1GLOA

Crystal structure of cys25ser mutant of human cathepsin s
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
217
structure length
217
Chain Sequence
b'LPDSVDWREKGCVTEVKYQGSCGASWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDLKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN S
publication title Structure of a Cys25->Ser Mutant of Human Cathepsin Cathepsin S
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 72
structure length 217
sequence length 217
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2001-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1gloA00
3B79A 3V6CA 3HD3A 2E02A 3QJ3A 4X6IA 1AIMA 1CTEA 2NQIA 2OZ2A 1GMYA 3MHHA 4QBBA 3N3GA 5CHTA 2PBHA 2DJGB 4BPVA 3WXEA 3PBHA 7PCKA 2JQGR 5JH3A 1U9QX 3M99A 1PPNA 1KHQA 4N4ZA 3OF8A 2DJFB 2P7UA 3IV2A 2DCBA 3LXSA 3V6EA 1JQPA 3KFQA 2XU5A 3OISA 1YK7A 2FRQA 6PADA 1M6DA 1KFXL 3KSEA 4XUIA 1EWLA 3O1GA 3IHPA 1PXVA 2AS8A 3GCBA 1PPDA 2DCDA 3ERVA 1NQCA 2GFOA 2DC8A 4WA6A 1Q6KA 5JA7A 1KXRA 1CVZA 4YYRA 2OP3A 4YV8A 1SNKA 1AYWA 1NL6A 2FQ9A 2XU4A 3K9MA 3U8EA 1NB3A 2B1NA 1PE6A 1EWOA 1Y08A 4CZWA 2R6NA 3ZUAA 3QSDA 2B1MA 2AUXA 1EF7A 4FIPA 5PADA 4YYWA 1DF0A 1MS6A 3I06A 5EF4A 1MDWA 3D6SA 1MIRA 2PNSA 4AXLA 2PREA 3NHEA 4MSXA 1AU3A 2FTDA 1TLOA 2Y6EA 1VSNA 1GLOA 3E1ZB 2XU1A 2R9CA 2E00A 2FUDA 5J94A 1ZCMA 4P6GA 4I04A 3P5UA 4QRGA 4Q8HA 1S4VA 3F5VA 3H7DA 5CHVA 1ZIVA 4XR7A 4BS5A 1BGOA 3N3KA 3BPFA 1NPZA 2PADA 4CDCB 4FK5A 2NQAA 2YJ9A 3HHIA 4CDFB 2G8JA 3KWBX 1BQIA 2NQGA 1F2CA 1F29A 2VHSA 3BOWA 4I05A 4YYUA 2R9NA 1VJVA 3CBJA 3BWKA 3P5WA 2DCAA 2HD5A 3OVZA 4YYQA 2DC9A 1YALA 9PAPA 3H6SA 1AU2A 3KKUA 1PIPA 2G6DA 2JQFR 3AI8A 1U9WA 3MTNA 2HXZA 2R9MA 4QRXA 1K3BB 2IBIA 1BY8A 3C9EA 2XU3A 2BDLA 1STFE 3N4CA 5CVMA 2ATOA 1EWMA 2ACTA 5CVOB 4ZUXU 1ITOA 2HHNA 4OELA 1FH0A 2AIMA 2C0YA 1NB5A 1U9XA 1GCBA 2VHFA 1QMYA 2OULA 1PPPA 1POPA 2DC7A 2FO5A 1TU6A 3QT4A 4FJCA 2DC6A 4N79A 4DMXA 4PP1A 3RVXA 1CV8A 2YJ2A 3F75A 4YYSA 3OF9A 2FYEA 4Q8GA 3H89A 1A6RA 4W5BA 1ME3A 1AYUA 2AVWA 1U9VA 5CVNB 3PNRA 2Y5BA 2YJBA 1YK8A 1CPJA 4X6HA 3OVXA 4KLBA 1EWPA 3O0UA 2G7YA 3HHAA 4MZSA 2BDZA 8PCHA 1AYVA 1KHPA 1CS8A 3BCNA 1AECA 4PP2E 3CH2X 2AYNA 2YJ8A 1QXPA 1F2BA 5A24A 4OEMA 2DZYA 4DMYA 2DZZA 2H7JA 4QH6A 2O6XA 3H8CA 1THEA 1CJLA 4BSQA 3IUTA 1ICFA 2HH5A 3HWNA 4HWYA 1F2AA 2AYOA 2NQDB 3K24A 1QOLA 4CDEB 1XKGA 3S3RA 2YJCA 3KX1A 2CB5A 4G54A 4RY2A 3WXGA 3LFYA 4PADA 3BC3A 3KW9A 4YYVA 1BP4A 2F7DA 3PDFA 4BQVA 3I3TA 4BS6A 3MHSA 2IPPB 3DF0A 3P5VA 1CSBB 3P5XA 1O0EA 1YT7A 2E03A 3MORA 1IWDA 2FRAA 1MHWA 2G8EA 1ATKA 1U5IA 1ME4A 3BPMA 4W5CA 1X9YA 4N8WA 5EGWA 1HUCB 2DCCA 4QRVA 1PPOA 1AU0A 2R9FA 4AXMA 1NLJA 2ARYA 1YVBA 5FPWA 1KFUL 1MEMA 2GHUA 3RVVA 1PBHA 1CB5A 4CDDB 4W4UA 2E01A 3USVA 4X6JA 4I07A 4PI3A 5F02A 1DEUA 1SP4B 3TNXA 2F1GA 3CBKA 4P6EA 3RVWA 3WXFA 1AU4A 3K8UA 1Y4HA 5K16A 1QDQA 1CQDA 3IEJA 3IMAA 3IOQA 1GECE 2P86A 2AU1A 2FT2A 1MEGA 1PCIA 3KWZA 2R9OA 2AUZA 4K7CA 2P0RA 3S3QA 3H8BA 2WBFX 4MZOA 4YVAA 3PW3A 2CIOA 3CH3X 1PADA 1TL9A
chains in the Genus database with same CATH superfamily
3B79A 3V6CA 3HD3A 2E02A 3QJ3A 4X6IA 1AIMA 1CTEA 2NQIA 2OZ2A 1GMYA 3MHHA 3N3GA 4QBBA 5CHTA 2PBHA 2DJGB 4BPVA 3WXEA 3PBHA 7PCKA 2JQGR 5JH3A 1U9QX 3M99A 1PPNA 4XZXA 1KHQA 4N4ZA 3OF8A 2DJFB 2P7UA 3PRPA 1DKIA 3IV2A 2DCBA 3LXSA 4OW0A 3V6EA 1JQPA 4MI7A 3KFQA 2XU5A 3OISA 1YK7A 2FRQA 6PADA 1M6DA 1KFXL 3KSEA 4XUIA 1EWLA 3O1GA 3IHPA 1PXVA 2AS8A 3GCBA 3ZNHA 3BY4A 1PPDA 2DCDA 3W30A 4HXDB 3ERVA 1NQCA 2GFOA 2DC8A 4WA6A 1Q6KA 5JA7A 1KXRA 1CVZA 4IUMA 4YYRA 4ZTBA 2OP3A 4YV8A 1SNKA 3MJ5A 2BU3A 1AYWA 1NL6A 2FQ9A 2XU4A 3K9MA 4MM3B 3U8EA 1NB3A 2B1NA 1PE6A 1EWOA 1Y08A 4CZWA 2R6NA 3ZUAA 3QSDA 2B1MA 2AUXA 1EF7A 4FIPA 5PADA 4YYWA 1DF0A 1MS6A 3I06A 5EF4A 1MDWA 3D6SA 1MIRA 2PNSA 4AXLA 2PREA 2HWKA 3NHEA 4RNAA 4MSXA 3W31A 1AU3A 2FTDA 1TLOA 2Y6EA 1VSNA 1GLOA 3E1ZB 2XU1A 2R9CA 2E00A 2FUDA 5J94A 1ZCMA 5KO3A 4P6GA 4I04A 3P5UA 4QRGA 4Q8HA 1S4VA 3F5VA 3H7DA 5CHVA 5E6JA 1ZIVA 4XR7A 4BS5A 1BGOA 2AGAA 3N3KA 4BOUA 3BPFA 1NPZA 2PADA 4CDCB 4FK5A 2NQAA 2YJ9A 3HHIA 4RKXA 4REZA 4CDFB 2G8JA 3KWBX 1BQIA 2NQGA 1F2CA 1F29A 2VHSA 3BOWA 4I05A 4D8IA 3MTVA 4YYUA 2R9NA 1VJVA 3CBJA 3BWKA 3P5WA 2DCAA 2HD5A 3OVZA 4RF1A 4YYQA 5JZEA 2DC9A 1YALA 1YZBA 9PAPA 3H6SA 1AU2A 3KKUA 1PIPA 2G6DA 2JQFR 3AI8A 4OVZB 1U9WA 3MTNA 2HXZA 2R9MA 4QRXA 1K3BB 2IBIA 1BY8A 3C9EA 2XU3A 2BDLA 1STFE 3N4CA 2JTCA 5CVMA 2ATOA 1EWMA 2ACTA 5CVOB 4ZUXU 4BOZA 3IFUA 1ITOA 2HHNA 4OELA 1FH0A 2AIMA 2C0YA 4A5UA 1NB5A 1U9XA 1GCBA 2VHFA 1QMYA 2OULA 3TRKA 1PPPA 2JRIA 2DOSA 3PHXA 1POPA 2DC7A 2FO5A 1TU6A 3QT4A 4FJCA 2DC6A 4N79A 4DMXA 4P16A 4PP1A 4PT5A 3RVXA 1CV8A 3C0RA 2YJ2A 2J7QA 3F75A 4BOSA 3OF9A 4YYSA 2FYEA 4Q8GA 3PSEA 3H89A 5EZSA 1A6RA 4BOPA 3B21A 4W5BA 1ME3A 3RNVA 1AYUA 2AVWA 1U9VA 5CVNB 3PNRA 2Y5BA 2YJBA 1YK8A 1CPJA 4X6HA 3OVXA 4KLBA 1EWPA 3PHUA 3TMPA 3O0UA 2G7YA 3HHAA 2BTWA 2BTWB 3BB7A 4MZSA 2BDZA 8PCHA 1AYVA 1KHPA 1CS8A 3BCNA 2J7QC 3O65A 1AECA 4D8BA 4PP2E 3CH2X 3MP2A 2AYNA 2YJ8A 1QXPA 1F2BA 5A24A 4OEMA 2DZYA 4DMYA 2DZZA 2H7JA 4OVZA 4QH6A 2O6XA 3H8CA 1THEA 1CJLA 4BSQA 3IUTA 1ICFA 2HH5A 3HWNA 4RF0A 4HWYA 1F2AA 5EZQA 2AYOA 2NQDB 4BOQA 3K24A 1QOLA 4CDEB 1XKGA 3S3RA 2YJCA 3KX1A 2CB5A 4G54A 4RY2A 3WXGA 3LFYA 4PADA 3BC3A 3KW9A 4YYVA 4R3DA 1BP4A 2F7DA 3PDFA 4BQVA 3I3TA 4BS6A 3MHSA 2IPPB 3DF0A 3BBAA 3P5VA 3PT2A 1CSBB 3P5XA 1O0EA 1YT7A 2E03A 3MORA 1IWDA 2FRAA 1MHWA 2G8EA 1ATKA 1U5IA 3OQCA 1ME4A 3BPMA 4W5CA 1X9YA 4N8WA 5EGWA 1HUCB 2DCCA 4QRVA 1PPOA 2FE8A 1AU0A 2R9FA 4AXMA 1NLJA 2ARYA 1YVBA 5FPWA 1KFUL 1MEMA 2GHUA 3RVVA 1PBHA 1CB5A 4CDDB 3E9SA 4W4UA 2E01A 3USVA 4X6JA 4I07A 4IP3A 4PI3A 4WURA 4D8EA 5F02A 2UZJA 1DEUA 1SP4B 3TNXA 2F1GA 3CBKA 4P6EA 3PRMA 3RVWA 3WXFA 3PHWA 1AU4A 3K8UA 1Y4HA 5K16A 1PVJA 1QDQA 1CQDA 4GUAA 3IEJA 1UKFA 3IMAA 3IOQA 1GECE 2P86A 2AU1A 2FT2A 1MEGA 1PCIA 2Z84A 3KWZA 2R9OA 2AUZA 4K7CA 2P0RA 3S3QA 3H8BA 2WBFX 4MZOA 4YVAA 3PW3A 2CIOA 4M0WA 3CH3X 1PADA 1TL9A
chains in the Genus database with same CATH topology
3B79A 3V6CA 3HD3A 2E02A 3QJ3A 4X6IA 1AIMA 1CTEA 2NQIA 2OZ2A 1GMYA 3MHHA 3N3GA 4QBBA 5CHTA 2PBHA 2DJGB 4BPVA 3WXEA 3PBHA 7PCKA 2JQGR 5JH3A 1U9QX 3M99A 1PPNA 1KHQA 4GUZA 4N4ZA 3OF8A 2DJFB 2P7UA 3IV2A 2DCBA 3LXSA 3V6EA 1JQPA 3KFQA 2XU5A 3OISA 1YK7A 2FRQA 6PADA 1M6DA 1KFXL 3KSEA 4XUIA 1EWLA 3O1GA 3IHPA 1PXVA 2AS8A 3GCBA 1PPDA 2DCDA 3ERVA 1NQCA 2GFOA 2DC8A 4WA6A 1Q6KA 5JA7A 1KXRA 1CVZA 4YYRA 2OP3A 4YV8A 1SNKA 1GX3A 1AYWA 1NL6A 2FQ9A 2XU4A 3K9MA 3U8EA 1NB3A 2B1NA 1PE6A 1EWOA 1Y08A 4CZWA 2R6NA 3ZUAA 3QSDA 2B1MA 2AUXA 1EF7A 4FIPA 5PADA 4YYWA 1DF0A 1MS6A 3I06A 5EF4A 1MDWA 3D6SA 1MIRA 2PNSA 4AXLA 2PREA 3NHEA 4MSXA 1AU3A 4B55A 2FTDA 1TLOA 2Y6EA 1VSNA 1GLOA 3E1ZB 2XU1A 2R9CA 2E00A 2FUDA 5J94A 1ZCMA 4P6GA 4I04A 3P5UA 4QRGA 4Q8HA 1S4VA 3F5VA 3H7DA 5CHVA 1ZIVA 4XR7A 4BS5A 1BGOA 3N3KA 4BGFA 3BPFA 1NPZA 2PADA 4C5PA 4CDCB 4FK5A 2NQAA 2YJ9A 3HHIA 4CDFB 2G8JA 3KWBX 1BQIA 2NQGA 1F2CA 1F29A 2VHSA 3BOWA 4I05A 4YYUA 2R9NA 1VJVA 3CBJA 3BWKA 3P5WA 2DCAA 2HD5A 3OVZA 4YYQA 2DC9A 1YALA 9PAPA 3H6SA 1AU2A 3KKUA 1PIPA 2G6DA 2JQFR 3AI8A 3D9WA 1U9WA 3MTNA 2HXZA 2R9MA 4QRXA 1K3BB 2IBIA 1BY8A 3C9EA 2XU3A 2BDLA 1STFE 3N4CA 5CVMA 2ATOA 1EWMA 4NV7A 2ACTA 2VFCA 5CVOB 4ZUXU 4NV8A 1ITOA 2HHNA 4OELA 1FH0A 1W5RA 2AIMA 2C0YA 1NB5A 1U9XA 1GCBA 2VHFA 1QMYA 2OULA 1PPPA 1E2TA 1POPA 2DC7A 2FO5A 1TU6A 3QT4A 4FJCA 2DC6A 4N79A 4DMXA 4PP1A 3RVXA 1CV8A 2YJ2A 3F75A 4YYSA 3OF9A 2FYEA 4Q8GA 3H89A 1A6RA 4W5BA 1ME3A 2BSZA 1AYUA 2AVWA 1U9VA 5CVNB 3PNRA 2Y5BA 2YJBA 1YK8A 1CPJA 4X6HA 3OVXA 4KLBA 1EWPA 3O0UA 2G7YA 3HHAA 4MZSA 2BDZA 8PCHA 1AYVA 1KHPA 1CS8A 3BCNA 1AECA 4PP2E 3CH2X 2AYNA 2YJ8A 1QXPA 1F2BA 5A24A 4OEMA 2DZYA 4DMYA 2DZZA 2H7JA 4QH6A 2O6XA 3H8CA 1THEA 1CJLA 4BSQA 3IUTA 1ICFA 2HH5A 3HWNA 4HWYA 1F2AA 2AYOA 2NQDB 3K24A 1QOLA 4CDEB 1W4TA 1XKGA 3S3RA 2YJCA 3KX1A 2CB5A 4G54A 4RY2A 3WXGA 3LFYA 4PADA 3BC3A 3KW9A 4YYVA 1BP4A 2F7DA 3PDFA 4BQVA 3I3TA 4BS6A 3MHSA 2IPPB 3DF0A 3P5VA 1CSBB 3P5XA 1O0EA 1YT7A 2E03A 1W6FA 3MORA 1IWDA 2FRAA 1MHWA 2G8EA 1ATKA 1U5IA 1ME4A 3BPMA 4W5CA 1X9YA 4N8WA 2VFBA 5EGWA 1HUCB 2DCCA 4QRVA 1PPOA 1AU0A 2R9FA 4AXMA 1NLJA 2ARYA 1YVBA 5FPWA 1KFUL 1MEMA 2GHUA 3RVVA 1PBHA 1CB5A 4CDDB 4W4UA 2E01A 3USVA 4X6JA 4I07A 4PI3A 5F02A 1DEUA 1SP4B 3TNXA 2F1GA 3CBKA 4P6EA 3RVWA 3WXFA 1AU4A 3K8UA 1Y4HA 5K16A 1QDQA 1CQDA 3IEJA 3IMAA 3IOQA 1GECE 2P86A 2AU1A 2FT2A 1MEGA 1PCIA 3KWZA 2R9OA 2AUZA 4K7CA 2P0RA 3S3QA 3H8BA 2WBFX 4MZOA 4YVAA 3PW3A 2CIOA 3LTWA 3CH3X 1PADA 1TL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B79 A;  3V6C A;  3HD3 A;  2E02 A;  3QJ3 A;  4X6I A;  1AIM A;  1CTE A;  2NQI A;  2OZ2 A;  1GMY A;  3MHH A;  4QBB A;  3N3G A;  5CHT A;  2PBH A;  2DJG B;  4BPV A;  3WXE A;  3PBH A;  7PCK A;  2JQG R;  5JH3 A;  1U9Q X;  3M99 A;  1PPN A;  1KHQ A;  4N4Z A;  3OF8 A;  2DJF B;  2P7U A;  3IV2 A;  2DCB A;  3LXS A;  3V6E A;  1JQP A;  3KFQ A;  2XU5 A;  3OIS A;  1YK7 A;  2FRQ A;  6PAD A;  1M6D A;  1KFX L;  3KSE A;  4XUI A;  1EWL A;  3O1G A;  3IHP A;  1PXV A;  2AS8 A;  3GCB A;  1PPD A;  2DCD A;  3ERV A;  1NQC A;  2GFO A;  2DC8 A;  4WA6 A;  1Q6K A;  5JA7 A;  1KXR A;  1CVZ A;  4YYR A;  2OP3 A;  4YV8 A;  1SNK A;  1AYW A;  1NL6 A;  2FQ9 A;  2XU4 A;  3K9M A;  3U8E A;  1NB3 A;  2B1N A;  1PE6 A;  1EWO A;  1Y08 A;  4CZW A;  2R6N A;  3ZUA A;  3QSD A;  2B1M A;  2AUX A;  1EF7 A;  4FIP A;  5PAD A;  4YYW A;  1DF0 A;  1MS6 A;  3I06 A;  5EF4 A;  1MDW A;  3D6S A;  1MIR A;  2PNS A;  4AXL A;  2PRE A;  3NHE A;  4MSX A;  1AU3 A;  2FTD A;  1TLO A;  2Y6E A;  1VSN A;  1GLO A;  3E1Z B;  2XU1 A;  2R9C A;  2E00 A;  2FUD A;  5J94 A;  1ZCM A;  4P6G A;  4I04 A;  3P5U A;  4QRG A;  4Q8H A;  1S4V A;  3F5V A;  3H7D A;  5CHV A;  1ZIV A;  4XR7 A;  4BS5 A;  1BGO A;  3N3K A;  3BPF A;  1NPZ A;  2PAD A;  4CDC B;  4FK5 A;  2NQA A;  2YJ9 A;  3HHI A;  4CDF B;  2G8J A;  3KWB X;  1BQI A;  2NQG A;  1F2C A;  1F29 A;  2VHS A;  3BOW A;  4I05 A;  4YYU A;  2R9N A;  1VJV A;  3CBJ A;  3BWK A;  3P5W A;  2DCA A;  2HD5 A;  3OVZ A;  4YYQ A;  2DC9 A;  1YAL A;  9PAP A;  3H6S A;  1AU2 A;  3KKU A;  1PIP A;  2G6D A;  2JQF R;  3AI8 A;  1U9W A;  3MTN A;  2HXZ A;  2R9M A;  4QRX A;  1K3B B;  2IBI A;  1BY8 A;  3C9E A;  2XU3 A;  2BDL A;  1STF E;  3N4C A;  5CVM A;  2ATO A;  1EWM A;  2ACT A;  5CVO B;  4ZUX U;  1ITO A;  2HHN A;  4OEL A;  1FH0 A;  2AIM A;  2C0Y A;  1NB5 A;  1U9X A;  1GCB A;  2VHF A;  1QMY A;  2OUL A;  1PPP A;  1POP A;  2DC7 A;  2FO5 A;  1TU6 A;  3QT4 A;  4FJC A;  2DC6 A;  4N79 A;  4DMX A;  4PP1 A;  3RVX A;  1CV8 A;  2YJ2 A;  3F75 A;  4YYS A;  3OF9 A;  2FYE A;  4Q8G A;  3H89 A;  1A6R A;  4W5B A;  1ME3 A;  1AYU A;  2AVW A;  1U9V A;  5CVN B;  3PNR A;  2Y5B A;  2YJB A;  1YK8 A;  1CPJ A;  4X6H A;  3OVX A;  4KLB A;  1EWP A;  3O0U A;  2G7Y A;  3HHA A;  4MZS A;  2BDZ A;  8PCH A;  1AYV A;  1KHP A;  1CS8 A;  3BCN A;  1AEC A;  4PP2 E;  3CH2 X;  2AYN A;  2YJ8 A;  1QXP A;  1F2B A;  5A24 A;  4OEM A;  2DZY A;  4DMY A;  2DZZ A;  2H7J A;  4QH6 A;  2O6X A;  3H8C A;  1THE A;  1CJL A;  4BSQ A;  3IUT A;  1ICF A;  2HH5 A;  3HWN A;  4HWY A;  1F2A A;  2AYO A;  2NQD B;  3K24 A;  1QOL A;  4CDE B;  1XKG A;  3S3R A;  2YJC A;  3KX1 A;  2CB5 A;  4G54 A;  4RY2 A;  3WXG A;  3LFY A;  4PAD A;  3BC3 A;  3KW9 A;  4YYV A;  1BP4 A;  2F7D A;  3PDF A;  4BQV A;  3I3T A;  4BS6 A;  3MHS A;  2IPP B;  3DF0 A;  3P5V A;  1CSB B;  3P5X A;  1O0E A;  1YT7 A;  2E03 A;  3MOR A;  1IWD A;  2FRA A;  1MHW A;  2G8E A;  1ATK A;  1U5I A;  1ME4 A;  3BPM A;  4W5C A;  1X9Y A;  4N8W A;  5EGW A;  1HUC B;  2DCC A;  4QRV A;  1PPO A;  1AU0 A;  2R9F A;  4AXM A;  1NLJ A;  2ARY A;  1YVB A;  5FPW A;  1KFU L;  1MEM A;  2GHU A;  3RVV A;  1PBH A;  1CB5 A;  4CDD B;  4W4U A;  2E01 A;  3USV A;  4X6J A;  4I07 A;  4PI3 A;  5F02 A;  1DEU A;  1SP4 B;  3TNX A;  2F1G A;  3CBK A;  4P6E A;  3RVW A;  3WXF A;  1AU4 A;  3K8U A;  1Y4H A;  5K16 A;  1QDQ A;  1CQD A;  3IEJ A;  3IMA A;  3IOQ A;  1GEC E;  2P86 A;  2AU1 A;  2FT2 A;  1MEG A;  1PCI A;  3KWZ A;  2R9O A;  2AUZ A;  4K7C A;  2P0R A;  3S3Q A;  3H8B A;  2WBF X;  4MZO A;  4YVA A;  3PW3 A;  2CIO A;  3CH3 X;  1PAD A;  1TL9 A; 
#chains in the Genus database with same CATH topology
 3B79 A;  3V6C A;  3HD3 A;  2E02 A;  3QJ3 A;  4X6I A;  1AIM A;  1CTE A;  2NQI A;  2OZ2 A;  1GMY A;  3MHH A;  3N3G A;  4QBB A;  5CHT A;  2PBH A;  2DJG B;  4BPV A;  3WXE A;  3PBH A;  7PCK A;  2JQG R;  5JH3 A;  1U9Q X;  3M99 A;  1PPN A;  4XZX A;  1KHQ A;  4N4Z A;  3OF8 A;  2DJF B;  2P7U A;  3PRP A;  1DKI A;  3IV2 A;  2DCB A;  3LXS A;  4OW0 A;  3V6E A;  1JQP A;  4MI7 A;  3KFQ A;  2XU5 A;  3OIS A;  1YK7 A;  2FRQ A;  6PAD A;  1M6D A;  1KFX L;  3KSE A;  4XUI A;  1EWL A;  3O1G A;  3IHP A;  1PXV A;  2AS8 A;  3GCB A;  3ZNH A;  3BY4 A;  1PPD A;  2DCD A;  3W30 A;  4HXD B;  3ERV A;  1NQC A;  2GFO A;  2DC8 A;  4WA6 A;  1Q6K A;  5JA7 A;  1KXR A;  1CVZ A;  4IUM A;  4YYR A;  4ZTB A;  2OP3 A;  4YV8 A;  1SNK A;  3MJ5 A;  2BU3 A;  1AYW A;  1NL6 A;  2FQ9 A;  2XU4 A;  3K9M A;  4MM3 B;  3U8E A;  1NB3 A;  2B1N A;  1PE6 A;  1EWO A;  1Y08 A;  4CZW A;  2R6N A;  3ZUA A;  3QSD A;  2B1M A;  2AUX A;  1EF7 A;  4FIP A;  5PAD A;  4YYW A;  1DF0 A;  1MS6 A;  3I06 A;  5EF4 A;  1MDW A;  3D6S A;  1MIR A;  2PNS A;  4AXL A;  2PRE A;  2HWK A;  3NHE A;  4RNA A;  4MSX A;  3W31 A;  1AU3 A;  2FTD A;  1TLO A;  2Y6E A;  1VSN A;  1GLO A;  3E1Z B;  2XU1 A;  2R9C A;  2E00 A;  2FUD A;  5J94 A;  1ZCM A;  5KO3 A;  4P6G A;  4I04 A;  3P5U A;  4QRG A;  4Q8H A;  1S4V A;  3F5V A;  3H7D A;  5CHV A;  5E6J A;  1ZIV A;  4XR7 A;  4BS5 A;  1BGO A;  2AGA A;  3N3K A;  4BOU A;  3BPF A;  1NPZ A;  2PAD A;  4CDC B;  4FK5 A;  2NQA A;  2YJ9 A;  3HHI A;  4RKX A;  4REZ A;  4CDF B;  2G8J A;  3KWB X;  1BQI A;  2NQG A;  1F2C A;  1F29 A;  2VHS A;  3BOW A;  4I05 A;  4D8I A;  3MTV A;  4YYU A;  2R9N A;  1VJV A;  3CBJ A;  3BWK A;  3P5W A;  2DCA A;  2HD5 A;  3OVZ A;  4RF1 A;  4YYQ A;  5JZE A;  2DC9 A;  1YAL A;  1YZB A;  9PAP A;  3H6S A;  1AU2 A;  3KKU A;  1PIP A;  2G6D A;  2JQF R;  3AI8 A;  4OVZ B;  1U9W A;  3MTN A;  2HXZ A;  2R9M A;  4QRX A;  1K3B B;  2IBI A;  1BY8 A;  3C9E A;  2XU3 A;  2BDL A;  1STF E;  3N4C A;  2JTC A;  5CVM A;  2ATO A;  1EWM A;  2ACT A;  5CVO B;  4ZUX U;  4BOZ A;  3IFU A;  1ITO A;  2HHN A;  4OEL A;  1FH0 A;  2AIM A;  2C0Y A;  4A5U A;  1NB5 A;  1U9X A;  1GCB A;  2VHF A;  1QMY A;  2OUL A;  3TRK A;  1PPP A;  2JRI A;  2DOS A;  3PHX A;  1POP A;  2DC7 A;  2FO5 A;  1TU6 A;  3QT4 A;  4FJC A;  2DC6 A;  4N79 A;  4DMX A;  4P16 A;  4PP1 A;  4PT5 A;  3RVX A;  1CV8 A;  3C0R A;  2YJ2 A;  2J7Q A;  3F75 A;  4BOS A;  3OF9 A;  4YYS A;  2FYE A;  4Q8G A;  3PSE A;  3H89 A;  5EZS A;  1A6R A;  4BOP A;  3B21 A;  4W5B A;  1ME3 A;  3RNV A;  1AYU A;  2AVW A;  1U9V A;  5CVN B;  3PNR A;  2Y5B A;  2YJB A;  1YK8 A;  1CPJ A;  4X6H A;  3OVX A;  4KLB A;  1EWP A;  3PHU A;  3TMP A;  3O0U A;  2G7Y A;  3HHA A;  2BTW A;  2BTW B;  3BB7 A;  4MZS A;  2BDZ A;  8PCH A;  1AYV A;  1KHP A;  1CS8 A;  3BCN A;  2J7Q C;  3O65 A;  1AEC A;  4D8B A;  4PP2 E;  3CH2 X;  3MP2 A;  2AYN A;  2YJ8 A;  1QXP A;  1F2B A;  5A24 A;  4OEM A;  2DZY A;  4DMY A;  2DZZ A;  2H7J A;  4OVZ A;  4QH6 A;  2O6X A;  3H8C A;  1THE A;  1CJL A;  4BSQ A;  3IUT A;  1ICF A;  2HH5 A;  3HWN A;  4RF0 A;  4HWY A;  1F2A A;  5EZQ A;  2AYO A;  2NQD B;  4BOQ A;  3K24 A;  1QOL A;  4CDE B;  1XKG A;  3S3R A;  2YJC A;  3KX1 A;  2CB5 A;  4G54 A;  4RY2 A;  3WXG A;  3LFY A;  4PAD A;  3BC3 A;  3KW9 A;  4YYV A;  4R3D A;  1BP4 A;  2F7D A;  3PDF A;  4BQV A;  3I3T A;  4BS6 A;  3MHS A;  2IPP B;  3DF0 A;  3BBA A;  3P5V A;  3PT2 A;  1CSB B;  3P5X A;  1O0E A;  1YT7 A;  2E03 A;  3MOR A;  1IWD A;  2FRA A;  1MHW A;  2G8E A;  1ATK A;  1U5I A;  3OQC A;  1ME4 A;  3BPM A;  4W5C A;  1X9Y A;  4N8W A;  5EGW A;  1HUC B;  2DCC A;  4QRV A;  1PPO A;  2FE8 A;  1AU0 A;  2R9F A;  4AXM A;  1NLJ A;  2ARY A;  1YVB A;  5FPW A;  1KFU L;  1MEM A;  2GHU A;  3RVV A;  1PBH A;  1CB5 A;  4CDD B;  3E9S A;  4W4U A;  2E01 A;  3USV A;  4X6J A;  4I07 A;  4IP3 A;  4PI3 A;  4WUR A;  4D8E A;  5F02 A;  2UZJ A;  1DEU A;  1SP4 B;  3TNX A;  2F1G A;  3CBK A;  4P6E A;  3PRM A;  3RVW A;  3WXF A;  3PHW A;  1AU4 A;  3K8U A;  1Y4H A;  5K16 A;  1PVJ A;  1QDQ A;  1CQD A;  4GUA A;  3IEJ A;  1UKF A;  3IMA A;  3IOQ A;  1GEC E;  2P86 A;  2AU1 A;  2FT2 A;  1MEG A;  1PCI A;  2Z84 A;  3KWZ A;  2R9O A;  2AUZ A;  4K7C A;  2P0R A;  3S3Q A;  3H8B A;  2WBF X;  4MZO A;  4YVA A;  3PW3 A;  2CIO A;  4M0W A;  3CH3 X;  1PAD A;  1TL9 A; 
#chains in the Genus database with same CATH homology
 3B79 A;  3V6C A;  3HD3 A;  2E02 A;  3QJ3 A;  4X6I A;  1AIM A;  1CTE A;  2NQI A;  2OZ2 A;  1GMY A;  3MHH A;  3N3G A;  4QBB A;  5CHT A;  2PBH A;  2DJG B;  4BPV A;  3WXE A;  3PBH A;  7PCK A;  2JQG R;  5JH3 A;  1U9Q X;  3M99 A;  1PPN A;  1KHQ A;  4GUZ A;  4N4Z A;  3OF8 A;  2DJF B;  2P7U A;  3IV2 A;  2DCB A;  3LXS A;  3V6E A;  1JQP A;  3KFQ A;  2XU5 A;  3OIS A;  1YK7 A;  2FRQ A;  6PAD A;  1M6D A;  1KFX L;  3KSE A;  4XUI A;  1EWL A;  3O1G A;  3IHP A;  1PXV A;  2AS8 A;  3GCB A;  1PPD A;  2DCD A;  3ERV A;  1NQC A;  2GFO A;  2DC8 A;  4WA6 A;  1Q6K A;  5JA7 A;  1KXR A;  1CVZ A;  4YYR A;  2OP3 A;  4YV8 A;  1SNK A;  1GX3 A;  1AYW A;  1NL6 A;  2FQ9 A;  2XU4 A;  3K9M A;  3U8E A;  1NB3 A;  2B1N A;  1PE6 A;  1EWO A;  1Y08 A;  4CZW A;  2R6N A;  3ZUA A;  3QSD A;  2B1M A;  2AUX A;  1EF7 A;  4FIP A;  5PAD A;  4YYW A;  1DF0 A;  1MS6 A;  3I06 A;  5EF4 A;  1MDW A;  3D6S A;  1MIR A;  2PNS A;  4AXL A;  2PRE A;  3NHE A;  4MSX A;  1AU3 A;  4B55 A;  2FTD A;  1TLO A;  2Y6E A;  1VSN A;  1GLO A;  3E1Z B;  2XU1 A;  2R9C A;  2E00 A;  2FUD A;  5J94 A;  1ZCM A;  4P6G A;  4I04 A;  3P5U A;  4QRG A;  4Q8H A;  1S4V A;  3F5V A;  3H7D A;  5CHV A;  1ZIV A;  4XR7 A;  4BS5 A;  1BGO A;  3N3K A;  4BGF A;  3BPF A;  1NPZ A;  2PAD A;  4C5P A;  4CDC B;  4FK5 A;  2NQA A;  2YJ9 A;  3HHI A;  4CDF B;  2G8J A;  3KWB X;  1BQI A;  2NQG A;  1F2C A;  1F29 A;  2VHS A;  3BOW A;  4I05 A;  4YYU A;  2R9N A;  1VJV A;  3CBJ A;  3BWK A;  3P5W A;  2DCA A;  2HD5 A;  3OVZ A;  4YYQ A;  2DC9 A;  1YAL A;  9PAP A;  3H6S A;  1AU2 A;  3KKU A;  1PIP A;  2G6D A;  2JQF R;  3AI8 A;  3D9W A;  1U9W A;  3MTN A;  2HXZ A;  2R9M A;  4QRX A;  1K3B B;  2IBI A;  1BY8 A;  3C9E A;  2XU3 A;  2BDL A;  1STF E;  3N4C A;  5CVM A;  2ATO A;  1EWM A;  4NV7 A;  2ACT A;  2VFC A;  5CVO B;  4ZUX U;  4NV8 A;  1ITO A;  2HHN A;  4OEL A;  1FH0 A;  1W5R A;  2AIM A;  2C0Y A;  1NB5 A;  1U9X A;  1GCB A;  2VHF A;  1QMY A;  2OUL A;  1PPP A;  1E2T A;  1POP A;  2DC7 A;  2FO5 A;  1TU6 A;  3QT4 A;  4FJC A;  2DC6 A;  4N79 A;  4DMX A;  4PP1 A;  3RVX A;  1CV8 A;  2YJ2 A;  3F75 A;  4YYS A;  3OF9 A;  2FYE A;  4Q8G A;  3H89 A;  1A6R A;  4W5B A;  1ME3 A;  2BSZ A;  1AYU A;  2AVW A;  1U9V A;  5CVN B;  3PNR A;  2Y5B A;  2YJB A;  1YK8 A;  1CPJ A;  4X6H A;  3OVX A;  4KLB A;  1EWP A;  3O0U A;  2G7Y A;  3HHA A;  4MZS A;  2BDZ A;  8PCH A;  1AYV A;  1KHP A;  1CS8 A;  3BCN A;  1AEC A;  4PP2 E;  3CH2 X;  2AYN A;  2YJ8 A;  1QXP A;  1F2B A;  5A24 A;  4OEM A;  2DZY A;  4DMY A;  2DZZ A;  2H7J A;  4QH6 A;  2O6X A;  3H8C A;  1THE A;  1CJL A;  4BSQ A;  3IUT A;  1ICF A;  2HH5 A;  3HWN A;  4HWY A;  1F2A A;  2AYO A;  2NQD B;  3K24 A;  1QOL A;  4CDE B;  1W4T A;  1XKG A;  3S3R A;  2YJC A;  3KX1 A;  2CB5 A;  4G54 A;  4RY2 A;  3WXG A;  3LFY A;  4PAD A;  3BC3 A;  3KW9 A;  4YYV A;  1BP4 A;  2F7D A;  3PDF A;  4BQV A;  3I3T A;  4BS6 A;  3MHS A;  2IPP B;  3DF0 A;  3P5V A;  1CSB B;  3P5X A;  1O0E A;  1YT7 A;  2E03 A;  1W6F A;  3MOR A;  1IWD A;  2FRA A;  1MHW A;  2G8E A;  1ATK A;  1U5I A;  1ME4 A;  3BPM A;  4W5C A;  1X9Y A;  4N8W A;  2VFB A;  5EGW A;  1HUC B;  2DCC A;  4QRV A;  1PPO A;  1AU0 A;  2R9F A;  4AXM A;  1NLJ A;  2ARY A;  1YVB A;  5FPW A;  1KFU L;  1MEM A;  2GHU A;  3RVV A;  1PBH A;  1CB5 A;  4CDD B;  4W4U A;  2E01 A;  3USV A;  4X6J A;  4I07 A;  4PI3 A;  5F02 A;  1DEU A;  1SP4 B;  3TNX A;  2F1G A;  3CBK A;  4P6E A;  3RVW A;  3WXF A;  1AU4 A;  3K8U A;  1Y4H A;  5K16 A;  1QDQ A;  1CQD A;  3IEJ A;  3IMA A;  3IOQ A;  1GEC E;  2P86 A;  2AU1 A;  2FT2 A;  1MEG A;  1PCI A;  3KWZ A;  2R9O A;  2AUZ A;  4K7C A;  2P0R A;  3S3Q A;  3H8B A;  2WBF X;  4MZO A;  4YVA A;  3PW3 A;  2CIO A;  3LTW A;  3CH3 X;  1PAD A;  1TL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...