3W31A

Structual basis for the recognition of ubc13 by the shigella flexneri effector ospi
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
192
structure length
192
Chain Sequence
NVNVKKLLESLNSKSLGDMDKDSELAATLQKMINPSGGDGNASGCALHACMAMLGYGVREAPVPNEISEYMTGFFHRHLEQIDSEGIVSHPNETYSKFRERIAENILQNTSKGSVVMISIEQATHWIAGFNDGEKIMFLDVQTGKGFNLYDPVEKSPDAFVDENSSVQVIHVSDQEFDHYANSSSWKSKRLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF169b
publication title Structural Basis for the Recognition of Ubc13 by the Shigella flexneri Effector OspI.
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Immune system
total genus 46
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2012-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.140 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3w31A00
3B21A 3W31A 4XZXA 4IP3A 3W30A
chains in the Genus database with same CATH superfamily
3IMAA 1X9YA 4W5CA 2JQGR 2F7DA 3PNRA 4BOZA 1DEUA 4YYUA 5EGWA 7PCKA 2Y6EA 3B21A 2JTCA 1SNKA 3W31A 3ERVA 3MTVA 4I07A 4RNAA 1BY8A 3N3KA 1CSBB 4DMYA 4OVZB 1U9XA 2AIMA 3K9MA 1S4VA 1K3BB 1QXPA 1ME3A 4W4UA 1PVJA 4BS5A 1EF7A 3KW9A 1UKFA 2C0YA 3C0RA 1EWOA 1AECA 4IUMA 1GCBA 4D8IA 2DJGB 2CIOA 4YVAA 5KO3A 5FPWA 3P5WA 4XUIA 1ZIVA 4IP3A 1EWPA 2AU1A 1XKGA 1YALA 2BTWB 4MI7A 1BGOA 1GMYA 3BOWA 4PADA 3OQCA 1MDWA 2B1NA 5A24A 1CS8A 2PNSA 4N79A 1F2BA 4REZA 2VHFA 3PHUA 3WXFA 1TL9A 1YK7A 3KFQA 1ICFA 2DZZA 4QRVA 2DC7A 2UZJA 2DCCA 3PRMA 3MJ5A 2O6XA 3PT2A 2DC8A 3H7DA 2NQGA 3OVXA 1CJLA 1NB3A 1PPDA 2J7QA 2FQ9A 3P5VA 1A6RA 4I04A 2ACTA 4PT5A 1AYVA 2PADA 4ZTBA 3IOQA 3H8BA 3PHWA 3BPFA 4W5BA 3KWBX 2E00A 4A5UA 4QH6A 3O65A 1DKIA 3LFYA 3S3QA 1CQDA 4G54A 5CVMA 3E9SA 2HWKA 1QMYA 3P5UA 4BPVA 3D6SA 2HD5A 2AUZA 5E6JA 4YYWA 1JQPA 3RVWA 2R9CA 3BPMA 3IEJA 4P16A 1Q6KA 3OVZA 4BOSA 3IUTA 4PI3A 1PBHA 4DMXA 1EWMA 3HWNA 3KKUA 5CHVA 5JH3A 3BB7A 1AYWA 1NPZA 3CBJA 1O0EA 4WURA 3P5XA 3ZUAA 4CDFB 3CBKA 1AYUA 4QRGA 1YK8A 3H6SA 1AU4A 6PADA 4X6IA 1F2CA 5CVNB 5EF4A 1Y4HA 1Y08A 3PSEA 3HHAA 2OZ2A 4RF1A 2BDZA 3USVA 1KHQA 4BOQA 2R9MA 1GECE 1POPA 3PBHA 4YYRA 1KHPA 1MHWA 2G8JA 3IV2A 1AU2A 4XR7A 2DJFB 1U5IA 3O1GA 4BSQA 3IHPA 4CDDB 1SP4B 3PDFA 4X6JA 3ZNHA 3PHXA 3N3GA 1U9VA 3MHHA 3V6CA 3MP2A 2G8EA 2AGAA 3OF9A 3WXGA 3BCNA 4QBBA 4XZXA 1PPPA 1CTEA 3O0UA 2G6DA 3KSEA 2DC9A 3K24A 3V6EA 8PCHA 3DF0A 3RVXA 2P0RA 1CB5A 1QOLA 2DCDA 1NLJA 4RKXA 3CH3X 1BQIA 1AU0A 3OF8A 4GUAA 3BWKA 5J94A 2FE8A 1KXRA 4RY2A 4BS6A 2GFOA 2CB5A 2YJ2A 4K7CA 1PCIA 2E01A 4OEMA 1QDQA 2R9FA 4P6GA 1PPNA 5JA7A 2H7JA 3TRKA 2R9OA 2F1GA 2HH5A 3KX1A 1IWDA 1YVBA 2VHSA 2XU1A 4CDEB 1DF0A 3IFUA 1KFXL 2DCAA 2B1MA 3PRPA 1U9WA 2R9NA 4CZWA 3BC3A 2DZYA 1STFE 2FTDA 2HHNA 2GHUA 3HD3A 2Z84A 4I05A 1CVZA 1NB5A 1YZBA 3F5VA 2P7UA 4YYQA 4QRXA 2NQDB 1AU3A 1MIRA 2FRAA 2HXZA 2PREA 2AYOA 3NHEA 1HUCB 4OVZA 1TLOA 1F29A 4HWYA 2PBHA 3CH2X 5K16A 4ZUXU 4D8BA 3N4CA 4CDCB 9PAPA 2IBIA 1PPOA 3WXEA 3QSDA 2Y5BA 3M99A 3H89A 1BP4A 2BU3A 3MTNA 3KWZA 1GLOA 1AIMA 1KFUL 2AYNA 2G7YA 2OULA 4OW0A 4YYVA 3B79A 1F2AA 4OELA 1PE6A 1ZCMA 4MM3B 2R6NA 2FRQA 1VJVA 2AS8A 2YJBA 4D8EA 3RVVA 2XU5A 2BTWA 1ME4A 4RF0A 5EZSA 3GCBA 1CPJA 1MEGA 2BDLA 1MEMA 4BOPA 3TMPA 5EZQA 4M0WA 3MHSA 4YV8A 2ATOA 2NQAA 2DOSA 4Q8HA 2J7QC 1ATKA 1MS6A 4MZOA 2XU4A 3F75A 1VSNA 1U9QX 5PADA 4Q8GA 3LXSA 1FH0A 1CV8A 5F02A 1YT7A 1ITOA 1PADA 4BOUA 1EWLA 3QT4A 5CVOB 2JQFR 5JZEA 4X6HA 3PW3A 4PP1A 3I3TA 2YJ9A 2YJCA 2FUDA 2IPPB 4KLBA 4YYSA 4MZSA 3S3RA 4WA6A 2AUXA 1THEA 3I06A 3U8EA 2ARYA 3BBAA 3QJ3A 3OISA 2NQIA 4R3DA 2WBFX 2DCBA 3HHIA 4PP2E 2FO5A 4HXDB 2OP3A 4FK5A 2E02A 3H8CA 4P6EA 2YJ8A 3MORA 4N8WA 3C9EA 2E03A 3AI8A 3RNVA 2FT2A 4AXLA 2FYEA 1PIPA 3K8UA 3BY4A 5CHTA 4FJCA 1NL6A 3E1ZB 4BQVA 2P86A 4N4ZA 3W30A 4FIPA 4AXMA 4MSXA 1PXVA 1M6DA 2XU3A 1TU6A 2AVWA 1NQCA 3TNXA 2DC6A 2JRIA
chains in the Genus database with same CATH topology
4PT5A 4ZTBA 3PHWA 4BOPA 3TMPA 5EZQA 4BOZA 4RKXA 4M0WA 4A5UA 3O65A 3B21A 1DKIA 2JTCA 4GUAA 2DOSA 2FE8A 3W31A 2J7QC 3MTVA 4RNAA 3E9SA 4OVZB 2HWKA 5E6JA 3TRKA 1PVJA 1UKFA 4P16A 3IFUA 4BOUA 4BOSA 3PRPA 3C0RA 4IUMA 4D8IA 5JZEA 5KO3A 2Z84A 3BB7A 1YZBA 4IP3A 4WURA 2BTWB 3BBAA 4OVZA 4MI7A 4R3DA 3OQCA 4D8BA 4HXDB 3PSEA 4RF1A 4REZA 4BOQA 3RNVA 2BU3A 3PHUA 3BY4A 4OW0A 3W30A 2UZJA 3PRMA 3MJ5A 3ZNHA 3PT2A 3PHXA 4MM3B 3MP2A 4D8EA 2AGAA 2J7QA 4XZXA 2JRIA 2BTWA 4RF0A 5EZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B21 A;  3W31 A;  4XZX A;  4IP3 A;  3W30 A; 
#chains in the Genus database with same CATH topology
 3IMA A;  1X9Y A;  4W5C A;  2JQG R;  2F7D A;  3PNR A;  4BOZ A;  1DEU A;  4YYU A;  5EGW A;  7PCK A;  2Y6E A;  3B21 A;  2JTC A;  1SNK A;  3W31 A;  3ERV A;  3MTV A;  4I07 A;  4RNA A;  1BY8 A;  3N3K A;  1CSB B;  4DMY A;  4OVZ B;  1U9X A;  2AIM A;  3K9M A;  1S4V A;  1K3B B;  1QXP A;  1ME3 A;  4W4U A;  1PVJ A;  4BS5 A;  1EF7 A;  3KW9 A;  1UKF A;  2C0Y A;  3C0R A;  1EWO A;  1AEC A;  4IUM A;  1GCB A;  4D8I A;  2DJG B;  2CIO A;  4YVA A;  5KO3 A;  5FPW A;  3P5W A;  4XUI A;  1ZIV A;  4IP3 A;  1EWP A;  2AU1 A;  1XKG A;  1YAL A;  2BTW B;  4MI7 A;  1BGO A;  1GMY A;  3BOW A;  4PAD A;  3OQC A;  1MDW A;  2B1N A;  5A24 A;  1CS8 A;  2PNS A;  4N79 A;  1F2B A;  4REZ A;  2VHF A;  3PHU A;  3WXF A;  1TL9 A;  1YK7 A;  3KFQ A;  1ICF A;  2DZZ A;  4QRV A;  2DC7 A;  2UZJ A;  2DCC A;  3PRM A;  3MJ5 A;  2O6X A;  3PT2 A;  2DC8 A;  3H7D A;  2NQG A;  3OVX A;  1CJL A;  1NB3 A;  1PPD A;  2J7Q A;  2FQ9 A;  3P5V A;  1A6R A;  4I04 A;  2ACT A;  4PT5 A;  1AYV A;  2PAD A;  4ZTB A;  3IOQ A;  3H8B A;  3PHW A;  3BPF A;  4W5B A;  3KWB X;  2E00 A;  4A5U A;  4QH6 A;  3O65 A;  1DKI A;  3LFY A;  3S3Q A;  1CQD A;  4G54 A;  5CVM A;  3E9S A;  2HWK A;  1QMY A;  3P5U A;  4BPV A;  3D6S A;  2HD5 A;  2AUZ A;  5E6J A;  4YYW A;  1JQP A;  3RVW A;  2R9C A;  3BPM A;  3IEJ A;  4P16 A;  1Q6K A;  3OVZ A;  4BOS A;  3IUT A;  4PI3 A;  1PBH A;  4DMX A;  1EWM A;  3HWN A;  3KKU A;  5CHV A;  5JH3 A;  3BB7 A;  1AYW A;  1NPZ A;  3CBJ A;  1O0E A;  4WUR A;  3P5X A;  3ZUA A;  4CDF B;  3CBK A;  1AYU A;  4QRG A;  1YK8 A;  3H6S A;  1AU4 A;  6PAD A;  4X6I A;  1F2C A;  5CVN B;  5EF4 A;  1Y4H A;  1Y08 A;  3PSE A;  3HHA A;  2OZ2 A;  4RF1 A;  2BDZ A;  3USV A;  1KHQ A;  4BOQ A;  2R9M A;  1GEC E;  1POP A;  3PBH A;  4YYR A;  1KHP A;  1MHW A;  2G8J A;  3IV2 A;  1AU2 A;  4XR7 A;  2DJF B;  1U5I A;  3O1G A;  4BSQ A;  3IHP A;  4CDD B;  1SP4 B;  3PDF A;  4X6J A;  3ZNH A;  3PHX A;  3N3G A;  1U9V A;  3MHH A;  3V6C A;  3MP2 A;  2G8E A;  2AGA A;  3OF9 A;  3WXG A;  3BCN A;  4QBB A;  4XZX A;  1PPP A;  1CTE A;  3O0U A;  2G6D A;  3KSE A;  2DC9 A;  3K24 A;  3V6E A;  8PCH A;  3DF0 A;  3RVX A;  2P0R A;  1CB5 A;  1QOL A;  2DCD A;  1NLJ A;  4RKX A;  3CH3 X;  1BQI A;  1AU0 A;  3OF8 A;  4GUA A;  3BWK A;  5J94 A;  2FE8 A;  1KXR A;  4RY2 A;  4BS6 A;  2GFO A;  2CB5 A;  2YJ2 A;  4K7C A;  1PCI A;  2E01 A;  4OEM A;  1QDQ A;  2R9F A;  4P6G A;  1PPN A;  5JA7 A;  2H7J A;  3TRK A;  2R9O A;  2F1G A;  2HH5 A;  3KX1 A;  1IWD A;  1YVB A;  2VHS A;  2XU1 A;  4CDE B;  1DF0 A;  3IFU A;  1KFX L;  2DCA A;  2B1M A;  3PRP A;  1U9W A;  2R9N A;  4CZW A;  3BC3 A;  2DZY A;  1STF E;  2FTD A;  2HHN A;  2GHU A;  3HD3 A;  2Z84 A;  4I05 A;  1CVZ A;  1NB5 A;  1YZB A;  3F5V A;  2P7U A;  4YYQ A;  4QRX A;  2NQD B;  1AU3 A;  1MIR A;  2FRA A;  2HXZ A;  2PRE A;  2AYO A;  3NHE A;  1HUC B;  4OVZ A;  1TLO A;  1F29 A;  4HWY A;  2PBH A;  3CH2 X;  5K16 A;  4ZUX U;  4D8B A;  3N4C A;  4CDC B;  9PAP A;  2IBI A;  1PPO A;  3WXE A;  3QSD A;  2Y5B A;  3M99 A;  3H89 A;  1BP4 A;  2BU3 A;  3MTN A;  3KWZ A;  1GLO A;  1AIM A;  1KFU L;  2AYN A;  2G7Y A;  2OUL A;  4OW0 A;  4YYV A;  3B79 A;  1F2A A;  4OEL A;  1PE6 A;  1ZCM A;  4MM3 B;  2R6N A;  2FRQ A;  1VJV A;  2AS8 A;  2YJB A;  4D8E A;  3RVV A;  2XU5 A;  2BTW A;  1ME4 A;  4RF0 A;  5EZS A;  3GCB A;  1CPJ A;  1MEG A;  2BDL A;  1MEM A;  4BOP A;  3TMP A;  5EZQ A;  4M0W A;  3MHS A;  4YV8 A;  2ATO A;  2NQA A;  2DOS A;  4Q8H A;  2J7Q C;  1ATK A;  1MS6 A;  4MZO A;  2XU4 A;  3F75 A;  1VSN A;  1U9Q X;  5PAD A;  4Q8G A;  3LXS A;  1FH0 A;  1CV8 A;  5F02 A;  1YT7 A;  1ITO A;  1PAD A;  4BOU A;  1EWL A;  3QT4 A;  5CVO B;  2JQF R;  5JZE A;  4X6H A;  3PW3 A;  4PP1 A;  3I3T A;  2YJ9 A;  2YJC A;  2FUD A;  2IPP B;  4KLB A;  4YYS A;  4MZS A;  3S3R A;  4WA6 A;  2AUX A;  1THE A;  3I06 A;  3U8E A;  2ARY A;  3BBA A;  3QJ3 A;  3OIS A;  2NQI A;  4R3D A;  2WBF X;  2DCB A;  3HHI A;  4PP2 E;  2FO5 A;  4HXD B;  2OP3 A;  4FK5 A;  2E02 A;  3H8C A;  4P6E A;  2YJ8 A;  3MOR A;  4N8W A;  3C9E A;  2E03 A;  3AI8 A;  3RNV A;  2FT2 A;  4AXL A;  2FYE A;  1PIP A;  3K8U A;  3BY4 A;  5CHT A;  4FJC A;  1NL6 A;  3E1Z B;  4BQV A;  2P86 A;  4N4Z A;  3W30 A;  4FIP A;  4AXM A;  4MSX A;  1PXV A;  1M6D A;  2XU3 A;  1TU6 A;  2AVW A;  1NQC A;  3TNX A;  2DC6 A;  2JRI A; 
#chains in the Genus database with same CATH homology
 4PT5 A;  4ZTB A;  3PHW A;  4BOP A;  3TMP A;  5EZQ A;  4BOZ A;  4RKX A;  4M0W A;  4A5U A;  3O65 A;  3B21 A;  1DKI A;  2JTC A;  4GUA A;  2DOS A;  2FE8 A;  3W31 A;  2J7Q C;  3MTV A;  4RNA A;  3E9S A;  4OVZ B;  2HWK A;  5E6J A;  3TRK A;  1PVJ A;  1UKF A;  4P16 A;  3IFU A;  4BOU A;  4BOS A;  3PRP A;  3C0R A;  4IUM A;  4D8I A;  5JZE A;  5KO3 A;  2Z84 A;  3BB7 A;  1YZB A;  4IP3 A;  4WUR A;  2BTW B;  3BBA A;  4OVZ A;  4MI7 A;  4R3D A;  3OQC A;  4D8B A;  4HXD B;  3PSE A;  4RF1 A;  4REZ A;  4BOQ A;  3RNV A;  2BU3 A;  3PHU A;  3BY4 A;  4OW0 A;  3W30 A;  2UZJ A;  3PRM A;  3MJ5 A;  3ZNH A;  3PT2 A;  3PHX A;  4MM3 B;  3MP2 A;  4D8E A;  2AGA A;  2J7Q A;  4XZX A;  2JRI A;  2BTW A;  4RF0 A;  5EZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...