3W31A

Structual basis for the recognition of ubc13 by the shigella flexneri effector ospi
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
192
structure length
192
Chain Sequence
b'NVNVKKLLESLNSKSLGDMDKDSELAATLQKMINPSGGDGNASGCALHACMAMLGYGVREAPVPNEISEYMTGFFHRHLEQIDSEGIVSHPNETYSKFRERIAENILQNTSKGSVVMISIEQATHWIAGFNDGEKIMFLDVQTGKGFNLYDPVEKSPDAFVDENSSVQVIHVSDQEFDHYANSSSWKSKRLC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF169b
publication title Structural Basis for the Recognition of Ubc13 by the Shigella flexneri Effector OspI.
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Immune system
total genus 46
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2012-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.140 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3w31A00
3W31A 4IP3A 3B21A 3W30A 4XZXA
chains in the Genus database with same CATH superfamily
3BWKA 5JA7A 2J7QA 3V6CA 4CDEB 4N4ZA 4PP1A 4MM3B 2DCAA 5EZQA 4PP2E 1KXRA 1QOLA 4AXLA 1MIRA 2WBFX 1F29A 2E03A 3P5VA 4W5BA 4XUIA 3F5VA 5CVNB 3KFQA 2PBHA 4BOZA 4BS6A 3MHSA 3E9SA 1EWPA 4RF1A 2DJGB 4A5UA 2R6NA 3I06A 3PNRA 1KHQA 2YJCA 3HD3A 4KLBA 2E01A 3N3GA 4WA6A 1PPPA 2JRIA 3GCBA 2DJFB 2DOSA 1Y4HA 4RY2A 2Y6EA 3RVXA 1YK8A 2XU3A 8PCHA 1GECE 2NQIA 5CHVA 3IHPA 3PDFA 3BB7A 4QRGA 1PPOA 1F2AA 2XU4A 1TU6A 1NQCA 1KFXL 3OF9A 3AI8A 3E1ZB 4N79A 1MHWA 2UZJA 2HXZA 2JTCA 1EWMA 1YT7A 1F2CA 3NHEA 1CB5A 1CPJA 3KW9A 3MORA 2BDZA 1AU4A 3K24A 5PADA 3MP2A 2BTWA 4HXDB 3F75A 4OVZB 2GHUA 3RNVA 4PI3A 3CH3X 3H6SA 2FRAA 3H89A 3WXEA 4OEMA 2BTWB 4CDCB 3TRKA 1YALA 1VSNA 3BPMA 1O0EA 4DMXA 3RVVA 1YK7A 4XR7A 2DC6A 1PCIA 4K7CA 3IFUA 1PVJA 1AIMA 2FE8A 2FRQA 3KX1A 1AU3A 2DC8A 3KWZA 1AU0A 1Q6KA 3OVZA 1U9WA 4QRXA 1MDWA 2YJ8A 1PXVA 3WXFA 3C9EA 3HHAA 2OULA 4X6JA 4BQVA 1BQIA 1K3BB 1CSBB 1AU2A 2JQGR 3K9MA 1VJVA 2DC9A 3PRPA 1A6RA 4Q8GA 3N4CA 2OZ2A 1AYWA 2FTDA 1FH0A 4QBBA 3I3TA 4YYVA 3CH2X 3CBKA 2G8JA 5J94A 2FQ9A 3H8BA 2HD5A 4BOUA 4D8BA 1QMYA 2ARYA 2YJ9A 3PW3A 2YJBA 1JQPA 4OELA 3PHUA 2XU5A 3C0RA 1DKIA 2NQGA 4I05A 1YVBA 1ITOA 3LFYA 1NL6A 5CVMA 3PHXA 1NPZA 3O0UA 3MTVA 1STFE 4IP3A 3U8EA 4YYQA 1DEUA 4FIPA 3USVA 4M0WA 2F7DA 2DCDA 4I04A 4PADA 4D8IA 4YV8A 5EGWA 1NLJA 2E00A 3ERVA 3BOWA 3PSEA 1ME3A 2P86A 1CTEA 1F2BA 3CBJA 3P5UA 2F1GA 5F02A 2GFOA 1M6DA 3PRMA 4Q8HA 3KSEA 1ICFA 2DZZA 2FT2A 3D6SA 2DCCA 3BPFA 4GUAA 2DCBA 2FO5A 3O1GA 2JQFR 1ZCMA 2E02A 2YJ2A 4BPVA 1PBHA 4OW0A 3HHIA 4IUMA 2AS8A 1BGOA 2IPPB 2PNSA 4XZXA 1UKFA 1GLOA 4YYSA 1XKGA 2CIOA 1EWLA 3OISA 3IEJA 2P7UA 4REZA 1AYVA 2HH5A 4YYWA 3MJ5A 1NB5A 1KFUL 1TL9A 3PHWA 3IMAA 5CVOB 2AYNA 1TLOA 2IBIA 4WURA 4P6EA 1U5IA 1CQDA 2R9MA 3ZNHA 4QRVA 5CHTA 3QSDA 1CVZA 1QDQA 1PPNA 4R3DA 7PCKA 3MTNA 2CB5A 3OF8A 1SP4B 2O6XA 3QT4A 4CDFB 3P5WA 1YZBA 3BC3A 1X9YA 1GMYA 3H7DA 3TMPA 9PAPA 3OQCA 2FYEA 2H7JA 2R9CA 2OP3A 5KO3A 5EF4A 1PIPA 4PT5A 1GCBA 3HWNA 1MEGA 2C0YA 2HWKA 2J7QC 1BP4A 2Z84A 3B79A 4QH6A 3OVXA 1ME4A 2HHNA 4W5CA 3V6EA 4P6GA 3TNXA 4D8EA 3ZUAA 3RVWA 4FJCA 4G54A 2Y5BA 2ACTA 4HWYA 1Y08A 4YVAA 2AGAA 2AIMA 3W30A 4ZUXU 2BU3A 4MZOA 3KKUA 3QJ3A 1HUCB 4BOPA 4ZTBA 2B1MA 6PADA 1QXPA 2AVWA 2R9NA 1AYUA 4N8WA 4X6HA 4BS5A 2PREA 2NQDB 2NQAA 3K8UA 3S3RA 2AUXA 1S4VA 2VHSA 1POPA 4CDDB 4CZWA 4YYRA 4I07A 2AUZA 3IUTA 1SNKA 4MSXA 4X6IA 1THEA 1CV8A 5JZEA 1MS6A 3S3QA 2PADA 4P16A 3M99A 3IOQA 5EZSA 2AYOA 1U9QX 2ATOA 4RF0A 3P5XA 3H8CA 3PT2A 3N3KA 4FK5A 4MZSA 3LXSA 4BOQA 3B21A 3WXGA 1DF0A 2G6DA 2R9OA 3DF0A 4W4UA 4OVZA 1PE6A 2XU1A 3IV2A 4DMYA 5K16A 4RNAA 1U9VA 1ATKA 4BSQA 2G8EA 2R9FA 1MEMA 4AXMA 1CS8A 3KWBX 1KHPA 1BY8A 4RKXA 3BCNA 3PBHA 2VHFA 1NB3A 1IWDA 4MI7A 5A24A 1PADA 5JH3A 1EF7A 3O65A 2G7YA 2B1NA 5E6JA 3W31A 2FUDA 4BOSA 2AU1A 3BBAA 5FPWA 1EWOA 2DZYA 1CJLA 2P0RA 3MHHA 1PPDA 2DC7A 3BY4A 4YYUA 2BDLA 1AECA 1ZIVA 1U9XA
chains in the Genus database with same CATH topology
4BOPA 4ZTBA 2J7QA 3IFUA 4OW0A 4IUMA 1PVJA 4MM3B 2FE8A 5EZQA 4XZXA 1UKFA 5JZEA 4P16A 5EZSA 4REZA 4BOZA 3E9SA 3PRPA 3MJ5A 4RF0A 4RF1A 3PHWA 3PT2A 4A5UA 4BOQA 4WURA 3B21A 3ZNHA 2JRIA 4BOUA 4R3DA 2DOSA 4D8BA 4OVZA 3PHUA 4RNAA 3C0RA 1YZBA 1DKIA 3BB7A 3TMPA 4RKXA 3OQCA 3PHXA 3MTVA 5KO3A 4IP3A 4PT5A 4MI7A 2UZJA 2JTCA 4M0WA 2HWKA 3O65A 2J7QC 2Z84A 4D8IA 5E6JA 3W31A 3MP2A 2BTWA 3PSEA 4BOSA 4D8EA 4HXDB 4OVZB 3RNVA 3BBAA 3PRMA 3BY4A 2BTWB 3TRKA 2AGAA 3W30A 4GUAA 2BU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W31 A;  4IP3 A;  3B21 A;  3W30 A;  4XZX A; 
#chains in the Genus database with same CATH topology
 3BWK A;  5JA7 A;  2J7Q A;  3V6C A;  4CDE B;  4N4Z A;  4PP1 A;  4MM3 B;  2DCA A;  5EZQ A;  4PP2 E;  1KXR A;  1QOL A;  4AXL A;  1MIR A;  2WBF X;  1F29 A;  2E03 A;  3P5V A;  4W5B A;  4XUI A;  3F5V A;  5CVN B;  3KFQ A;  2PBH A;  4BOZ A;  4BS6 A;  3MHS A;  3E9S A;  1EWP A;  4RF1 A;  2DJG B;  4A5U A;  2R6N A;  3I06 A;  3PNR A;  1KHQ A;  2YJC A;  3HD3 A;  4KLB A;  2E01 A;  3N3G A;  4WA6 A;  1PPP A;  2JRI A;  3GCB A;  2DJF B;  2DOS A;  1Y4H A;  4RY2 A;  2Y6E A;  3RVX A;  1YK8 A;  2XU3 A;  8PCH A;  1GEC E;  2NQI A;  5CHV A;  3IHP A;  3PDF A;  3BB7 A;  4QRG A;  1PPO A;  1F2A A;  2XU4 A;  1TU6 A;  1NQC A;  1KFX L;  3OF9 A;  3AI8 A;  3E1Z B;  4N79 A;  1MHW A;  2UZJ A;  2HXZ A;  2JTC A;  1EWM A;  1YT7 A;  1F2C A;  3NHE A;  1CB5 A;  1CPJ A;  3KW9 A;  3MOR A;  2BDZ A;  1AU4 A;  3K24 A;  5PAD A;  3MP2 A;  2BTW A;  4HXD B;  3F75 A;  4OVZ B;  2GHU A;  3RNV A;  4PI3 A;  3CH3 X;  3H6S A;  2FRA A;  3H89 A;  3WXE A;  4OEM A;  2BTW B;  4CDC B;  3TRK A;  1YAL A;  1VSN A;  3BPM A;  1O0E A;  4DMX A;  3RVV A;  1YK7 A;  4XR7 A;  2DC6 A;  1PCI A;  4K7C A;  3IFU A;  1PVJ A;  1AIM A;  2FE8 A;  2FRQ A;  3KX1 A;  1AU3 A;  2DC8 A;  3KWZ A;  1AU0 A;  1Q6K A;  3OVZ A;  1U9W A;  4QRX A;  1MDW A;  2YJ8 A;  1PXV A;  3WXF A;  3C9E A;  3HHA A;  2OUL A;  4X6J A;  4BQV A;  1BQI A;  1K3B B;  1CSB B;  1AU2 A;  2JQG R;  3K9M A;  1VJV A;  2DC9 A;  3PRP A;  1A6R A;  4Q8G A;  3N4C A;  2OZ2 A;  1AYW A;  2FTD A;  1FH0 A;  4QBB A;  3I3T A;  4YYV A;  3CH2 X;  3CBK A;  2G8J A;  5J94 A;  2FQ9 A;  3H8B A;  2HD5 A;  4BOU A;  4D8B A;  1QMY A;  2ARY A;  2YJ9 A;  3PW3 A;  2YJB A;  1JQP A;  4OEL A;  3PHU A;  2XU5 A;  3C0R A;  1DKI A;  2NQG A;  4I05 A;  1YVB A;  1ITO A;  3LFY A;  1NL6 A;  5CVM A;  3PHX A;  1NPZ A;  3O0U A;  3MTV A;  1STF E;  4IP3 A;  3U8E A;  4YYQ A;  1DEU A;  4FIP A;  3USV A;  4M0W A;  2F7D A;  2DCD A;  4I04 A;  4PAD A;  4D8I A;  4YV8 A;  5EGW A;  1NLJ A;  2E00 A;  3ERV A;  3BOW A;  3PSE A;  1ME3 A;  2P86 A;  1CTE A;  1F2B A;  3CBJ A;  3P5U A;  2F1G A;  5F02 A;  2GFO A;  1M6D A;  3PRM A;  4Q8H A;  3KSE A;  1ICF A;  2DZZ A;  2FT2 A;  3D6S A;  2DCC A;  3BPF A;  4GUA A;  2DCB A;  2FO5 A;  3O1G A;  2JQF R;  1ZCM A;  2E02 A;  2YJ2 A;  4BPV A;  1PBH A;  4OW0 A;  3HHI A;  4IUM A;  2AS8 A;  1BGO A;  2IPP B;  2PNS A;  4XZX A;  1UKF A;  1GLO A;  4YYS A;  1XKG A;  2CIO A;  1EWL A;  3OIS A;  3IEJ A;  2P7U A;  4REZ A;  1AYV A;  2HH5 A;  4YYW A;  3MJ5 A;  1NB5 A;  1KFU L;  1TL9 A;  3PHW A;  3IMA A;  5CVO B;  2AYN A;  1TLO A;  2IBI A;  4WUR A;  4P6E A;  1U5I A;  1CQD A;  2R9M A;  3ZNH A;  4QRV A;  5CHT A;  3QSD A;  1CVZ A;  1QDQ A;  1PPN A;  4R3D A;  7PCK A;  3MTN A;  2CB5 A;  3OF8 A;  1SP4 B;  2O6X A;  3QT4 A;  4CDF B;  3P5W A;  1YZB A;  3BC3 A;  1X9Y A;  1GMY A;  3H7D A;  3TMP A;  9PAP A;  3OQC A;  2FYE A;  2H7J A;  2R9C A;  2OP3 A;  5KO3 A;  5EF4 A;  1PIP A;  4PT5 A;  1GCB A;  3HWN A;  1MEG A;  2C0Y A;  2HWK A;  2J7Q C;  1BP4 A;  2Z84 A;  3B79 A;  4QH6 A;  3OVX A;  1ME4 A;  2HHN A;  4W5C A;  3V6E A;  4P6G A;  3TNX A;  4D8E A;  3ZUA A;  3RVW A;  4FJC A;  4G54 A;  2Y5B A;  2ACT A;  4HWY A;  1Y08 A;  4YVA A;  2AGA A;  2AIM A;  3W30 A;  4ZUX U;  2BU3 A;  4MZO A;  3KKU A;  3QJ3 A;  1HUC B;  4BOP A;  4ZTB A;  2B1M A;  6PAD A;  1QXP A;  2AVW A;  2R9N A;  1AYU A;  4N8W A;  4X6H A;  4BS5 A;  2PRE A;  2NQD B;  2NQA A;  3K8U A;  3S3R A;  2AUX A;  1S4V A;  2VHS A;  1POP A;  4CDD B;  4CZW A;  4YYR A;  4I07 A;  2AUZ A;  3IUT A;  1SNK A;  4MSX A;  4X6I A;  1THE A;  1CV8 A;  5JZE A;  1MS6 A;  3S3Q A;  2PAD A;  4P16 A;  3M99 A;  3IOQ A;  5EZS A;  2AYO A;  1U9Q X;  2ATO A;  4RF0 A;  3P5X A;  3H8C A;  3PT2 A;  3N3K A;  4FK5 A;  4MZS A;  3LXS A;  4BOQ A;  3B21 A;  3WXG A;  1DF0 A;  2G6D A;  2R9O A;  3DF0 A;  4W4U A;  4OVZ A;  1PE6 A;  2XU1 A;  3IV2 A;  4DMY A;  5K16 A;  4RNA A;  1U9V A;  1ATK A;  4BSQ A;  2G8E A;  2R9F A;  1MEM A;  4AXM A;  1CS8 A;  3KWB X;  1KHP A;  1BY8 A;  4RKX A;  3BCN A;  3PBH A;  2VHF A;  1NB3 A;  1IWD A;  4MI7 A;  5A24 A;  1PAD A;  5JH3 A;  1EF7 A;  3O65 A;  2G7Y A;  2B1N A;  5E6J A;  3W31 A;  2FUD A;  4BOS A;  2AU1 A;  3BBA A;  5FPW A;  1EWO A;  2DZY A;  1CJL A;  2P0R A;  3MHH A;  1PPD A;  2DC7 A;  3BY4 A;  4YYU A;  2BDL A;  1AEC A;  1ZIV A;  1U9X A; 
#chains in the Genus database with same CATH homology
 4BOP A;  4ZTB A;  2J7Q A;  3IFU A;  4OW0 A;  4IUM A;  1PVJ A;  4MM3 B;  2FE8 A;  5EZQ A;  4XZX A;  1UKF A;  5JZE A;  4P16 A;  5EZS A;  4REZ A;  4BOZ A;  3E9S A;  3PRP A;  3MJ5 A;  4RF0 A;  4RF1 A;  3PHW A;  3PT2 A;  4A5U A;  4BOQ A;  4WUR A;  3B21 A;  3ZNH A;  2JRI A;  4BOU A;  4R3D A;  2DOS A;  4D8B A;  4OVZ A;  3PHU A;  4RNA A;  3C0R A;  1YZB A;  1DKI A;  3BB7 A;  3TMP A;  4RKX A;  3OQC A;  3PHX A;  3MTV A;  5KO3 A;  4IP3 A;  4PT5 A;  4MI7 A;  2UZJ A;  2JTC A;  4M0W A;  2HWK A;  3O65 A;  2J7Q C;  2Z84 A;  4D8I A;  5E6J A;  3W31 A;  3MP2 A;  2BTW A;  3PSE A;  4BOS A;  4D8E A;  4HXD B;  4OVZ B;  3RNV A;  3BBA A;  3PRM A;  3BY4 A;  2BTW B;  3TRK A;  2AGA A;  3W30 A;  4GUA A;  2BU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...