3CBKA

Chagasin-cathepsin b
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
257
structure length
257
Chain Sequence
b'LKLPASFDAREQWPQCPTIKEIRDQGSCGSAWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEAHVNGARPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin B
publication title Displacement of the occluding loop by the parasite protein, chagasin, results in efficient inhibition of human cathepsin B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 60
structure length 257
sequence length 257
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2008-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3cbkA00
1NQCA 3GCBA 1KFXL 1KFUL 3V6CA 2P86A 4FJCA 4HWYA 2NQGA 1NLJA 2C0YA 1BP4A 3KX1A 2XU3A 4MSXA 5PADA 4BS6A 4AXMA 3V6EA 3USVA 2NQAA 2DC6A 1Q6KA 2PNSA 3TNXA 3I06A 3ZUAA 1TLOA 1CV8A 4XR7A 2YJCA 1MEMA 4CDDB 3WXGA 3BCNA 3ERVA 4FK5A 2ARYA 3P5XA 3WXEA 1A6RA 2OZ2A 3QT4A 3MTNA 2DJGB 9PAPA 2IPPB 1ICFA 1NPZA 4X6HA 3RVWA 4DMXA 2F1GA 1PBHA 4X6IA 2G8EA 4X6JA 5K16A 1MEGA 4N79A 1AECA 1XKGA 2FQ9A 1ME3A 1CJLA 2YJ9A 1YALA 1PADA 3IHPA 3DF0A 1YT7A 2AYOA 4CDCB 2PBHA 1F2BA 4OEMA 3QJ3A 2G8JA 1NL6A 2R9FA 1EWPA 3S3QA 2PADA 2BDZA 1PE6A 3I3TA 2AUZA 3HWNA 3KFQA 3LXSA 3LFYA 3P5UA 1CVZA 3OISA 1U9XA 2E03A 2R9CA 5EGWA 2XU5A 1YVBA 3KWBX 2DCBA 3F75A 1K3BB 1GCBA 3RVXA 1Y08A 4Q8HA 4QBBA 1PCIA 2B1MA 1POPA 4KLBA 3OVXA 2R9MA 2HH5A 4P6GA 1SNKA 3M99A 2CB5A 3BC3A 3MHHA 5CHTA 5F02A 2DZYA 4YV8A 1Y4HA 2DJFB 2DC8A 1PPPA 3WXFA 1U9WA 1QOLA 2G7YA 2CIOA 2GHUA 1JQPA 2VHSA 7PCKA 3KWZA 2AVWA 1PIPA 1ZCMA 4YVAA 5CVMA 3U8EA 2FRQA 3N4CA 3MORA 4W5BA 2XU1A 4OELA 4PP2E 1ATKA 3B79A 1NB5A 4YYVA 3OVZA 1ME4A 4MZSA 2R6NA 4FIPA 1CTEA 4AXLA 4MZOA 4YYRA 2OULA 1CS8A 1S4VA 1KHQA 1PPDA 3IMAA 2DCAA 2GFOA 4PP1A 1O0EA 3QSDA 2FT2A 3NHEA 2FRAA 4N8WA 4I07A 3KW9A 4BQVA 1CPJA 1BQIA 2DC9A 2BDLA 4YYQA 4YYWA 1GECE 3O1GA 4N4ZA 1TL9A 2XU4A 8PCHA 3D6SA 5JH3A 2P7UA 2AYNA 3OF9A 4YYUA 3KKUA 2HD5A 1VJVA 2DCDA 2NQDB 3BPFA 2DCCA 1AU2A 3E1ZB 3P5VA 3PNRA 4W4UA 2AS8A 5EF4A 3O0UA 1F2CA 3H7DA 1MDWA 3AI8A 2FTDA 2YJ2A 2ATOA 1DEUA 1F29A 3K8UA 3HHAA 1AYUA 2G6DA 2HXZA 4RY2A 4QRVA 4DMYA 2OP3A 3P5WA 2Y6EA 3H8CA 2DC7A 2YJ8A 1U5IA 3HHIA 1QXPA 1CB5A 1PXVA 1AYWA 3RVVA 4CDEB 2VHFA 1BGOA 4ZUXU 2IBIA 1AU3A 3CH2X 1ZIVA 2YJBA 3F5VA 2R9OA 4XUIA 2O6XA 1FH0A 1GMYA 1KHPA 1MS6A 4CDFB 4W5CA 1CQDA 2ACTA 1AYVA 1VSNA 4CZWA 2PREA 2B1NA 3OF8A 1SP4B 3S3RA 1AU4A 4G54A 2Y5BA 1M6DA 1EWOA 4BS5A 1PPNA 3CBKA 4Q8GA 3PDFA 5FPWA 3N3GA 4QH6A 1EF7A 2DZZA 5CVNB 2WBFX 3BPMA 3IEJA 1U9QX 6PADA 4YYSA 2JQFR 1DF0A 3PBHA 1STFE 2E00A 1U9VA 1NB3A 2H7JA 3CBJA 3IOQA 1F2AA 4WA6A 5JA7A 2FO5A 3MHSA 1AU0A 3H89A 4P6EA 4PADA 2E02A 4QRXA 2FUDA 4I04A 1QDQA 4QRGA 3KSEA 3C9EA 3PW3A 4K7CA 4BPVA 2AUXA 3CH3X 1EWMA 2JQGR 1PPOA 4I05A 3BOWA 2P0RA 1YK7A 1X9YA 4PI3A 1EWLA 2AU1A 5CHVA 5CVOB 3IV2A 1CSBB 2E01A 3IUTA 1GLOA 1MIRA 1HUCB 4BSQA 1BY8A 1YK8A 2FYEA 3N3KA 2HHNA 3HD3A 2R9NA 5J94A 1ITOA 1QMYA 3BWKA 5A24A 1TU6A 1KXRA 1MHWA 2NQIA 1AIMA 2AIMA 3H6SA 3K9MA 2F7DA 3K24A 1THEA 1IWDA 3H8BA
chains in the Genus database with same CATH superfamily
1NQCA 3GCBA 1KFXL 1KFUL 3MJ5A 3V6CA 2P86A 4FJCA 4HWYA 2NQGA 1NLJA 3PHUA 3TMPA 2C0YA 1BP4A 3KX1A 3IFUA 2XU3A 4MSXA 5PADA 4BS6A 4AXMA 3V6EA 4XZXA 3USVA 2NQAA 2DC6A 1Q6KA 3ZNHA 2HWKA 3PSEA 2PNSA 3TNXA 3I06A 3ZUAA 1TLOA 1CV8A 4HXDB 4XR7A 2YJCA 1MEMA 2J7QC 3B21A 4CDDB 3WXGA 3BCNA 4MM3B 3ERVA 4FK5A 2ARYA 3P5XA 3WXEA 1A6RA 2OZ2A 3QT4A 3MTNA 2DJGB 9PAPA 2IPPB 1ICFA 1NPZA 1UKFA 4X6HA 3RVWA 4DMXA 2F1GA 1PBHA 4X6IA 3E9SA 2G8EA 4X6JA 5K16A 4BOPA 1MEGA 4N79A 1AECA 1XKGA 2FQ9A 1ME3A 4BOZA 1CJLA 2YJ9A 1YALA 1PADA 3IHPA 3DF0A 1YT7A 2AYOA 4CDCB 4OW0A 2PBHA 1F2BA 4OEMA 3QJ3A 2G8JA 1NL6A 2R9FA 4BOSA 1EWPA 3S3QA 1PVJA 2PADA 2BDZA 1PE6A 3I3TA 2AUZA 3HWNA 3KFQA 4IUMA 3LXSA 4D8IA 3LFYA 3P5UA 1DKIA 1CVZA 3OISA 4D8BA 1U9XA 4WURA 3RNVA 2E03A 2R9CA 5EGWA 2DOSA 2XU5A 1YVBA 3KWBX 2DCBA 3F75A 1K3BB 1GCBA 3RVXA 1Y08A 4Q8HA 4QBBA 1PCIA 2B1MA 1POPA 4KLBA 4P16A 4PT5A 2FE8A 3MP2A 3OVXA 2R9MA 2HH5A 4P6GA 1SNKA 3M99A 2CB5A 3BC3A 3MHHA 5CHTA 5F02A 2DZYA 4YV8A 3O65A 1Y4HA 2DJFB 2DC8A 4RNAA 1PPPA 4IP3A 3WXFA 1U9WA 1QOLA 2G7YA 2CIOA 2GHUA 1JQPA 2VHSA 7PCKA 3KWZA 2AVWA 1PIPA 1ZCMA 4YVAA 5CVMA 2BTWA 3U8EA 2FRQA 3N4CA 3MORA 4W5BA 4RF0A 2XU1A 4OELA 4PP2E 1ATKA 3B79A 1NB5A 4BOUA 4YYVA 3OVZA 1ME4A 4MZSA 2R6NA 4FIPA 1CTEA 4AXLA 4MZOA 4YYRA 2OULA 1CS8A 3BY4A 1S4VA 1KHQA 1PPDA 3IMAA 2DCAA 2GFOA 3OQCA 4PP1A 1O0EA 3QSDA 2FT2A 3NHEA 2FRAA 4N8WA 4I07A 4OVZA 3KW9A 4BQVA 1CPJA 1BQIA 2DC9A 2BDLA 3PRPA 4YYQA 1GECE 3O1GA 4YYWA 2UZJA 4N4ZA 1TL9A 2XU4A 8PCHA 3D6SA 5JH3A 2P7UA 2AYNA 3OF9A 4YYUA 3KKUA 2HD5A 1VJVA 4GUAA 2DCDA 2NQDB 3BPFA 2DCCA 1AU2A 3E1ZB 3P5VA 3PNRA 4W4UA 5JZEA 2AS8A 5EF4A 3O0UA 1F2CA 3H7DA 2J7QA 1MDWA 3AI8A 3PRMA 4RF1A 2JTCA 2FTDA 2YJ2A 2ATOA 1DEUA 1F29A 3K8UA 4R3DA 4MI7A 4REZA 3HHAA 4M0WA 1AYUA 2G6DA 2HXZA 4RY2A 4QRVA 4DMYA 2OP3A 4A5UA 3P5WA 2Y6EA 3H8CA 2DC7A 2YJ8A 1U5IA 3HHIA 1QXPA 1CB5A 1PXVA 1AYWA 3W30A 3RVVA 4CDEB 4RKXA 2VHFA 1BGOA 5KO3A 4ZUXU 2IBIA 1AU3A 3CH2X 1ZIVA 2YJBA 3F5VA 2R9OA 4XUIA 2O6XA 1FH0A 5EZSA 1GMYA 1KHPA 1MS6A 4CDFB 4W5CA 1CQDA 2ACTA 1AYVA 1VSNA 4CZWA 3MTVA 2PREA 2B1NA 3OF8A 1SP4B 3S3RA 1AU4A 4G54A 4ZTBA 2Y5BA 1M6DA 1EWOA 4BS5A 1PPNA 3CBKA 4Q8GA 3PDFA 5FPWA 3N3GA 4QH6A 1EF7A 2DZZA 5CVNB 2WBFX 3BPMA 3PHXA 3IEJA 1U9QX 6PADA 4YYSA 2JQFR 1DF0A 3PBHA 3PT2A 1STFE 2E00A 1U9VA 1YZBA 1NB3A 2H7JA 2BTWB 3CBJA 3IOQA 1F2AA 4WA6A 5JA7A 2FO5A 3W31A 3MHSA 1AU0A 2BU3A 3H89A 4P6EA 4PADA 2E02A 4QRXA 2FUDA 4I04A 1QDQA 4QRGA 3KSEA 3C9EA 3PW3A 2Z84A 4K7CA 4BPVA 2AUXA 3CH3X 1EWMA 4OVZB 2JQGR 1PPOA 4I05A 3BOWA 5EZQA 3TRKA 2P0RA 1YK7A 1X9YA 4PI3A 1EWLA 2AU1A 5CHVA 5CVOB 3IV2A 1CSBB 2E01A 3IUTA 1GLOA 1MIRA 4BOQA 2JRIA 2AGAA 1HUCB 4BSQA 1BY8A 1YK8A 2FYEA 3N3KA 3PHWA 2HHNA 3HD3A 2R9NA 5J94A 1ITOA 1QMYA 3BB7A 3BWKA 5A24A 1TU6A 1KXRA 1MHWA 2NQIA 1AIMA 2AIMA 3H6SA 3K9MA 3BBAA 4D8EA 3C0RA 2F7DA 5E6JA 3K24A 1THEA 1IWDA 3H8BA
chains in the Genus database with same CATH topology
1NQCA 3GCBA 1KFXL 1KFUL 3V6CA 2P86A 4B55A 4FJCA 4HWYA 2NQGA 1NLJA 2C0YA 1BP4A 3KX1A 2XU3A 4MSXA 5PADA 4BS6A 4AXMA 3V6EA 3USVA 2NQAA 2DC6A 1Q6KA 2PNSA 3TNXA 3I06A 3ZUAA 1TLOA 1CV8A 4XR7A 2YJCA 1MEMA 4CDDB 3WXGA 3BCNA 3ERVA 4FK5A 2ARYA 3P5XA 3WXEA 1A6RA 2OZ2A 3QT4A 3MTNA 2DJGB 9PAPA 2IPPB 1ICFA 1NPZA 4NV7A 4X6HA 3RVWA 4DMXA 2F1GA 1PBHA 4X6IA 2G8EA 4X6JA 5K16A 1MEGA 4N79A 1AECA 1XKGA 2FQ9A 1ME3A 1W4TA 1CJLA 1E2TA 1YALA 2YJ9A 1PADA 3IHPA 3DF0A 1YT7A 2AYOA 4CDCB 2PBHA 1F2BA 4OEMA 3QJ3A 2G8JA 1NL6A 2R9FA 1EWPA 3S3QA 2PADA 2BDZA 1PE6A 3I3TA 2AUZA 3HWNA 3KFQA 2VFBA 3LXSA 3LFYA 3P5UA 1CVZA 3OISA 1U9XA 2E03A 2R9CA 2BSZA 5EGWA 2XU5A 1YVBA 3KWBX 2DCBA 3F75A 1K3BB 1GCBA 3RVXA 1Y08A 4Q8HA 4QBBA 1PCIA 2B1MA 1POPA 4KLBA 3OVXA 2R9MA 2HH5A 4P6GA 1SNKA 3M99A 2CB5A 3BC3A 3MHHA 5CHTA 5F02A 2DZYA 4YV8A 1Y4HA 2DJFB 2DC8A 1PPPA 3WXFA 1U9WA 1QOLA 2G7YA 2CIOA 2GHUA 1JQPA 2VHSA 7PCKA 3KWZA 2AVWA 1PIPA 1ZCMA 4YVAA 5CVMA 3U8EA 2FRQA 3N4CA 3MORA 4W5BA 2XU1A 4OELA 4PP2E 1ATKA 3B79A 1NB5A 4YYVA 4GUZA 3OVZA 1ME4A 4MZSA 2R6NA 4FIPA 1CTEA 4AXLA 4MZOA 4YYRA 2OULA 1CS8A 1S4VA 1KHQA 1PPDA 3IMAA 2DCAA 2GFOA 4PP1A 1O0EA 3QSDA 2FT2A 3NHEA 2FRAA 4N8WA 4I07A 3KW9A 4BQVA 1CPJA 1BQIA 2DC9A 2BDLA 4YYQA 4YYWA 1GECE 3O1GA 4N4ZA 1TL9A 2XU4A 8PCHA 3D6SA 5JH3A 2P7UA 2AYNA 3OF9A 4YYUA 3KKUA 2HD5A 1VJVA 2DCDA 2NQDB 3BPFA 2DCCA 1AU2A 3E1ZB 3P5VA 3PNRA 4W4UA 2AS8A 1W5RA 5EF4A 3O0UA 1F2CA 3H7DA 1MDWA 3AI8A 2FTDA 2YJ2A 2ATOA 1DEUA 1F29A 3K8UA 3HHAA 1AYUA 2G6DA 2HXZA 4RY2A 4QRVA 4DMYA 2OP3A 3P5WA 2Y6EA 3H8CA 2DC7A 2YJ8A 1U5IA 3HHIA 1QXPA 1CB5A 1PXVA 1AYWA 3RVVA 4CDEB 2VHFA 1BGOA 4ZUXU 2IBIA 1AU3A 3CH2X 1ZIVA 2YJBA 3F5VA 2R9OA 4XUIA 2O6XA 1FH0A 2VFCA 1GMYA 1KHPA 1MS6A 4CDFB 4W5CA 1CQDA 2ACTA 1AYVA 1VSNA 4CZWA 2PREA 2B1NA 3OF8A 1SP4B 3S3RA 1AU4A 4G54A 3LTWA 2Y5BA 1M6DA 1EWOA 4BS5A 1PPNA 3CBKA 4Q8GA 3PDFA 5FPWA 3N3GA 4QH6A 1EF7A 2DZZA 5CVNB 2WBFX 1W6FA 1GX3A 3BPMA 3IEJA 1U9QX 6PADA 4YYSA 2JQFR 1DF0A 3PBHA 1STFE 2E00A 1U9VA 1NB3A 2H7JA 3CBJA 3IOQA 1F2AA 4WA6A 5JA7A 2FO5A 3MHSA 1AU0A 4NV8A 3H89A 4P6EA 4PADA 2E02A 4QRXA 2FUDA 4I04A 1QDQA 4QRGA 3KSEA 3C9EA 3PW3A 4K7CA 4BPVA 2AUXA 3CH3X 1EWMA 2JQGR 1PPOA 4I05A 3BOWA 2P0RA 1YK7A 1X9YA 4PI3A 1EWLA 2AU1A 5CHVA 5CVOB 3IV2A 1CSBB 2E01A 3IUTA 1GLOA 1MIRA 1HUCB 4BSQA 1BY8A 4C5PA 1YK8A 2FYEA 3N3KA 2HHNA 3HD3A 2R9NA 5J94A 1ITOA 1QMYA 3BWKA 3D9WA 5A24A 1TU6A 1KXRA 1MHWA 2NQIA 1AIMA 2AIMA 3H6SA 3K9MA 4BGFA 2F7DA 3K24A 1THEA 1IWDA 3H8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NQC A;  3GCB A;  1KFX L;  1KFU L;  3V6C A;  2P86 A;  4FJC A;  4HWY A;  2NQG A;  1NLJ A;  2C0Y A;  1BP4 A;  3KX1 A;  2XU3 A;  4MSX A;  5PAD A;  4BS6 A;  4AXM A;  3V6E A;  3USV A;  2NQA A;  2DC6 A;  1Q6K A;  2PNS A;  3TNX A;  3I06 A;  3ZUA A;  1TLO A;  1CV8 A;  4XR7 A;  2YJC A;  1MEM A;  4CDD B;  3WXG A;  3BCN A;  3ERV A;  4FK5 A;  2ARY A;  3P5X A;  3WXE A;  1A6R A;  2OZ2 A;  3QT4 A;  3MTN A;  2DJG B;  9PAP A;  2IPP B;  1ICF A;  1NPZ A;  4X6H A;  3RVW A;  4DMX A;  2F1G A;  1PBH A;  4X6I A;  2G8E A;  4X6J A;  5K16 A;  1MEG A;  4N79 A;  1AEC A;  1XKG A;  2FQ9 A;  1ME3 A;  1CJL A;  2YJ9 A;  1YAL A;  1PAD A;  3IHP A;  3DF0 A;  1YT7 A;  2AYO A;  4CDC B;  2PBH A;  1F2B A;  4OEM A;  3QJ3 A;  2G8J A;  1NL6 A;  2R9F A;  1EWP A;  3S3Q A;  2PAD A;  2BDZ A;  1PE6 A;  3I3T A;  2AUZ A;  3HWN A;  3KFQ A;  3LXS A;  3LFY A;  3P5U A;  1CVZ A;  3OIS A;  1U9X A;  2E03 A;  2R9C A;  5EGW A;  2XU5 A;  1YVB A;  3KWB X;  2DCB A;  3F75 A;  1K3B B;  1GCB A;  3RVX A;  1Y08 A;  4Q8H A;  4QBB A;  1PCI A;  2B1M A;  1POP A;  4KLB A;  3OVX A;  2R9M A;  2HH5 A;  4P6G A;  1SNK A;  3M99 A;  2CB5 A;  3BC3 A;  3MHH A;  5CHT A;  5F02 A;  2DZY A;  4YV8 A;  1Y4H A;  2DJF B;  2DC8 A;  1PPP A;  3WXF A;  1U9W A;  1QOL A;  2G7Y A;  2CIO A;  2GHU A;  1JQP A;  2VHS A;  7PCK A;  3KWZ A;  2AVW A;  1PIP A;  1ZCM A;  4YVA A;  5CVM A;  3U8E A;  2FRQ A;  3N4C A;  3MOR A;  4W5B A;  2XU1 A;  4OEL A;  4PP2 E;  1ATK A;  3B79 A;  1NB5 A;  4YYV A;  3OVZ A;  1ME4 A;  4MZS A;  2R6N A;  4FIP A;  1CTE A;  4AXL A;  4MZO A;  4YYR A;  2OUL A;  1CS8 A;  1S4V A;  1KHQ A;  1PPD A;  3IMA A;  2DCA A;  2GFO A;  4PP1 A;  1O0E A;  3QSD A;  2FT2 A;  3NHE A;  2FRA A;  4N8W A;  4I07 A;  3KW9 A;  4BQV A;  1CPJ A;  1BQI A;  2DC9 A;  2BDL A;  4YYQ A;  4YYW A;  1GEC E;  3O1G A;  4N4Z A;  1TL9 A;  2XU4 A;  8PCH A;  3D6S A;  5JH3 A;  2P7U A;  2AYN A;  3OF9 A;  4YYU A;  3KKU A;  2HD5 A;  1VJV A;  2DCD A;  2NQD B;  3BPF A;  2DCC A;  1AU2 A;  3E1Z B;  3P5V A;  3PNR A;  4W4U A;  2AS8 A;  5EF4 A;  3O0U A;  1F2C A;  3H7D A;  1MDW A;  3AI8 A;  2FTD A;  2YJ2 A;  2ATO A;  1DEU A;  1F29 A;  3K8U A;  3HHA A;  1AYU A;  2G6D A;  2HXZ A;  4RY2 A;  4QRV A;  4DMY A;  2OP3 A;  3P5W A;  2Y6E A;  3H8C A;  2DC7 A;  2YJ8 A;  1U5I A;  3HHI A;  1QXP A;  1CB5 A;  1PXV A;  1AYW A;  3RVV A;  4CDE B;  2VHF A;  1BGO A;  4ZUX U;  2IBI A;  1AU3 A;  3CH2 X;  1ZIV A;  2YJB A;  3F5V A;  2R9O A;  4XUI A;  2O6X A;  1FH0 A;  1GMY A;  1KHP A;  1MS6 A;  4CDF B;  4W5C A;  1CQD A;  2ACT A;  1AYV A;  1VSN A;  4CZW A;  2PRE A;  2B1N A;  3OF8 A;  1SP4 B;  3S3R A;  1AU4 A;  4G54 A;  2Y5B A;  1M6D A;  1EWO A;  4BS5 A;  1PPN A;  3CBK A;  4Q8G A;  3PDF A;  5FPW A;  3N3G A;  4QH6 A;  1EF7 A;  2DZZ A;  5CVN B;  2WBF X;  3BPM A;  3IEJ A;  1U9Q X;  6PAD A;  4YYS A;  2JQF R;  1DF0 A;  3PBH A;  1STF E;  2E00 A;  1U9V A;  1NB3 A;  2H7J A;  3CBJ A;  3IOQ A;  1F2A A;  4WA6 A;  5JA7 A;  2FO5 A;  3MHS A;  1AU0 A;  3H89 A;  4P6E A;  4PAD A;  2E02 A;  4QRX A;  2FUD A;  4I04 A;  1QDQ A;  4QRG A;  3KSE A;  3C9E A;  3PW3 A;  4K7C A;  4BPV A;  2AUX A;  3CH3 X;  1EWM A;  2JQG R;  1PPO A;  4I05 A;  3BOW A;  2P0R A;  1YK7 A;  1X9Y A;  4PI3 A;  1EWL A;  2AU1 A;  5CHV A;  5CVO B;  3IV2 A;  1CSB B;  2E01 A;  3IUT A;  1GLO A;  1MIR A;  1HUC B;  4BSQ A;  1BY8 A;  1YK8 A;  2FYE A;  3N3K A;  2HHN A;  3HD3 A;  2R9N A;  5J94 A;  1ITO A;  1QMY A;  3BWK A;  5A24 A;  1TU6 A;  1KXR A;  1MHW A;  2NQI A;  1AIM A;  2AIM A;  3H6S A;  3K9M A;  2F7D A;  3K24 A;  1THE A;  1IWD A;  3H8B A; 
#chains in the Genus database with same CATH topology
 1NQC A;  3GCB A;  1KFX L;  1KFU L;  3MJ5 A;  3V6C A;  2P86 A;  4FJC A;  4HWY A;  2NQG A;  1NLJ A;  3PHU A;  3TMP A;  2C0Y A;  1BP4 A;  3KX1 A;  3IFU A;  2XU3 A;  4MSX A;  5PAD A;  4BS6 A;  4AXM A;  3V6E A;  4XZX A;  3USV A;  2NQA A;  2DC6 A;  1Q6K A;  3ZNH A;  2HWK A;  3PSE A;  2PNS A;  3TNX A;  3I06 A;  3ZUA A;  1TLO A;  1CV8 A;  4HXD B;  4XR7 A;  2YJC A;  1MEM A;  2J7Q C;  3B21 A;  4CDD B;  3WXG A;  3BCN A;  4MM3 B;  3ERV A;  4FK5 A;  2ARY A;  3P5X A;  3WXE A;  1A6R A;  2OZ2 A;  3QT4 A;  3MTN A;  2DJG B;  9PAP A;  2IPP B;  1ICF A;  1NPZ A;  1UKF A;  4X6H A;  3RVW A;  4DMX A;  2F1G A;  1PBH A;  4X6I A;  3E9S A;  2G8E A;  4X6J A;  5K16 A;  4BOP A;  1MEG A;  4N79 A;  1AEC A;  1XKG A;  2FQ9 A;  1ME3 A;  4BOZ A;  1CJL A;  2YJ9 A;  1YAL A;  1PAD A;  3IHP A;  3DF0 A;  1YT7 A;  2AYO A;  4CDC B;  4OW0 A;  2PBH A;  1F2B A;  4OEM A;  3QJ3 A;  2G8J A;  1NL6 A;  2R9F A;  4BOS A;  1EWP A;  3S3Q A;  1PVJ A;  2PAD A;  2BDZ A;  1PE6 A;  3I3T A;  2AUZ A;  3HWN A;  3KFQ A;  4IUM A;  3LXS A;  4D8I A;  3LFY A;  3P5U A;  1DKI A;  1CVZ A;  3OIS A;  4D8B A;  1U9X A;  4WUR A;  3RNV A;  2E03 A;  2R9C A;  5EGW A;  2DOS A;  2XU5 A;  1YVB A;  3KWB X;  2DCB A;  3F75 A;  1K3B B;  1GCB A;  3RVX A;  1Y08 A;  4Q8H A;  4QBB A;  1PCI A;  2B1M A;  1POP A;  4KLB A;  4P16 A;  4PT5 A;  2FE8 A;  3MP2 A;  3OVX A;  2R9M A;  2HH5 A;  4P6G A;  1SNK A;  3M99 A;  2CB5 A;  3BC3 A;  3MHH A;  5CHT A;  5F02 A;  2DZY A;  4YV8 A;  3O65 A;  1Y4H A;  2DJF B;  2DC8 A;  4RNA A;  1PPP A;  4IP3 A;  3WXF A;  1U9W A;  1QOL A;  2G7Y A;  2CIO A;  2GHU A;  1JQP A;  2VHS A;  7PCK A;  3KWZ A;  2AVW A;  1PIP A;  1ZCM A;  4YVA A;  5CVM A;  2BTW A;  3U8E A;  2FRQ A;  3N4C A;  3MOR A;  4W5B A;  4RF0 A;  2XU1 A;  4OEL A;  4PP2 E;  1ATK A;  3B79 A;  1NB5 A;  4BOU A;  4YYV A;  3OVZ A;  1ME4 A;  4MZS A;  2R6N A;  4FIP A;  1CTE A;  4AXL A;  4MZO A;  4YYR A;  2OUL A;  1CS8 A;  3BY4 A;  1S4V A;  1KHQ A;  1PPD A;  3IMA A;  2DCA A;  2GFO A;  3OQC A;  4PP1 A;  1O0E A;  3QSD A;  2FT2 A;  3NHE A;  2FRA A;  4N8W A;  4I07 A;  4OVZ A;  3KW9 A;  4BQV A;  1CPJ A;  1BQI A;  2DC9 A;  2BDL A;  3PRP A;  4YYQ A;  1GEC E;  3O1G A;  4YYW A;  2UZJ A;  4N4Z A;  1TL9 A;  2XU4 A;  8PCH A;  3D6S A;  5JH3 A;  2P7U A;  2AYN A;  3OF9 A;  4YYU A;  3KKU A;  2HD5 A;  1VJV A;  4GUA A;  2DCD A;  2NQD B;  3BPF A;  2DCC A;  1AU2 A;  3E1Z B;  3P5V A;  3PNR A;  4W4U A;  5JZE A;  2AS8 A;  5EF4 A;  3O0U A;  1F2C A;  3H7D A;  2J7Q A;  1MDW A;  3AI8 A;  3PRM A;  4RF1 A;  2JTC A;  2FTD A;  2YJ2 A;  2ATO A;  1DEU A;  1F29 A;  3K8U A;  4R3D A;  4MI7 A;  4REZ A;  3HHA A;  4M0W A;  1AYU A;  2G6D A;  2HXZ A;  4RY2 A;  4QRV A;  4DMY A;  2OP3 A;  4A5U A;  3P5W A;  2Y6E A;  3H8C A;  2DC7 A;  2YJ8 A;  1U5I A;  3HHI A;  1QXP A;  1CB5 A;  1PXV A;  1AYW A;  3W30 A;  3RVV A;  4CDE B;  4RKX A;  2VHF A;  1BGO A;  5KO3 A;  4ZUX U;  2IBI A;  1AU3 A;  3CH2 X;  1ZIV A;  2YJB A;  3F5V A;  2R9O A;  4XUI A;  2O6X A;  1FH0 A;  5EZS A;  1GMY A;  1KHP A;  1MS6 A;  4CDF B;  4W5C A;  1CQD A;  2ACT A;  1AYV A;  1VSN A;  4CZW A;  3MTV A;  2PRE A;  2B1N A;  3OF8 A;  1SP4 B;  3S3R A;  1AU4 A;  4G54 A;  4ZTB A;  2Y5B A;  1M6D A;  1EWO A;  4BS5 A;  1PPN A;  3CBK A;  4Q8G A;  3PDF A;  5FPW A;  3N3G A;  4QH6 A;  1EF7 A;  2DZZ A;  5CVN B;  2WBF X;  3BPM A;  3PHX A;  3IEJ A;  1U9Q X;  6PAD A;  4YYS A;  2JQF R;  1DF0 A;  3PBH A;  3PT2 A;  1STF E;  2E00 A;  1U9V A;  1YZB A;  1NB3 A;  2H7J A;  2BTW B;  3CBJ A;  3IOQ A;  1F2A A;  4WA6 A;  5JA7 A;  2FO5 A;  3W31 A;  3MHS A;  1AU0 A;  2BU3 A;  3H89 A;  4P6E A;  4PAD A;  2E02 A;  4QRX A;  2FUD A;  4I04 A;  1QDQ A;  4QRG A;  3KSE A;  3C9E A;  3PW3 A;  2Z84 A;  4K7C A;  4BPV A;  2AUX A;  3CH3 X;  1EWM A;  4OVZ B;  2JQG R;  1PPO A;  4I05 A;  3BOW A;  5EZQ A;  3TRK A;  2P0R A;  1YK7 A;  1X9Y A;  4PI3 A;  1EWL A;  2AU1 A;  5CHV A;  5CVO B;  3IV2 A;  1CSB B;  2E01 A;  3IUT A;  1GLO A;  1MIR A;  4BOQ A;  2JRI A;  2AGA A;  1HUC B;  4BSQ A;  1BY8 A;  1YK8 A;  2FYE A;  3N3K A;  3PHW A;  2HHN A;  3HD3 A;  2R9N A;  5J94 A;  1ITO A;  1QMY A;  3BB7 A;  3BWK A;  5A24 A;  1TU6 A;  1KXR A;  1MHW A;  2NQI A;  1AIM A;  2AIM A;  3H6S A;  3K9M A;  3BBA A;  4D8E A;  3C0R A;  2F7D A;  5E6J A;  3K24 A;  1THE A;  1IWD A;  3H8B A; 
#chains in the Genus database with same CATH homology
 1NQC A;  3GCB A;  1KFX L;  1KFU L;  3V6C A;  2P86 A;  4B55 A;  4FJC A;  4HWY A;  2NQG A;  1NLJ A;  2C0Y A;  1BP4 A;  3KX1 A;  2XU3 A;  4MSX A;  5PAD A;  4BS6 A;  4AXM A;  3V6E A;  3USV A;  2NQA A;  2DC6 A;  1Q6K A;  2PNS A;  3TNX A;  3I06 A;  3ZUA A;  1TLO A;  1CV8 A;  4XR7 A;  2YJC A;  1MEM A;  4CDD B;  3WXG A;  3BCN A;  3ERV A;  4FK5 A;  2ARY A;  3P5X A;  3WXE A;  1A6R A;  2OZ2 A;  3QT4 A;  3MTN A;  2DJG B;  9PAP A;  2IPP B;  1ICF A;  1NPZ A;  4NV7 A;  4X6H A;  3RVW A;  4DMX A;  2F1G A;  1PBH A;  4X6I A;  2G8E A;  4X6J A;  5K16 A;  1MEG A;  4N79 A;  1AEC A;  1XKG A;  2FQ9 A;  1ME3 A;  1W4T A;  1CJL A;  1E2T A;  1YAL A;  2YJ9 A;  1PAD A;  3IHP A;  3DF0 A;  1YT7 A;  2AYO A;  4CDC B;  2PBH A;  1F2B A;  4OEM A;  3QJ3 A;  2G8J A;  1NL6 A;  2R9F A;  1EWP A;  3S3Q A;  2PAD A;  2BDZ A;  1PE6 A;  3I3T A;  2AUZ A;  3HWN A;  3KFQ A;  2VFB A;  3LXS A;  3LFY A;  3P5U A;  1CVZ A;  3OIS A;  1U9X A;  2E03 A;  2R9C A;  2BSZ A;  5EGW A;  2XU5 A;  1YVB A;  3KWB X;  2DCB A;  3F75 A;  1K3B B;  1GCB A;  3RVX A;  1Y08 A;  4Q8H A;  4QBB A;  1PCI A;  2B1M A;  1POP A;  4KLB A;  3OVX A;  2R9M A;  2HH5 A;  4P6G A;  1SNK A;  3M99 A;  2CB5 A;  3BC3 A;  3MHH A;  5CHT A;  5F02 A;  2DZY A;  4YV8 A;  1Y4H A;  2DJF B;  2DC8 A;  1PPP A;  3WXF A;  1U9W A;  1QOL A;  2G7Y A;  2CIO A;  2GHU A;  1JQP A;  2VHS A;  7PCK A;  3KWZ A;  2AVW A;  1PIP A;  1ZCM A;  4YVA A;  5CVM A;  3U8E A;  2FRQ A;  3N4C A;  3MOR A;  4W5B A;  2XU1 A;  4OEL A;  4PP2 E;  1ATK A;  3B79 A;  1NB5 A;  4YYV A;  4GUZ A;  3OVZ A;  1ME4 A;  4MZS A;  2R6N A;  4FIP A;  1CTE A;  4AXL A;  4MZO A;  4YYR A;  2OUL A;  1CS8 A;  1S4V A;  1KHQ A;  1PPD A;  3IMA A;  2DCA A;  2GFO A;  4PP1 A;  1O0E A;  3QSD A;  2FT2 A;  3NHE A;  2FRA A;  4N8W A;  4I07 A;  3KW9 A;  4BQV A;  1CPJ A;  1BQI A;  2DC9 A;  2BDL A;  4YYQ A;  4YYW A;  1GEC E;  3O1G A;  4N4Z A;  1TL9 A;  2XU4 A;  8PCH A;  3D6S A;  5JH3 A;  2P7U A;  2AYN A;  3OF9 A;  4YYU A;  3KKU A;  2HD5 A;  1VJV A;  2DCD A;  2NQD B;  3BPF A;  2DCC A;  1AU2 A;  3E1Z B;  3P5V A;  3PNR A;  4W4U A;  2AS8 A;  1W5R A;  5EF4 A;  3O0U A;  1F2C A;  3H7D A;  1MDW A;  3AI8 A;  2FTD A;  2YJ2 A;  2ATO A;  1DEU A;  1F29 A;  3K8U A;  3HHA A;  1AYU A;  2G6D A;  2HXZ A;  4RY2 A;  4QRV A;  4DMY A;  2OP3 A;  3P5W A;  2Y6E A;  3H8C A;  2DC7 A;  2YJ8 A;  1U5I A;  3HHI A;  1QXP A;  1CB5 A;  1PXV A;  1AYW A;  3RVV A;  4CDE B;  2VHF A;  1BGO A;  4ZUX U;  2IBI A;  1AU3 A;  3CH2 X;  1ZIV A;  2YJB A;  3F5V A;  2R9O A;  4XUI A;  2O6X A;  1FH0 A;  2VFC A;  1GMY A;  1KHP A;  1MS6 A;  4CDF B;  4W5C A;  1CQD A;  2ACT A;  1AYV A;  1VSN A;  4CZW A;  2PRE A;  2B1N A;  3OF8 A;  1SP4 B;  3S3R A;  1AU4 A;  4G54 A;  3LTW A;  2Y5B A;  1M6D A;  1EWO A;  4BS5 A;  1PPN A;  3CBK A;  4Q8G A;  3PDF A;  5FPW A;  3N3G A;  4QH6 A;  1EF7 A;  2DZZ A;  5CVN B;  2WBF X;  1W6F A;  1GX3 A;  3BPM A;  3IEJ A;  1U9Q X;  6PAD A;  4YYS A;  2JQF R;  1DF0 A;  3PBH A;  1STF E;  2E00 A;  1U9V A;  1NB3 A;  2H7J A;  3CBJ A;  3IOQ A;  1F2A A;  4WA6 A;  5JA7 A;  2FO5 A;  3MHS A;  1AU0 A;  4NV8 A;  3H89 A;  4P6E A;  4PAD A;  2E02 A;  4QRX A;  2FUD A;  4I04 A;  1QDQ A;  4QRG A;  3KSE A;  3C9E A;  3PW3 A;  4K7C A;  4BPV A;  2AUX A;  3CH3 X;  1EWM A;  2JQG R;  1PPO A;  4I05 A;  3BOW A;  2P0R A;  1YK7 A;  1X9Y A;  4PI3 A;  1EWL A;  2AU1 A;  5CHV A;  5CVO B;  3IV2 A;  1CSB B;  2E01 A;  3IUT A;  1GLO A;  1MIR A;  1HUC B;  4BSQ A;  1BY8 A;  4C5P A;  1YK8 A;  2FYE A;  3N3K A;  2HHN A;  3HD3 A;  2R9N A;  5J94 A;  1ITO A;  1QMY A;  3BWK A;  3D9W A;  5A24 A;  1TU6 A;  1KXR A;  1MHW A;  2NQI A;  1AIM A;  2AIM A;  3H6S A;  3K9M A;  4BGF A;  2F7D A;  3K24 A;  1THE A;  1IWD A;  3H8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...