1GLOA

Crystal structure of cys25ser mutant of human cathepsin s
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGASWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDLKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN S
publication title Structure of a Cys25->Ser Mutant of Human Cathepsin Cathepsin S
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 72
structure length 217
sequence length 217
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2001-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1gloA00
1BY8A 3HHAA 4N79A 1PXVA 2FUDA 2O6XA 3BC3A 3DF0A 3H8CA 1ME4A 4XR7A 1AU3A 3GCBA 7PCKA 4YYUA 1AIMA 1AU0A 3WXGA 1GCBA 2IPPB 3K9MA 1FH0A 3HHIA 3HWNA 3BOWA 5K16A 4Q8HA 4N4ZA 3S3QA 3WXFA 3PBHA 2E02A 3CBKA 2DZZA 2AUZA 2JQGR 2DC8A 3P5VA 2R9CA 2WBFX 2R9OA 4BS6A 3BWKA 1NL6A 4YVAA 2PADA 2DC9A 1EWLA 4YYQA 4YYRA 5JA7A 1THEA 1KXRA 4Q8GA 1A6RA 1PIPA 2F1GA 2R9MA 3N3KA 3P5WA 4BS5A 4WA6A 1YT7A 3LFYA 1MEGA 1ME3A 1QMYA 3KW9A 9PAPA 1Y4HA 2FO5A 3KWBX 1MDWA 1U5IA 4QRXA 3KX1A 2PNSA 2P86A 4YV8A 5CHTA 2AS8A 4DMYA 2FTDA 5F02A 1POPA 2DC7A 2XU5A 2CIOA 4AXMA 4QRVA 4QBBA 2C0YA 1F29A 2HH5A 3IOQA 2FRAA 2G8EA 4K7CA 3PW3A 4PP1A 1IWDA 3MORA 2B1MA 2BDLA 2Y6EA 3ERVA 2VHSA 3S3RA 4X6IA 3O0UA 4KLBA 2FYEA 2DC6A 1EWPA 3USVA 1K3BB 3BPMA 1U9VA 4I05A 2PREA 4ZUXU 3CH2X 1TL9A 2ARYA 2R9NA 5CVMA 1VJVA 2AYOA 2YJCA 3C9EA 1AU2A 3K8UA 2DJFB 1EWOA 1CB5A 2OULA 2CB5A 1O0EA 2AIMA 1NQCA 1M6DA 1EWMA 2YJBA 1PPDA 1F2AA 2P0RA 1CS8A 5J94A 1ZCMA 1SNKA 3PDFA 3RVWA 1PBHA 4G54A 1QOLA 5A24A 1U9XA 3F5VA 2VHFA 2YJ9A 1AECA 2E00A 1YK7A 3KWZA 3OVXA 4BPVA 5CVNB 1XKGA 1X9YA 2GHUA 4X6HA 2R9FA 3M99A 4RY2A 1DF0A 3H7DA 3LXSA 2YJ8A 1BQIA 2DJGB 2XU3A 3OF8A 1MS6A 1QDQA 5EF4A 3TNXA 3AI8A 1QXPA 5FPWA 1YVBA 1BGOA 2G7YA 4CDFB 3H89A 4N8WA 3KKUA 1CSBB 4PI3A 1AYWA 2AVWA 2NQGA 4QRGA 1GLOA 2FRQA 2HHNA 2BDZA 1EF7A 6PADA 3IMAA 3D6SA 1KHPA 1ICFA 4W4UA 1F2BA 1Y08A 3KSEA 3WXEA 4CZWA 4DMXA 1CVZA 4YYVA 1NB5A 4PADA 2G8JA 2XU4A 4YYWA 1MIRA 3MHHA 3IV2A 5CVOB 3U8EA 3BPFA 4PP2E 4I07A 4QH6A 3OF9A 1JQPA 2PBHA 4MSXA 4CDEB 2NQDB 2FT2A 1PPPA 3P5UA 1AU4A 2DCDA 3MTNA 3I06A 4P6GA 1U9QX 4BQVA 2DZYA 1CV8A 2GFOA 3N4CA 4FK5A 4OELA 2NQAA 1MHWA 1S4VA 1NPZA 2FQ9A 1KHQA 4FJCA 3E1ZB 4MZOA 5PADA 2E03A 3MHSA 1NLJA 4P6EA 2IBIA 1PE6A 1GMYA 1AYVA 4OEMA 3IEJA 2G6DA 1ZIVA 3IHPA 3HD3A 4XUIA 3F75A 3PNRA 1Q6KA 2OP3A 3KFQA 2DCAA 4BSQA 1TLOA 1NB3A 4X6JA 2NQIA 4I04A 2H7JA 2DCBA 3IUTA 4AXLA 2P7UA 1F2CA 1MEMA 3V6EA 1KFXL 1AYUA 1PPNA 1PPOA 3B79A 1ITOA 3CBJA 3QJ3A 4FIPA 2AUXA 3BCNA 1CPJA 1DEUA 5JH3A 3P5XA 4W5BA 1YK8A 1CTEA 2ATOA 3I3TA 2F7DA 4W5CA 3NHEA 2ACTA 1GECE 3H8BA 1PCIA 2YJ2A 1KFUL 1HUCB 3ZUAA 1YALA 1TU6A 3K24A 3H6SA 4HWYA 1ATKA 2DCCA 1BP4A 2HD5A 3O1GA 2HXZA 2OZ2A 4YYSA 1PADA 2AYNA 8PCHA 3QSDA 1U9WA 3QT4A 2R6NA 3OISA 2E01A 1VSNA 4MZSA 5CHVA 4CDCB 2AU1A 2JQFR 2Y5BA 3CH3X 1CQDA 3N3GA 3RVVA 5EGWA 1SP4B 3V6CA 2XU1A 4CDDB 1STFE 2B1NA 3OVZA 1CJLA 3RVXA
chains in the Genus database with same CATH superfamily
1BY8A 3HHAA 4N79A 1PXVA 2FUDA 2O6XA 3BC3A 3DF0A 3H8CA 1ME4A 4XR7A 1AU3A 3GCBA 7PCKA 4YYUA 1AIMA 1AU0A 3WXGA 5EZSA 1GCBA 2IPPB 3K9MA 1FH0A 3HHIA 4RKXA 3HWNA 3BOWA 5K16A 3E9SA 4Q8HA 4N4ZA 3S3QA 3WXFA 3O65A 3PBHA 2E02A 3CBKA 2DZZA 2AUZA 2JQGR 2DC8A 3P5VA 2R9CA 2WBFX 4IUMA 2R9OA 4BS6A 3BWKA 1NL6A 5EZQA 4YVAA 2PADA 2HWKA 2DC9A 1EWLA 1DKIA 4YYQA 4YYRA 5JA7A 1THEA 1KXRA 4Q8GA 4D8IA 1A6RA 1PIPA 2F1GA 2R9MA 3N3KA 3P5WA 4BS5A 4WA6A 1YT7A 3LFYA 1MEGA 4R3DA 1ME3A 1QMYA 3KW9A 9PAPA 1Y4HA 2FO5A 3KWBX 1MDWA 1U5IA 4QRXA 3KX1A 2PNSA 2P86A 4YV8A 5CHTA 2AS8A 4DMYA 2FTDA 5F02A 1POPA 2DC7A 2XU5A 4M0WA 2CIOA 4AXMA 4QRVA 4QBBA 2C0YA 1F29A 2HH5A 3IOQA 2FRAA 2G8EA 4K7CA 3PHWA 1IWDA 3PW3A 4PP1A 3MORA 2B1MA 2BDLA 2Y6EA 3ERVA 2VHSA 3S3RA 4X6IA 3O0UA 4KLBA 2FYEA 2J7QC 2DC6A 4IP3A 1EWPA 3PHUA 3USVA 4OVZA 1K3BB 3BPMA 4RNAA 1U9VA 3ZNHA 4I05A 2PREA 4ZUXU 3BBAA 3CH2X 1TL9A 2ARYA 4BOUA 2R9NA 5CVMA 1VJVA 2BTWB 2AYOA 2YJCA 3C9EA 1AU2A 3K8UA 2DJFB 1EWOA 4D8BA 1CB5A 2OULA 2CB5A 4PT5A 1O0EA 2AIMA 1NQCA 1M6DA 1EWMA 2YJBA 1PPDA 4A5UA 1F2AA 3PHXA 2P0RA 4XZXA 5JZEA 1CS8A 2JTCA 5J94A 1ZCMA 5KO3A 1SNKA 3TRKA 3PDFA 3RVWA 1PBHA 4G54A 1QOLA 4OW0A 5A24A 1U9XA 3F5VA 3MTVA 4REZA 2VHFA 2YJ9A 4D8EA 1AECA 2E00A 1YK7A 3KWZA 3OVXA 4BPVA 2JRIA 5CVNB 3W31A 1XKGA 4ZTBA 1X9YA 2GHUA 4X6HA 2R9FA 3M99A 4RY2A 1DF0A 3H7DA 3LXSA 2YJ8A 1BQIA 2DJGB 2XU3A 3OF8A 1MS6A 4MI7A 1QDQA 5EF4A 3TNXA 3AI8A 1QXPA 5FPWA 1YVBA 3MP2A 1BGOA 2G7YA 4CDFB 3BB7A 3H89A 4N8WA 3KKUA 1CSBB 4PI3A 1AYWA 2AVWA 2NQGA 4QRGA 1GLOA 2FRQA 2HHNA 4RF1A 2BDZA 2BU3A 1EF7A 6PADA 3IMAA 1UKFA 3D6SA 1KHPA 1ICFA 5E6JA 4W4UA 1F2BA 1Y08A 3KSEA 3WXEA 4BOQA 4CZWA 4DMXA 1CVZA 4YYVA 1NB5A 4PADA 2G8JA 4OVZB 2XU4A 4YYWA 1MIRA 3MHHA 3IV2A 5CVOB 3U8EA 2AGAA 3BPFA 4PP2E 2UZJA 4I07A 4QH6A 3OF9A 1JQPA 2PBHA 4MSXA 4CDEB 2NQDB 4WURA 2FT2A 2FE8A 1PPPA 3P5UA 1AU4A 2DCDA 2Z84A 3MTNA 3I06A 4P6GA 1U9QX 4BQVA 2DZYA 1CV8A 2GFOA 3N4CA 4FK5A 4OELA 2NQAA 4BOPA 1MHWA 1S4VA 3MJ5A 3B21A 1NPZA 2FQ9A 1KHQA 4FJCA 3E1ZB 4MZOA 2BTWA 5PADA 2E03A 3MHSA 1NLJA 4MM3B 3RNVA 4P6EA 2IBIA 1PE6A 1GMYA 3PRPA 3BY4A 1AYVA 4OEMA 3IEJA 2G6DA 1ZIVA 3IHPA 3HD3A 4XUIA 4HXDB 3F75A 3PNRA 1Q6KA 2OP3A 3KFQA 2DCAA 4BSQA 4P16A 1TLOA 1NB3A 4X6JA 2NQIA 4I04A 2H7JA 2DCBA 3IUTA 4AXLA 3W30A 2P7UA 1F2CA 1MEMA 3V6EA 1KFXL 1AYUA 1PPNA 1PPOA 3B79A 1ITOA 3CBJA 3QJ3A 4FIPA 2AUXA 3BCNA 4RF0A 1CPJA 1DEUA 5JH3A 3P5XA 4W5BA 1PVJA 1YK8A 1CTEA 2ATOA 3I3TA 3PT2A 2F7DA 4W5CA 3NHEA 2ACTA 1GECE 3H8BA 4BOZA 1PCIA 2YJ2A 1KFUL 4GUAA 1HUCB 3ZUAA 1YALA 1TU6A 3TMPA 3K24A 2DOSA 3H6SA 4HWYA 1ATKA 2DCCA 1BP4A 3PSEA 2HD5A 3PRMA 3O1GA 2HXZA 2OZ2A 4YYSA 1PADA 2AYNA 2J7QA 8PCHA 3QSDA 1U9WA 3QT4A 2R6NA 3OISA 2E01A 1VSNA 4MZSA 5CHVA 3C0RA 4CDCB 2AU1A 4BOSA 2JQFR 1YZBA 2Y5BA 3CH3X 3OQCA 1CQDA 3N3GA 3RVVA 5EGWA 1SP4B 3IFUA 3V6CA 2XU1A 4CDDB 1STFE 2B1NA 3OVZA 1CJLA 3RVXA
chains in the Genus database with same CATH topology
1BY8A 3HHAA 4N79A 1PXVA 2FUDA 2O6XA 3BC3A 3DF0A 3H8CA 1ME4A 4XR7A 1AU3A 3GCBA 7PCKA 4NV8A 4YYUA 1AIMA 1AU0A 3WXGA 1GCBA 2IPPB 3K9MA 1FH0A 3HHIA 3HWNA 3BOWA 5K16A 4Q8HA 4N4ZA 3S3QA 3WXFA 3PBHA 2E02A 3CBKA 2DZZA 2AUZA 2JQGR 2DC8A 3P5VA 2R9CA 2WBFX 2R9OA 4BS6A 3BWKA 1NL6A 4YVAA 2PADA 2DC9A 1EWLA 4YYQA 4YYRA 5JA7A 2BSZA 1THEA 1KXRA 4Q8GA 2VFBA 4BGFA 1A6RA 1PIPA 2F1GA 2R9MA 3N3KA 3P5WA 4BS5A 4WA6A 1YT7A 3LFYA 1MEGA 1ME3A 1QMYA 3KW9A 9PAPA 1Y4HA 2FO5A 3KWBX 1MDWA 1U5IA 4QRXA 3KX1A 2PNSA 2P86A 4YV8A 5CHTA 2AS8A 4DMYA 2FTDA 5F02A 1POPA 2DC7A 2XU5A 2CIOA 4AXMA 4QRVA 4QBBA 2C0YA 1F29A 3LTWA 2HH5A 3IOQA 2FRAA 2G8EA 4K7CA 3PW3A 1IWDA 4PP1A 3MORA 1GX3A 2B1MA 2BDLA 2Y6EA 3ERVA 2VHSA 3S3RA 4X6IA 3O0UA 4KLBA 2FYEA 2DC6A 1EWPA 3USVA 1K3BB 3BPMA 1U9VA 4I05A 2PREA 4ZUXU 3CH2X 1TL9A 2ARYA 2R9NA 5CVMA 1VJVA 2AYOA 2YJCA 3C9EA 1AU2A 3K8UA 2DJFB 1E2TA 1EWOA 1CB5A 2OULA 2CB5A 4NV7A 1O0EA 2AIMA 1NQCA 1M6DA 1EWMA 2YJBA 1PPDA 1F2AA 2P0RA 1CS8A 5J94A 1ZCMA 1SNKA 3PDFA 3RVWA 1PBHA 4G54A 1QOLA 5A24A 1U9XA 3F5VA 2VHFA 2YJ9A 4C5PA 1AECA 2E00A 1YK7A 3KWZA 3OVXA 4BPVA 5CVNB 1XKGA 1X9YA 2GHUA 4X6HA 2R9FA 3M99A 1W4TA 4RY2A 1DF0A 3H7DA 3LXSA 2YJ8A 1BQIA 2DJGB 2XU3A 3OF8A 1MS6A 1QDQA 5EF4A 3TNXA 3AI8A 1QXPA 5FPWA 1YVBA 1BGOA 2G7YA 4CDFB 3H89A 4N8WA 3KKUA 1CSBB 4PI3A 1AYWA 2AVWA 2NQGA 4QRGA 1GLOA 2FRQA 2HHNA 2BDZA 1EF7A 6PADA 3IMAA 3D6SA 1KHPA 1ICFA 4W4UA 1F2BA 1Y08A 3KSEA 3WXEA 1W6FA 4CZWA 4DMXA 1CVZA 4YYVA 1NB5A 4PADA 2G8JA 2XU4A 4YYWA 1MIRA 3MHHA 3IV2A 5CVOB 3U8EA 3BPFA 4PP2E 4I07A 4QH6A 3OF9A 1JQPA 2PBHA 4MSXA 4CDEB 2NQDB 2FT2A 1PPPA 3P5UA 1AU4A 1W5RA 2DCDA 3MTNA 3I06A 4P6GA 1U9QX 4BQVA 2DZYA 1CV8A 2GFOA 3N4CA 4FK5A 4OELA 2NQAA 1MHWA 1S4VA 1NPZA 2FQ9A 1KHQA 4FJCA 3E1ZB 4MZOA 5PADA 2E03A 3MHSA 1NLJA 4P6EA 2IBIA 1PE6A 1GMYA 1AYVA 4OEMA 3IEJA 2G6DA 1ZIVA 3IHPA 3HD3A 4XUIA 3F75A 3PNRA 1Q6KA 2OP3A 3KFQA 2DCAA 4BSQA 1TLOA 1NB3A 4X6JA 2NQIA 4I04A 2H7JA 2DCBA 3IUTA 4AXLA 2P7UA 1F2CA 1MEMA 3V6EA 1KFXL 1AYUA 1PPNA 1PPOA 3B79A 1ITOA 3CBJA 3QJ3A 4FIPA 2AUXA 3BCNA 1CPJA 1DEUA 5JH3A 3P5XA 4W5BA 1YK8A 1CTEA 2ATOA 3I3TA 2F7DA 4W5CA 3NHEA 2ACTA 1GECE 3H8BA 1PCIA 2YJ2A 1KFUL 1HUCB 3ZUAA 1YALA 1TU6A 3K24A 3H6SA 4HWYA 1ATKA 2DCCA 1BP4A 2HD5A 3O1GA 2HXZA 2OZ2A 4YYSA 1PADA 2AYNA 8PCHA 3QSDA 1U9WA 3QT4A 2R6NA 3OISA 2E01A 1VSNA 4MZSA 5CHVA 4CDCB 2AU1A 2JQFR 4GUZA 2Y5BA 3CH3X 1CQDA 3N3GA 3RVVA 4B55A 5EGWA 1SP4B 3V6CA 2XU1A 4CDDB 1STFE 2B1NA 3OVZA 2VFCA 1CJLA 3D9WA 3RVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BY8 A;  3HHA A;  4N79 A;  1PXV A;  2FUD A;  2O6X A;  3BC3 A;  3DF0 A;  3H8C A;  1ME4 A;  4XR7 A;  1AU3 A;  3GCB A;  7PCK A;  4YYU A;  1AIM A;  1AU0 A;  3WXG A;  1GCB A;  2IPP B;  3K9M A;  1FH0 A;  3HHI A;  3HWN A;  3BOW A;  5K16 A;  4Q8H A;  4N4Z A;  3S3Q A;  3WXF A;  3PBH A;  2E02 A;  3CBK A;  2DZZ A;  2AUZ A;  2JQG R;  2DC8 A;  3P5V A;  2R9C A;  2WBF X;  2R9O A;  4BS6 A;  3BWK A;  1NL6 A;  4YVA A;  2PAD A;  2DC9 A;  1EWL A;  4YYQ A;  4YYR A;  5JA7 A;  1THE A;  1KXR A;  4Q8G A;  1A6R A;  1PIP A;  2F1G A;  2R9M A;  3N3K A;  3P5W A;  4BS5 A;  4WA6 A;  1YT7 A;  3LFY A;  1MEG A;  1ME3 A;  1QMY A;  3KW9 A;  9PAP A;  1Y4H A;  2FO5 A;  3KWB X;  1MDW A;  1U5I A;  4QRX A;  3KX1 A;  2PNS A;  2P86 A;  4YV8 A;  5CHT A;  2AS8 A;  4DMY A;  2FTD A;  5F02 A;  1POP A;  2DC7 A;  2XU5 A;  2CIO A;  4AXM A;  4QRV A;  4QBB A;  2C0Y A;  1F29 A;  2HH5 A;  3IOQ A;  2FRA A;  2G8E A;  4K7C A;  3PW3 A;  4PP1 A;  1IWD A;  3MOR A;  2B1M A;  2BDL A;  2Y6E A;  3ERV A;  2VHS A;  3S3R A;  4X6I A;  3O0U A;  4KLB A;  2FYE A;  2DC6 A;  1EWP A;  3USV A;  1K3B B;  3BPM A;  1U9V A;  4I05 A;  2PRE A;  4ZUX U;  3CH2 X;  1TL9 A;  2ARY A;  2R9N A;  5CVM A;  1VJV A;  2AYO A;  2YJC A;  3C9E A;  1AU2 A;  3K8U A;  2DJF B;  1EWO A;  1CB5 A;  2OUL A;  2CB5 A;  1O0E A;  2AIM A;  1NQC A;  1M6D A;  1EWM A;  2YJB A;  1PPD A;  1F2A A;  2P0R A;  1CS8 A;  5J94 A;  1ZCM A;  1SNK A;  3PDF A;  3RVW A;  1PBH A;  4G54 A;  1QOL A;  5A24 A;  1U9X A;  3F5V A;  2VHF A;  2YJ9 A;  1AEC A;  2E00 A;  1YK7 A;  3KWZ A;  3OVX A;  4BPV A;  5CVN B;  1XKG A;  1X9Y A;  2GHU A;  4X6H A;  2R9F A;  3M99 A;  4RY2 A;  1DF0 A;  3H7D A;  3LXS A;  2YJ8 A;  1BQI A;  2DJG B;  2XU3 A;  3OF8 A;  1MS6 A;  1QDQ A;  5EF4 A;  3TNX A;  3AI8 A;  1QXP A;  5FPW A;  1YVB A;  1BGO A;  2G7Y A;  4CDF B;  3H89 A;  4N8W A;  3KKU A;  1CSB B;  4PI3 A;  1AYW A;  2AVW A;  2NQG A;  4QRG A;  1GLO A;  2FRQ A;  2HHN A;  2BDZ A;  1EF7 A;  6PAD A;  3IMA A;  3D6S A;  1KHP A;  1ICF A;  4W4U A;  1F2B A;  1Y08 A;  3KSE A;  3WXE A;  4CZW A;  4DMX A;  1CVZ A;  4YYV A;  1NB5 A;  4PAD A;  2G8J A;  2XU4 A;  4YYW A;  1MIR A;  3MHH A;  3IV2 A;  5CVO B;  3U8E A;  3BPF A;  4PP2 E;  4I07 A;  4QH6 A;  3OF9 A;  1JQP A;  2PBH A;  4MSX A;  4CDE B;  2NQD B;  2FT2 A;  1PPP A;  3P5U A;  1AU4 A;  2DCD A;  3MTN A;  3I06 A;  4P6G A;  1U9Q X;  4BQV A;  2DZY A;  1CV8 A;  2GFO A;  3N4C A;  4FK5 A;  4OEL A;  2NQA A;  1MHW A;  1S4V A;  1NPZ A;  2FQ9 A;  1KHQ A;  4FJC A;  3E1Z B;  4MZO A;  5PAD A;  2E03 A;  3MHS A;  1NLJ A;  4P6E A;  2IBI A;  1PE6 A;  1GMY A;  1AYV A;  4OEM A;  3IEJ A;  2G6D A;  1ZIV A;  3IHP A;  3HD3 A;  4XUI A;  3F75 A;  3PNR A;  1Q6K A;  2OP3 A;  3KFQ A;  2DCA A;  4BSQ A;  1TLO A;  1NB3 A;  4X6J A;  2NQI A;  4I04 A;  2H7J A;  2DCB A;  3IUT A;  4AXL A;  2P7U A;  1F2C A;  1MEM A;  3V6E A;  1KFX L;  1AYU A;  1PPN A;  1PPO A;  3B79 A;  1ITO A;  3CBJ A;  3QJ3 A;  4FIP A;  2AUX A;  3BCN A;  1CPJ A;  1DEU A;  5JH3 A;  3P5X A;  4W5B A;  1YK8 A;  1CTE A;  2ATO A;  3I3T A;  2F7D A;  4W5C A;  3NHE A;  2ACT A;  1GEC E;  3H8B A;  1PCI A;  2YJ2 A;  1KFU L;  1HUC B;  3ZUA A;  1YAL A;  1TU6 A;  3K24 A;  3H6S A;  4HWY A;  1ATK A;  2DCC A;  1BP4 A;  2HD5 A;  3O1G A;  2HXZ A;  2OZ2 A;  4YYS A;  1PAD A;  2AYN A;  8PCH A;  3QSD A;  1U9W A;  3QT4 A;  2R6N A;  3OIS A;  2E01 A;  1VSN A;  4MZS A;  5CHV A;  4CDC B;  2AU1 A;  2JQF R;  2Y5B A;  3CH3 X;  1CQD A;  3N3G A;  3RVV A;  5EGW A;  1SP4 B;  3V6C A;  2XU1 A;  4CDD B;  1STF E;  2B1N A;  3OVZ A;  1CJL A;  3RVX A; 
#chains in the Genus database with same CATH topology
 1BY8 A;  3HHA A;  4N79 A;  1PXV A;  2FUD A;  2O6X A;  3BC3 A;  3DF0 A;  3H8C A;  1ME4 A;  4XR7 A;  1AU3 A;  3GCB A;  7PCK A;  4YYU A;  1AIM A;  1AU0 A;  3WXG A;  5EZS A;  1GCB A;  2IPP B;  3K9M A;  1FH0 A;  3HHI A;  4RKX A;  3HWN A;  3BOW A;  5K16 A;  3E9S A;  4Q8H A;  4N4Z A;  3S3Q A;  3WXF A;  3O65 A;  3PBH A;  2E02 A;  3CBK A;  2DZZ A;  2AUZ A;  2JQG R;  2DC8 A;  3P5V A;  2R9C A;  2WBF X;  4IUM A;  2R9O A;  4BS6 A;  3BWK A;  1NL6 A;  5EZQ A;  4YVA A;  2PAD A;  2HWK A;  2DC9 A;  1EWL A;  1DKI A;  4YYQ A;  4YYR A;  5JA7 A;  1THE A;  1KXR A;  4Q8G A;  4D8I A;  1A6R A;  1PIP A;  2F1G A;  2R9M A;  3N3K A;  3P5W A;  4BS5 A;  4WA6 A;  1YT7 A;  3LFY A;  1MEG A;  4R3D A;  1ME3 A;  1QMY A;  3KW9 A;  9PAP A;  1Y4H A;  2FO5 A;  3KWB X;  1MDW A;  1U5I A;  4QRX A;  3KX1 A;  2PNS A;  2P86 A;  4YV8 A;  5CHT A;  2AS8 A;  4DMY A;  2FTD A;  5F02 A;  1POP A;  2DC7 A;  2XU5 A;  4M0W A;  2CIO A;  4AXM A;  4QRV A;  4QBB A;  2C0Y A;  1F29 A;  2HH5 A;  3IOQ A;  2FRA A;  2G8E A;  4K7C A;  3PHW A;  1IWD A;  3PW3 A;  4PP1 A;  3MOR A;  2B1M A;  2BDL A;  2Y6E A;  3ERV A;  2VHS A;  3S3R A;  4X6I A;  3O0U A;  4KLB A;  2FYE A;  2J7Q C;  2DC6 A;  4IP3 A;  1EWP A;  3PHU A;  3USV A;  4OVZ A;  1K3B B;  3BPM A;  4RNA A;  1U9V A;  3ZNH A;  4I05 A;  2PRE A;  4ZUX U;  3BBA A;  3CH2 X;  1TL9 A;  2ARY A;  4BOU A;  2R9N A;  5CVM A;  1VJV A;  2BTW B;  2AYO A;  2YJC A;  3C9E A;  1AU2 A;  3K8U A;  2DJF B;  1EWO A;  4D8B A;  1CB5 A;  2OUL A;  2CB5 A;  4PT5 A;  1O0E A;  2AIM A;  1NQC A;  1M6D A;  1EWM A;  2YJB A;  1PPD A;  4A5U A;  1F2A A;  3PHX A;  2P0R A;  4XZX A;  5JZE A;  1CS8 A;  2JTC A;  5J94 A;  1ZCM A;  5KO3 A;  1SNK A;  3TRK A;  3PDF A;  3RVW A;  1PBH A;  4G54 A;  1QOL A;  4OW0 A;  5A24 A;  1U9X A;  3F5V A;  3MTV A;  4REZ A;  2VHF A;  2YJ9 A;  4D8E A;  1AEC A;  2E00 A;  1YK7 A;  3KWZ A;  3OVX A;  4BPV A;  2JRI A;  5CVN B;  3W31 A;  1XKG A;  4ZTB A;  1X9Y A;  2GHU A;  4X6H A;  2R9F A;  3M99 A;  4RY2 A;  1DF0 A;  3H7D A;  3LXS A;  2YJ8 A;  1BQI A;  2DJG B;  2XU3 A;  3OF8 A;  1MS6 A;  4MI7 A;  1QDQ A;  5EF4 A;  3TNX A;  3AI8 A;  1QXP A;  5FPW A;  1YVB A;  3MP2 A;  1BGO A;  2G7Y A;  4CDF B;  3BB7 A;  3H89 A;  4N8W A;  3KKU A;  1CSB B;  4PI3 A;  1AYW A;  2AVW A;  2NQG A;  4QRG A;  1GLO A;  2FRQ A;  2HHN A;  4RF1 A;  2BDZ A;  2BU3 A;  1EF7 A;  6PAD A;  3IMA A;  1UKF A;  3D6S A;  1KHP A;  1ICF A;  5E6J A;  4W4U A;  1F2B A;  1Y08 A;  3KSE A;  3WXE A;  4BOQ A;  4CZW A;  4DMX A;  1CVZ A;  4YYV A;  1NB5 A;  4PAD A;  2G8J A;  4OVZ B;  2XU4 A;  4YYW A;  1MIR A;  3MHH A;  3IV2 A;  5CVO B;  3U8E A;  2AGA A;  3BPF A;  4PP2 E;  2UZJ A;  4I07 A;  4QH6 A;  3OF9 A;  1JQP A;  2PBH A;  4MSX A;  4CDE B;  2NQD B;  4WUR A;  2FT2 A;  2FE8 A;  1PPP A;  3P5U A;  1AU4 A;  2DCD A;  2Z84 A;  3MTN A;  3I06 A;  4P6G A;  1U9Q X;  4BQV A;  2DZY A;  1CV8 A;  2GFO A;  3N4C A;  4FK5 A;  4OEL A;  2NQA A;  4BOP A;  1MHW A;  1S4V A;  3MJ5 A;  3B21 A;  1NPZ A;  2FQ9 A;  1KHQ A;  4FJC A;  3E1Z B;  4MZO A;  2BTW A;  5PAD A;  2E03 A;  3MHS A;  1NLJ A;  4MM3 B;  3RNV A;  4P6E A;  2IBI A;  1PE6 A;  1GMY A;  3PRP A;  3BY4 A;  1AYV A;  4OEM A;  3IEJ A;  2G6D A;  1ZIV A;  3IHP A;  3HD3 A;  4XUI A;  4HXD B;  3F75 A;  3PNR A;  1Q6K A;  2OP3 A;  3KFQ A;  2DCA A;  4BSQ A;  4P16 A;  1TLO A;  1NB3 A;  4X6J A;  2NQI A;  4I04 A;  2H7J A;  2DCB A;  3IUT A;  4AXL A;  3W30 A;  2P7U A;  1F2C A;  1MEM A;  3V6E A;  1KFX L;  1AYU A;  1PPN A;  1PPO A;  3B79 A;  1ITO A;  3CBJ A;  3QJ3 A;  4FIP A;  2AUX A;  3BCN A;  4RF0 A;  1CPJ A;  1DEU A;  5JH3 A;  3P5X A;  4W5B A;  1PVJ A;  1YK8 A;  1CTE A;  2ATO A;  3I3T A;  3PT2 A;  2F7D A;  4W5C A;  3NHE A;  2ACT A;  1GEC E;  3H8B A;  4BOZ A;  1PCI A;  2YJ2 A;  1KFU L;  4GUA A;  1HUC B;  3ZUA A;  1YAL A;  1TU6 A;  3TMP A;  3K24 A;  2DOS A;  3H6S A;  4HWY A;  1ATK A;  2DCC A;  1BP4 A;  3PSE A;  2HD5 A;  3PRM A;  3O1G A;  2HXZ A;  2OZ2 A;  4YYS A;  1PAD A;  2AYN A;  2J7Q A;  8PCH A;  3QSD A;  1U9W A;  3QT4 A;  2R6N A;  3OIS A;  2E01 A;  1VSN A;  4MZS A;  5CHV A;  3C0R A;  4CDC B;  2AU1 A;  4BOS A;  2JQF R;  1YZB A;  2Y5B A;  3CH3 X;  3OQC A;  1CQD A;  3N3G A;  3RVV A;  5EGW A;  1SP4 B;  3IFU A;  3V6C A;  2XU1 A;  4CDD B;  1STF E;  2B1N A;  3OVZ A;  1CJL A;  3RVX A; 
#chains in the Genus database with same CATH homology
 1BY8 A;  3HHA A;  4N79 A;  1PXV A;  2FUD A;  2O6X A;  3BC3 A;  3DF0 A;  3H8C A;  1ME4 A;  4XR7 A;  1AU3 A;  3GCB A;  7PCK A;  4NV8 A;  4YYU A;  1AIM A;  1AU0 A;  3WXG A;  1GCB A;  2IPP B;  3K9M A;  1FH0 A;  3HHI A;  3HWN A;  3BOW A;  5K16 A;  4Q8H A;  4N4Z A;  3S3Q A;  3WXF A;  3PBH A;  2E02 A;  3CBK A;  2DZZ A;  2AUZ A;  2JQG R;  2DC8 A;  3P5V A;  2R9C A;  2WBF X;  2R9O A;  4BS6 A;  3BWK A;  1NL6 A;  4YVA A;  2PAD A;  2DC9 A;  1EWL A;  4YYQ A;  4YYR A;  5JA7 A;  2BSZ A;  1THE A;  1KXR A;  4Q8G A;  2VFB A;  4BGF A;  1A6R A;  1PIP A;  2F1G A;  2R9M A;  3N3K A;  3P5W A;  4BS5 A;  4WA6 A;  1YT7 A;  3LFY A;  1MEG A;  1ME3 A;  1QMY A;  3KW9 A;  9PAP A;  1Y4H A;  2FO5 A;  3KWB X;  1MDW A;  1U5I A;  4QRX A;  3KX1 A;  2PNS A;  2P86 A;  4YV8 A;  5CHT A;  2AS8 A;  4DMY A;  2FTD A;  5F02 A;  1POP A;  2DC7 A;  2XU5 A;  2CIO A;  4AXM A;  4QRV A;  4QBB A;  2C0Y A;  1F29 A;  3LTW A;  2HH5 A;  3IOQ A;  2FRA A;  2G8E A;  4K7C A;  3PW3 A;  1IWD A;  4PP1 A;  3MOR A;  1GX3 A;  2B1M A;  2BDL A;  2Y6E A;  3ERV A;  2VHS A;  3S3R A;  4X6I A;  3O0U A;  4KLB A;  2FYE A;  2DC6 A;  1EWP A;  3USV A;  1K3B B;  3BPM A;  1U9V A;  4I05 A;  2PRE A;  4ZUX U;  3CH2 X;  1TL9 A;  2ARY A;  2R9N A;  5CVM A;  1VJV A;  2AYO A;  2YJC A;  3C9E A;  1AU2 A;  3K8U A;  2DJF B;  1E2T A;  1EWO A;  1CB5 A;  2OUL A;  2CB5 A;  4NV7 A;  1O0E A;  2AIM A;  1NQC A;  1M6D A;  1EWM A;  2YJB A;  1PPD A;  1F2A A;  2P0R A;  1CS8 A;  5J94 A;  1ZCM A;  1SNK A;  3PDF A;  3RVW A;  1PBH A;  4G54 A;  1QOL A;  5A24 A;  1U9X A;  3F5V A;  2VHF A;  2YJ9 A;  4C5P A;  1AEC A;  2E00 A;  1YK7 A;  3KWZ A;  3OVX A;  4BPV A;  5CVN B;  1XKG A;  1X9Y A;  2GHU A;  4X6H A;  2R9F A;  3M99 A;  1W4T A;  4RY2 A;  1DF0 A;  3H7D A;  3LXS A;  2YJ8 A;  1BQI A;  2DJG B;  2XU3 A;  3OF8 A;  1MS6 A;  1QDQ A;  5EF4 A;  3TNX A;  3AI8 A;  1QXP A;  5FPW A;  1YVB A;  1BGO A;  2G7Y A;  4CDF B;  3H89 A;  4N8W A;  3KKU A;  1CSB B;  4PI3 A;  1AYW A;  2AVW A;  2NQG A;  4QRG A;  1GLO A;  2FRQ A;  2HHN A;  2BDZ A;  1EF7 A;  6PAD A;  3IMA A;  3D6S A;  1KHP A;  1ICF A;  4W4U A;  1F2B A;  1Y08 A;  3KSE A;  3WXE A;  1W6F A;  4CZW A;  4DMX A;  1CVZ A;  4YYV A;  1NB5 A;  4PAD A;  2G8J A;  2XU4 A;  4YYW A;  1MIR A;  3MHH A;  3IV2 A;  5CVO B;  3U8E A;  3BPF A;  4PP2 E;  4I07 A;  4QH6 A;  3OF9 A;  1JQP A;  2PBH A;  4MSX A;  4CDE B;  2NQD B;  2FT2 A;  1PPP A;  3P5U A;  1AU4 A;  1W5R A;  2DCD A;  3MTN A;  3I06 A;  4P6G A;  1U9Q X;  4BQV A;  2DZY A;  1CV8 A;  2GFO A;  3N4C A;  4FK5 A;  4OEL A;  2NQA A;  1MHW A;  1S4V A;  1NPZ A;  2FQ9 A;  1KHQ A;  4FJC A;  3E1Z B;  4MZO A;  5PAD A;  2E03 A;  3MHS A;  1NLJ A;  4P6E A;  2IBI A;  1PE6 A;  1GMY A;  1AYV A;  4OEM A;  3IEJ A;  2G6D A;  1ZIV A;  3IHP A;  3HD3 A;  4XUI A;  3F75 A;  3PNR A;  1Q6K A;  2OP3 A;  3KFQ A;  2DCA A;  4BSQ A;  1TLO A;  1NB3 A;  4X6J A;  2NQI A;  4I04 A;  2H7J A;  2DCB A;  3IUT A;  4AXL A;  2P7U A;  1F2C A;  1MEM A;  3V6E A;  1KFX L;  1AYU A;  1PPN A;  1PPO A;  3B79 A;  1ITO A;  3CBJ A;  3QJ3 A;  4FIP A;  2AUX A;  3BCN A;  1CPJ A;  1DEU A;  5JH3 A;  3P5X A;  4W5B A;  1YK8 A;  1CTE A;  2ATO A;  3I3T A;  2F7D A;  4W5C A;  3NHE A;  2ACT A;  1GEC E;  3H8B A;  1PCI A;  2YJ2 A;  1KFU L;  1HUC B;  3ZUA A;  1YAL A;  1TU6 A;  3K24 A;  3H6S A;  4HWY A;  1ATK A;  2DCC A;  1BP4 A;  2HD5 A;  3O1G A;  2HXZ A;  2OZ2 A;  4YYS A;  1PAD A;  2AYN A;  8PCH A;  3QSD A;  1U9W A;  3QT4 A;  2R6N A;  3OIS A;  2E01 A;  1VSN A;  4MZS A;  5CHV A;  4CDC B;  2AU1 A;  2JQF R;  4GUZ A;  2Y5B A;  3CH3 X;  1CQD A;  3N3G A;  3RVV A;  4B55 A;  5EGW A;  1SP4 B;  3V6C A;  2XU1 A;  4CDD B;  1STF E;  2B1N A;  3OVZ A;  2VFC A;  1CJL A;  3D9W A;  3RVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...