A;  3N4C A;  3PDF A;  3MHH A;  1ITO A;  3C9E A;  2YJB A;  4I05 A;  2AUZ A;  2XU5 A;  2FYE A;  5F02 A;  2XU1 A;  3IHP A;  2IPP B;  1TU6 A;  1NL6 A;  2DZY A;  3HD3 A;  4MZO A;  2CB5 A;  2PNS A;  3N3K A;  4CZW A;  2YJC A;  4Q8G A;  1YT7 A;  1MEM A;  1KXR A;  4YYV A;  2XU4 A;  3BWK A;  1NB5 A;  2FTD A;  5CHT A;  8PCH A;  1TL9 A;  3H8C A;  2NQD B;  3IV2 A;  4W4U A;  2DCB A;  5A24 A;  1XKG A;  2HH5 A;  1GEC E;  4YYU A;  3WXG A;  3D6S A;  2CIO A;  2VHS A;  3F75 A;  1ZIV A;  1MS6 A;  4P6E A;  1BGO A;  1M6D A;  2NQI A;  3KKU A;  2O6X A;  4BSQ A;  2HXZ A;  1AYW A;  3O1G A;  3KFQ A;  4PAD A;  3K8U A;  2R9O A;  4CDF B;  1Q6K A;  1KHP A;  3BPM A;  4YYQ A;  4XR7 A;  1CV8 A;  1EWO A;  2G6D A;  1CQD A;  4MSX A;  4X6H A;  1U9W A;  2B1N A;  4QRX A;  2P86 A;  2AUX A;  1GMY A;  2OZ2 A;  1KFU L;  3HHI A;  1NPZ A;  3NHE A;  3B79 A;  2VHF A;  2FQ9 A;  1ZCM A;  4FJC A;  2DJF B;  5CVN B;  1PIP A;  1CS8 A;  5J94 A;  3F5V A;  2IBI A;  1PPP A;  2R9F A;  3P5X A;  3QSD A;  3H89 A;  4BPV A;  2R6N A;  1U9X A;  3V6C A;  3P5V A;  2XU3 A;  5PAD A;  3I06 A;  4MZS A;  2G8E A;  1F2C A;  2P7U A;  4N8W A;  2PRE A;  1PPO A;  2OUL A;  3ERV A;  4BS5 A;  3V6E A;  3IMA A;  3KW9 A;  2HD5 A;  1U9V A;  5CHV A;  5CVM A;  3P5U A;  1QXP A;  2GFO A;  3IEJ A;  4G54 A;  4N79 A;  5EF4 A;  2R9C A;  1VSN A;  4W5C A;  2DC9 A;  3BC3 A;  2ARY A;  1VJV A;  1NQC A;  2C0Y A;  3IOQ A; 
#chains in the Genus database with same CATH topology
 2P0R A;  3P5W A;  5JA7 A;  2ATO A;  3BCN A;  5E6J A;  3RVV A;  2JRI A;  2HHN A;  2BDZ A;  1QDQ A;  4PP1 A;  3HHA A;  3S3Q A;  4RF1 A;  4RY2 A;  4P6G A;  1ME4 A;  1CSB B;  1MIR A;  1KFX L;  3WXF A;  2FRQ A;  1BY8 A;  5EGW A;  3K9M A;  4K7C A;  3MHS A;  4FK5 A;  5JH3 A;  2DJG B;  2DOS A;  4BQV A;  1PE6 A;  1YAL A;  1ATK A;  1DF0 A;  1PAD A;  1AYV A;  3KX1 A;  3PHU A;  2AYO A;  3O65 A;  4Q8H A;  1IWD A;  3PHW A;  1NLJ A;  1PXV A;  3PSE A;  4HXD B;  1CTE A;  1PPN A;  2AYN A;  1DKI A;  1U5I A;  4WA6 A;  2FT2 A;  4ZUX U;  2F7D A;  3DF0 A;  3USV A;  1Y08 A;  3KSE A;  4QRG A;  2JTC A;  3B21 A;  4YVA A;  1AU3 A;  2Y5B A;  5CVO B;  3N3G A;  4OEM A;  3HWN A;  2Y6E A;  1TLO A;  2NQA A;  3BB7 A;  2WBF X;  3OQC A;  1ICF A;  1PPD A;  1S4V A;  3S3R A;  3I3T A;  1ME3 A;  2OP3 A;  2HWK A;  9PAP A;  3BBA A;  1GLO A;  1CPJ A;  2E02 A;  4BS6 A;  5EZS A;  1F2B A;  2AIM A;  1STF E;  1YK7 A;  4ZTB A;  4OEL A;  4YYR A;  4QH6 A;  4X6J A;  4AXL A;  3E9S A;  1CJL A;  1POP A;  4XUI A;  2JQF R;  4MI7 A;  3OIS A;  6PAD A;  1A6R A;  4W5B A;  3RVW A;  2PAD A;  2R9M A;  1EF7 A;  3H7D A;  4D8I A;  1X9Y A;  1PBH A;  3H6S A;  4IP3 A;  2NQG A;  1UKF A;  4A5U A;  2AGA A;  2DC7 A;  4I04 A;  4DMY A;  4KLB A;  2BTW B;  4RKX A;  3WXE A;  1BP4 A;  1U9Q X;  4QRV A;  1QOL A;  4PI3 A;  4YV8 A;  1PCI A;  4I07 A;  5K16 A;  1F29 A;  2FE8 A;  4YYW A;  2JQG R;  3KWB X;  3ZUA A;  4CDC B;  3OF8 A;  1EWL A;  4FIP A;  4BOU A;  4D8B A;  2DCA A;  4CDE B;  2AU1 A;  3PBH A;  3CBJ A;  2H7J A;  3BPF A;  4R3D A;  1K3B B;  3OF9 A;  2B1M A;  1MEG A;  3CBK A;  2YJ8 A;  4N4Z A;  1GCB A;  3QT4 A;  3W30 A;  2GHU A;  2AVW A;  3TMP A;  1MDW A;  1CVZ A;  3M99 A;  4PT5 A;  1YVB A;  4IUM A;  2DCC A;  1BQI A;  3LFY A;  1HUC B;  1QMY A;  2DC8 A;  2AS8 A;  2Z84 A;  1AEC A;  1EWP A;  4BOZ A;  4YYS A;  2FRA A;  2YJ2 A;  1SNK A;  4QBB A;  1F2A A;  1AU0 A;  3BOW A;  3PRP A;  3RNV A;  4X6I A;  1DEU A;  3K24 A;  1YZB A;  2R9N A;  1AU2 A;  1O0E A;  4AXM A;  2G8J A;  3RVX A;  2E03 A;  5KO3 A;  2DCD A;  3CH2 X;  1AU4 A;  3MJ5 A;  1KHQ A;  1YK8 A;  3H8B A;  7PCK A;  3OVZ A;  1JQP A;  1PVJ A;  5JZE A;  5FPW A;  1MHW A;  3MOR A;  1EWM A;  1AYU A;  3MTN A;  2FO5 A;  1AIM A;  2ACT A;  2YJ9 A;  4BOQ A;  2DC6 A;  2E00 A;  3IFU A;  2DZZ A;  2G7Y A;  3PT2 A;  3QJ3 A;  3LXS A;  2FUD A;  3PW3 A;  3IUT A;  3E1Z B;  3PNR A;  4PP2 E;  5EZQ A;  4OVZ A;  1NB3 A;  3KWZ A;  2BDL A;  2F1G A;  3O0U A;  3TNX A;  3OVX A;  1CB5 A;  2E01 A;  4HWY A;  1FH0 A;  4WUR A;  1Y4H A;  4RF0 A;  3AI8 A;  3GCB A;  2PBH A;  1SP4 B;  1THE A;  3U8E A;  3CH3 X;  4CDD B;  4DMX A;  3N4C A;  3PDF A;  3MHH A;  1ITO A;  3C9E A;  2YJB A;  4I05 A;  2AUZ A;  2XU5 A;  2FYE A;  5F02 A;  2XU1 A;  3IHP A;  2IPP B;  3C0R A;  1TU6 A;  1NL6 A;  2DZY A;  3HD3 A;  4MZO A;  2CB5 A;  2PNS A;  3N3K A;  4CZW A;  4XZX A;  2YJC A;  4Q8G A;  1YT7 A;  1MEM A;  1KXR A;  4YYV A;  2XU4 A;  3BWK A;  1NB5 A;  2FTD A;  4GUA A;  5CHT A;  8PCH A;  1TL9 A;  3H8C A;  4M0W A;  2NQD B;  3IV2 A;  4W4U A;  2DCB A;  3W31 A;  5A24 A;  1XKG A;  2HH5 A;  3ZNH A;  1GEC E;  4YYU A;  3WXG A;  3D6S A;  2CIO A;  3MTV A;  2VHS A;  3F75 A;  1ZIV A;  1MS6 A;  4P6E A;  1BGO A;  1M6D A;  2NQI A;  3KKU A;  2O6X A;  4OW0 A;  4BSQ A;  2HXZ A;  1AYW A;  3O1G A;  3KFQ A;  4PAD A;  3PHX A;  3K8U A;  2R9O A;  4CDF B;  1Q6K A;  1KHP A;  3BPM A;  4YYQ A;  4RNA A;  4XR7 A;  1CV8 A;  1EWO A;  2BU3 A;  2G6D A;  1CQD A;  4MM3 B;  4MSX A;  4X6H A;  1U9W A;  2B1N A;  4QRX A;  2P86 A;  3PRM A;  2AUX A;  1GMY A;  2OZ2 A;  4P16 A;  1KFU L;  3HHI A;  1NPZ A;  3NHE A;  3B79 A;  2VHF A;  2FQ9 A;  1ZCM A;  4D8E A;  4FJC A;  2DJF B;  5CVN B;  1PIP A;  3BY4 A;  1CS8 A;  5J94 A;  3F5V A;  4BOP A;  3MP2 A;  2IBI A;  1PPP A;  2R9F A;  3P5X A;  3QSD A;  3H89 A;  3TRK A;  4BPV A;  2R6N A;  1U9X A;  3V6C A;  3P5V A;  2J7Q C;  2XU3 A;  5PAD A;  2J7Q A;  3I06 A;  2BTW A;  4MZS A;  2G8E A;  4BOS A;  1F2C A;  2P7U A;  4N8W A;  4OVZ B;  2PRE A;  1PPO A;  2OUL A;  3ERV A;  4BS5 A;  3V6E A;  3IMA A;  3KW9 A;  2HD5 A;  1U9V A;  5CHV A;  5CVM A;  3P5U A;  1QXP A;  2GFO A;  3IEJ A;  4G54 A;  4N79 A;  5EF4 A;  2R9C A;  1VSN A;  4W5C A;  2DC9 A;  3BC3 A;  2ARY A;  1VJV A;  2UZJ A;  1NQC A;  2C0Y A;  3IOQ A;  4REZ A; 
#chains in the Genus database with same CATH homology
 2P0R A;  3P5W A;  5JA7 A;  2ATO A;  3BCN A;  3RVV A;  4B55 A;  2HHN A;  2BDZ A;  1QDQ A;  4PP1 A;  3HHA A;  3S3Q A;  4RY2 A;  4P6G A;  1ME4 A;  1CSB B;  1MIR A;  1KFX L;  3WXF A;  2FRQ A;  1BY8 A;  5EGW A;  3K9M A;  4K7C A;  3MHS A;  4FK5 A;  5JH3 A;  2DJG B;  4BQV A;  1PE6 A;  1YAL A;  1ATK A;  1DF0 A;  1PAD A;  1AYV A;  3KX1 A;  2AYO A;  4Q8H A;  1IWD A;  1NLJ A;  1PXV A;  1CTE A;  1PPN A;  2AYN A;  1U5I A;  4WA6 A;  2FT2 A;  4ZUX U;  2F7D A;  3DF0 A;  3USV A;  1Y08 A;  3KSE A;  4QRG A;  4YVA A;  1AU3 A;  2Y5B A;  5CVO B;  2VFC A;  3N3G A;  4OEM A;  3HWN A;  2Y6E A;  1TLO A;  2NQA A;  2WBF X;  1ICF A;  1PPD A;  1S4V A;  3S3R A;  1W4T A;  3I3T A;  1ME3 A;  1W6F A;  2OP3 A;  9PAP A;  1GLO A;  1CPJ A;  2E02 A;  4BS6 A;  1F2B A;  2AIM A;  1STF E;  1YK7 A;  4OEL A;  4YYR A;  4QH6 A;  4X6J A;  4AXL A;  1CJL A;  1POP A;  4XUI A;  2JQF R;  3OIS A;  6PAD A;  1A6R A;  4W5B A;  3RVW A;  2PAD A;  2R9M A;  1EF7 A;  3H7D A;  1X9Y A;  1PBH A;  3H6S A;  2NQG A;  2DC7 A;  4I04 A;  4DMY A;  4KLB A;  4BGF A;  3WXE A;  1BP4 A;  1U9Q X;  4QRV A;  1QOL A;  4PI3 A;  4YV8 A;  1PCI A;  4I07 A;  5K16 A;  1F29 A;  4YYW A;  2JQG R;  3KWB X;  3ZUA A;  4CDC B;  3OF8 A;  1EWL A;  4FIP A;  2DCA A;  4CDE B;  2AU1 A;  3PBH A;  3CBJ A;  2H7J A;  3BPF A;  1K3B B;  3OF9 A;  2B1M A;  1MEG A;  3CBK A;  2YJ8 A;  4N4Z A;  1GCB A;  3QT4 A;  2GHU A;  2AVW A;  1MDW A;  1CVZ A;  3M99 A;  4NV7 A;  1YVB A;  3LTW A;  2DCC A;  1BQI A;  3LFY A;  1HUC B;  1QMY A;  2DC8 A;  2AS8 A;  1AEC A;  1EWP A;  4YYS A;  2FRA A;  2YJ2 A;  1SNK A;  4QBB A;  1F2A A;  1AU0 A;  3BOW A;  4X6I A;  1DEU A;  3K24 A;  2R9N A;  1AU2 A;  4NV8 A;  1O0E A;  4AXM A;  1W5R A;  2G8J A;  3RVX A;  2E03 A;  2DCD A;  3CH2 X;  1AU4 A;  1KHQ A;  1YK8 A;  3H8B A;  7PCK A;  3OVZ A;  1JQP A;  5FPW A;  1MHW A;  3MOR A;  1EWM A;  1AYU A;  3MTN A;  2FO5 A;  1AIM A;  2ACT A;  2YJ9 A;  2DC6 A;  2E00 A;  2DZZ A;  2G7Y A;  3QJ3 A;  3LXS A;  2FUD A;  3PW3 A;  3IUT A;  3E1Z B;  3PNR A;  4PP2 E;  1NB3 A;  3KWZ A;  2BDL A;  2F1G A;  3O0U A;  3TNX A;  3OVX A;  1CB5 A;  2E01 A;  4HWY A;  1FH0 A;  1Y4H A;  3AI8 A;  3GCB A;  2PBH A;  1SP4 B;  1THE A;  3U8E A;  3CH3 X;  4CDD B;  4DMX A;  3N4C A;  3PDF A;  3MHH A;  1ITO A;  3C9E A;  2YJB A;  4I05 A;  2AUZ A;  2XU5 A;  2FYE A;  5F02 A;  2XU1 A;  3IHP A;  2IPP B;  1TU6 A;  1NL6 A;  2DZY A;  3HD3 A;  4MZO A;  2CB5 A;  2PNS A;  3N3K A;  4CZW A;  2YJC A;  4Q8G A;  1YT7 A;  1MEM A;  1KXR A;  4YYV A;  2XU4 A;  3BWK A;  1NB5 A;  2FTD A;  5CHT A;  8PCH A;  1TL9 A;  3H8C A;  2NQD B;  3IV2 A;  4W4U A;  2DCB A;  5A24 A;  1XKG A;  2HH5 A;  2BSZ A;  1GEC E;  4YYU A;  3WXG A;  3D6S A;  2CIO A;  2VHS A;  3F75 A;  1ZIV A;  1MS6 A;  4P6E A;  1BGO A;  1M6D A;  2NQI A;  3KKU A;  2O6X A;  4BSQ A;  2HXZ A;  1AYW A;  3O1G A;  3KFQ A;  4PAD A;  3K8U A;  2R9O A;  4CDF B;  1Q6K A;  1KHP A;  3BPM A;  4YYQ A;  1GX3 A;  4XR7 A;  1CV8 A;  1EWO A;  2G6D A;  1CQD A;  4MSX A;  4X6H A;  1U9W A;  2B1N A;  4QRX A;  2P86 A;  3D9W A;  2AUX A;  1GMY A;  2OZ2 A;  1KFU L;  4C5P A;  3HHI A;  1NPZ A;  3NHE A;  3B79 A;  2VHF A;  2FQ9 A;  1ZCM A;  4FJC A;  2DJF B;  5CVN B;  1PIP A;  1E2T A;  1CS8 A;  5J94 A;  3F5V A;  2IBI A;  1PPP A;  2R9F A;  3P5X A;  3QSD A;  2VFB A;  3H89 A;  4BPV A;  2R6N A;  1U9X A;  3V6C A;  3P5V A;  2XU3 A;  5PAD A;  3I06 A;  4MZS A;  2G8E A;  1F2C A;  2P7U A;  4N8W A;  2PRE A;  3ERV A;  1PPO A;  2OUL A;  4BS5 A;  3V6E A;  4GUZ A;  3IMA A;  3KW9 A;  2HD5 A;  1U9V A;  5CHV A;  5CVM A;  3P5U A;  1QXP A;  2GFO A;  3IEJ A;  4G54 A;  4N79 A;  5EF4 A;  2R9C A;  1VSN A;  4W5C A;  2DC9 A;  3BC3 A;  2ARY A;  1VJV A;  1NQC A;  2C0Y A;  3IOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...