1PE6A

Refined x-ray structure of papain(dot)e-64-c complex at 2.1-angstroms resolution
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAPAIN
publication title Refined x-ray structure of papain.E-64-c complex at 2.1-A resolution.
pubmed rcsb
source organism Carica papaya
molecule tags Hydrolase (sulfhydryl proteinase)
total genus 70
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1991-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1pe6A00
1AYWA 3RVVA 3OVXA 3D6SA 3I3TA 1BP4A 3PW3A 4AXMA 1TU6A 1MDWA 2BDLA 2DCBA 3K9MA 3H8BA 3QT4A 4CZWA 4CDDB 2CIOA 1U9WA 3V6CA 3PBHA 1GMYA 2O6XA 3KX1A 1AIMA 1GLOA 3P5VA 1S4VA 2G7YA 4N8WA 2YJBA 2R9MA 1IWDA 1ME4A 4YVAA 2B1NA 2VHSA 1PE6A 4YYQA 1DEUA 3H8CA 1VSNA 3RVWA 3F5VA 4I05A 1MEMA 2GFOA 5CVOB 1TLOA 1NPZA 1YT7A 2XU5A 2XU1A 1AECA 2JQFR 2R9FA 2HXZA 2WBFX 4X6JA 2G6DA 1AU4A 1PBHA 8PCHA 3MHHA 3P5UA 1PPNA 2PNSA 2DZYA 4BS6A 1U9VA 3E1ZB 2HHNA 1JQPA 1YVBA 3OVZA 1BQIA 1AU3A 4N4ZA 3BPFA 1AU2A 4YV8A 1YK7A 4MSXA 5J94A 5K16A 3CH2X 1F29A 4CDEB 2ATOA 4G54A 1NB5A 3AI8A 2E02A 3H6SA 3LFYA 1MS6A 3HHIA 2NQAA 2VHFA 2R9CA 4YYRA 3S3RA 1XKGA 1MHWA 4DMXA 4XUIA 2P86A 1MIRA 1EWLA 3U8EA 2PREA 2P0RA 1AYUA 2YJ8A 1F2AA 4MZSA 4P6EA 2NQGA 5PADA 3F75A 1POPA 4QBBA 1CVZA 3OISA 3USVA 3IMAA 4MZOA 2AS8A 3KW9A 3ZUAA 3HWNA 3KKUA 5CVMA 3IUTA 1PPDA 2FT2A 3HD3A 1PPOA 1Y08A 3CH3X 3IHPA 1KFXL 1Y4HA 2DZZA 5CHVA 4OEMA 1KFUL 2E00A 1NLJA 2FYEA 1EF7A 2JQGR 2GHUA 4QRXA 4YYSA 2YJ9A 9PAPA 1PIPA 2ARYA 3ERVA 4X6IA 1F2BA 2E03A 2XU3A 2DCAA 1HUCB 2XU4A 3KWZA 1ATKA 2FTDA 4K7CA 1PXVA 1CTEA 4N79A 3QJ3A 3WXEA 4ZUXU 1TL9A 4FJCA 4X6HA 4BPVA 5EGWA 3RVXA 2AVWA 1BY8A 1QMYA 3CBJA 1SP4B 2IBIA 2OZ2A 1X9YA 3WXFA 2E01A 2BDZA 1FH0A 1CB5A 4PP2E 3V6EA 1U9QX 1M6DA 5JH3A 4XR7A 1K3BB 3IV2A 2FRQA 2G8JA 1U5IA 4I04A 1PPPA 1MEGA 3PNRA 2AYNA 2AUXA 1ZCMA 4BSQA 1NB3A 1DF0A 3GCBA 1THEA 1ME3A 3KSEA 6PADA 1STFE 2DC6A 4BQVA 1NL6A 3MHSA 3KFQA 1GCBA 3O0UA 3WXGA 4W5BA 1YK8A 3M99A 4PI3A 4RY2A 1CSBB 1CPJA 2AIMA 2DC8A 2DCDA 1KXRA 5CHTA 1SNKA 3K8UA 1CQDA 1QOLA 1BGOA 3BOWA 2HH5A 3MTNA 3OF8A 5EF4A 3CBKA 3B79A 4OELA 1PCIA 2B1MA 3IEJA 5A24A 2Y5BA 5JA7A 2DC9A 3O1GA 2R9NA 3K24A 1ICFA 1VJVA 4P6GA 1AYVA 4DMYA 3OF9A 3N3GA 4YYWA 1YALA 2C0YA 1F2CA 2YJCA 1Q6KA 1QDQA 1GECE 4YYUA 1CS8A 2FO5A 2P7UA 3I06A 1QXPA 2Y6EA 4AXLA 3BPMA 3N3KA 2R9OA 5F02A 1PADA 2OP3A 4QH6A 2H7JA 5CVNB 4PADA 3S3QA 2FUDA 1KHQA 1NQCA 3LXSA 3TNXA 2FRAA 2DCCA 3P5XA 4YYVA 1EWPA 7PCKA 3NHEA 2AUZA 2DJFB 3N4CA 3DF0A 4PP1A 4CDFB 2PADA 3BCNA 1CJLA 1CV8A 1A6RA 2NQDB 1O0EA 3MORA 2IPPB 3BC3A 3KWBX 2G8EA 2R6NA 3HHAA 3BWKA 1KHPA 2HD5A 1EWMA 3H7DA 3C9EA 2F7DA 3H89A 3P5WA 4WA6A 4QRVA 2AYOA 2OULA 2DJGB 4FIPA 2FQ9A 1ZIVA 4KLBA 1AU0A 5FPWA 1ITOA 1U9XA 4BS5A 3PDFA 4Q8HA 1EWOA 2AU1A 4W4UA 4CDCB 4QRGA 2F1GA 2ACTA 4HWYA 2NQIA 3IOQA 2YJ2A 3QSDA 4FK5A 2CB5A 2DC7A 4W5CA 2PBHA 4Q8GA 4I07A
chains in the Genus database with same CATH superfamily
1AYWA 3RVVA 3OVXA 3D6SA 2Z84A 3BBAA 4RKXA 5KO3A 4WURA 3I3TA 1BP4A 3PW3A 4AXMA 1TU6A 1MDWA 2BDLA 2DCBA 3K9MA 3H8BA 4OW0A 3QT4A 4CZWA 4CDDB 2CIOA 3PSEA 1U9WA 3V6CA 3PBHA 1GMYA 2O6XA 3KX1A 1AIMA 1GLOA 3P5VA 2FE8A 1S4VA 2G7YA 4N8WA 2YJBA 2R9MA 1IWDA 3W30A 1ME4A 4YVAA 2B1NA 2VHSA 1PE6A 4YYQA 1DEUA 3H8CA 1VSNA 4D8EA 3RVWA 3O65A 3F5VA 4I05A 4IUMA 1MEMA 2GFOA 5CVOB 1TLOA 1NPZA 1YT7A 2XU5A 2XU1A 4PT5A 1AECA 2JQFR 2R9FA 2HXZA 2WBFX 4X6JA 2G6DA 1AU4A 1PBHA 8PCHA 3MHHA 3P5UA 1PPNA 2PNSA 2DZYA 4BS6A 1U9VA 3E1ZB 2HHNA 1JQPA 2BTWA 1YVBA 3OVZA 1BQIA 1AU3A 4N4ZA 3BPFA 1AU2A 4YV8A 1YK7A 4MSXA 5J94A 4M0WA 5K16A 3CH2X 1F29A 4CDEB 2ATOA 4G54A 1NB5A 1YZBA 3AI8A 2E02A 3H6SA 3LFYA 3PT2A 1MS6A 3HHIA 2NQAA 2VHFA 2R9CA 4MI7A 3W31A 4YYRA 3S3RA 1XKGA 1MHWA 4DMXA 4XUIA 2P86A 1MIRA 1EWLA 3U8EA 2PREA 2P0RA 1AYUA 3C0RA 4OVZA 2YJ8A 4HXDB 1F2AA 4MZSA 4P6EA 2NQGA 3IFUA 5PADA 4P16A 3F75A 1POPA 4QBBA 1CVZA 3OISA 3USVA 3IMAA 4MZOA 2AS8A 3KW9A 3ZUAA 3HWNA 5E6JA 4A5UA 3KKUA 5CVMA 3IUTA 1PPDA 2FT2A 3HD3A 1PPOA 1Y08A 3CH3X 3IHPA 1KFXL 1Y4HA 2DZZA 5CHVA 3RNVA 4OEMA 1KFUL 4MM3B 2E00A 1NLJA 2FYEA 3PHUA 2JRIA 1EF7A 2JQGR 2BTWB 2GHUA 3PHWA 4QRXA 4YYSA 3TRKA 2YJ9A 3TMPA 9PAPA 1PIPA 5EZSA 2ARYA 3ERVA 4X6IA 1F2BA 2E03A 2XU3A 2DCAA 4REZA 1HUCB 2XU4A 3KWZA 1ATKA 5EZQA 2FTDA 4K7CA 4RF1A 4BOSA 1PXVA 1CTEA 4N79A 3QJ3A 3WXEA 4ZUXU 4RF0A 1TL9A 4FJCA 4X6HA 4BPVA 5EGWA 3RVXA 2AVWA 1BY8A 1QMYA 2UZJA 4XZXA 3CBJA 1SP4B 2IBIA 4D8BA 2OZ2A 1X9YA 3WXFA 2E01A 2BDZA 1FH0A 1CB5A 4PP2E 3V6EA 1U9QX 1M6DA 5JH3A 4XR7A 3MJ5A 4OVZB 1K3BB 3IV2A 3MTVA 2FRQA 2G8JA 1U5IA 4I04A 3PRPA 2J7QC 1PPPA 1MEGA 3PNRA 2AYNA 2AUXA 2DOSA 1ZCMA 3OQCA 4BSQA 3MP2A 1NB3A 4BOPA 1DF0A 3GCBA 1THEA 1ME3A 3KSEA 6PADA 2HWKA 1STFE 2DC6A 4BQVA 1NL6A 3MHSA 3KFQA 1GCBA 3O0UA 4GUAA 3WXGA 3E9SA 4W5BA 1YK8A 3M99A 4PI3A 4RY2A 4BOQA 1CSBB 3PHXA 1CPJA 2AIMA 2DC8A 2DCDA 1KXRA 2JTCA 5CHTA 1SNKA 3K8UA 1CQDA 1QOLA 1BGOA 3BOWA 2HH5A 3MTNA 3OF8A 5EF4A 3CBKA 1PVJA 3B79A 4OELA 1PCIA 2B1MA 3IEJA 5A24A 2Y5BA 5JA7A 2DC9A 3O1GA 2R9NA 3K24A 1ICFA 1VJVA 4P6GA 4RNAA 1AYVA 2J7QA 4BOUA 4DMYA 3OF9A 1DKIA 3N3GA 4YYWA 4ZTBA 1YALA 2C0YA 1F2CA 2YJCA 1Q6KA 1QDQA 1GECE 4YYUA 3PRMA 3B21A 1CS8A 2FO5A 2P7UA 3I06A 1QXPA 2Y6EA 4AXLA 3BPMA 3N3KA 2R9OA 5F02A 1PADA 2OP3A 4QH6A 2AGAA 2H7JA 5CVNB 4PADA 3S3QA 4BOZA 2FUDA 1KHQA 1NQCA 3LXSA 3TNXA 2FRAA 2DCCA 3P5XA 4YYVA 1EWPA 7PCKA 3NHEA 3ZNHA 2AUZA 3BY4A 2DJFB 3N4CA 3BB7A 3DF0A 4PP1A 4CDFB 2PADA 3BCNA 4D8IA 1CJLA 1CV8A 1A6RA 2NQDB 1O0EA 3MORA 2IPPB 3BC3A 3KWBX 2G8EA 2R6NA 3HHAA 3BWKA 1KHPA 2HD5A 1EWMA 3H7DA 3C9EA 2F7DA 3H89A 3P5WA 4WA6A 4QRVA 2AYOA 2OULA 2DJGB 4FIPA 2FQ9A 1ZIVA 4KLBA 1AU0A 5FPWA 1ITOA 1U9XA 4BS5A 3PDFA 4Q8HA 1EWOA 2AU1A 4R3DA 4W4UA 4CDCB 4QRGA 2F1GA 2ACTA 4HWYA 2NQIA 2BU3A 3IOQA 2YJ2A 5JZEA 4IP3A 3QSDA 4FK5A 2CB5A 2DC7A 4W5CA 2PBHA 4Q8GA 1UKFA 4I07A
chains in the Genus database with same CATH topology
1AYWA 3RVVA 3OVXA 3D6SA 3I3TA 1BP4A 3PW3A 4AXMA 1TU6A 1MDWA 2BDLA 2DCBA 3K9MA 3H8BA 3QT4A 4CZWA 4CDDB 2CIOA 1U9WA 3V6CA 3PBHA 1GMYA 2O6XA 3KX1A 1AIMA 1GLOA 3P5VA 1S4VA 2G7YA 4N8WA 2YJBA 2R9MA 1IWDA 1ME4A 4YVAA 2B1NA 2VHSA 1PE6A 4YYQA 1DEUA 3H8CA 1VSNA 3RVWA 3F5VA 4I05A 1MEMA 2GFOA 5CVOB 1TLOA 1NPZA 1YT7A 2XU5A 2XU1A 1AECA 2JQFR 2R9FA 2HXZA 2WBFX 4X6JA 2G6DA 1AU4A 1PBHA 8PCHA 3MHHA 3P5UA 1PPNA 2PNSA 2DZYA 4BS6A 1U9VA 3E1ZB 2HHNA 1JQPA 1YVBA 3OVZA 1BQIA 1AU3A 4N4ZA 3BPFA 1AU2A 4YV8A 1YK7A 4MSXA 5J94A 5K16A 3CH2X 1F29A 4CDEB 2ATOA 4G54A 1NB5A 3AI8A 2E02A 3H6SA 3LFYA 1MS6A 3HHIA 2NQAA 2VHFA 2R9CA 4YYRA 3S3RA 1XKGA 1MHWA 4DMXA 4XUIA 2P86A 4BGFA 1MIRA 1EWLA 3U8EA 2PREA 2P0RA 1AYUA 2YJ8A 1F2AA 4MZSA 4P6EA 2NQGA 5PADA 3F75A 1POPA 4QBBA 1CVZA 3OISA 3USVA 3IMAA 4MZOA 2AS8A 3KW9A 3ZUAA 3HWNA 3KKUA 5CVMA 3IUTA 1PPDA 2FT2A 3HD3A 1PPOA 1Y08A 3CH3X 3IHPA 1KFXL 1Y4HA 2DZZA 5CHVA 4OEMA 1KFUL 2BSZA 2E00A 1NLJA 2FYEA 1EF7A 2JQGR 2GHUA 4QRXA 4GUZA 4YYSA 2YJ9A 9PAPA 1PIPA 2ARYA 3ERVA 4X6IA 1F2BA 2E03A 2XU3A 2DCAA 1HUCB 2XU4A 3KWZA 1W6FA 1ATKA 2FTDA 4K7CA 1PXVA 1CTEA 4N79A 3QJ3A 3WXEA 4ZUXU 1TL9A 4FJCA 4X6HA 4BPVA 5EGWA 3RVXA 2AVWA 1BY8A 1QMYA 1W4TA 3CBJA 1SP4B 2IBIA 2OZ2A 1X9YA 3WXFA 2E01A 2BDZA 1FH0A 1CB5A 4PP2E 3V6EA 1U9QX 1M6DA 5JH3A 4XR7A 1K3BB 3IV2A 2FRQA 2G8JA 1U5IA 4I04A 1PPPA 1MEGA 3PNRA 2AYNA 2AUXA 1ZCMA 4BSQA 1NB3A 1DF0A 3GCBA 1THEA 1ME3A 3KSEA 6PADA 1STFE 2DC6A 4BQVA 1NL6A 3MHSA 3KFQA 1GCBA 3O0UA 3WXGA 4W5BA 1YK8A 3M99A 4PI3A 4RY2A 1CSBB 1CPJA 2AIMA 2DC8A 2DCDA 1KXRA 5CHTA 1SNKA 3K8UA 1CQDA 1QOLA 1BGOA 3BOWA 2HH5A 3MTNA 3OF8A 5EF4A 3CBKA 3B79A 4OELA 1PCIA 2B1MA 3IEJA 5A24A 4C5PA 2Y5BA 5JA7A 2DC9A 3O1GA 2R9NA 3K24A 1ICFA 1VJVA 4P6GA 1AYVA 4DMYA 3OF9A 3N3GA 4YYWA 1YALA 2C0YA 1F2CA 2YJCA 1Q6KA 1QDQA 1GECE 4YYUA 1CS8A 2FO5A 2P7UA 3I06A 1QXPA 2Y6EA 4AXLA 3BPMA 1W5RA 3N3KA 2R9OA 5F02A 1PADA 2OP3A 4QH6A 2H7JA 5CVNB 4PADA 3S3QA 2FUDA 1KHQA 1NQCA 3LXSA 3TNXA 2FRAA 4B55A 2DCCA 3P5XA 4YYVA 3LTWA 1EWPA 7PCKA 3NHEA 1GX3A 2AUZA 2DJFB 3N4CA 3DF0A 4PP1A 4CDFB 2PADA 3BCNA 1CJLA 1CV8A 1A6RA 2NQDB 4NV8A 1O0EA 3MORA 3D9WA 2IPPB 3BC3A 3KWBX 1E2TA 2G8EA 2R6NA 3HHAA 3BWKA 1KHPA 2HD5A 1EWMA 3H7DA 3C9EA 2F7DA 3H89A 3P5WA 4WA6A 4QRVA 2AYOA 2OULA 2DJGB 4FIPA 2VFBA 2FQ9A 1ZIVA 4KLBA 1AU0A 4NV7A 5FPWA 1ITOA 1U9XA 4BS5A 3PDFA 4Q8HA 1EWOA 2AU1A 4W4UA 4CDCB 4QRGA 2F1GA 2ACTA 4HWYA 2NQIA 3IOQA 2YJ2A 3QSDA 4FK5A 2CB5A 2DC7A 4W5CA 2PBHA 4Q8GA 2VFCA 4I07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AYW A;  3RVV A;  3OVX A;  3D6S A;  3I3T A;  1BP4 A;  3PW3 A;  4AXM A;  1TU6 A;  1MDW A;  2BDL A;  2DCB A;  3K9M A;  3H8B A;  3QT4 A;  4CZW A;  4CDD B;  2CIO A;  1U9W A;  3V6C A;  3PBH A;  1GMY A;  2O6X A;  3KX1 A;  1AIM A;  1GLO A;  3P5V A;  1S4V A;  2G7Y A;  4N8W A;  2YJB A;  2R9M A;  1IWD A;  1ME4 A;  4YVA A;  2B1N A;  2VHS A;  1PE6 A;  4YYQ A;  1DEU A;  3H8C A;  1VSN A;  3RVW A;  3F5V A;  4I05 A;  1MEM A;  2GFO A;  5CVO B;  1TLO A;  1NPZ A;  1YT7 A;  2XU5 A;  2XU1 A;  1AEC A;  2JQF R;  2R9F A;  2HXZ A;  2WBF X;  4X6J A;  2G6D A;  1AU4 A;  1PBH A;  8PCH A;  3MHH A;  3P5U A;  1PPN A;  2PNS A;  2DZY A;  4BS6 A;  1U9V A;  3E1Z B;  2HHN A;  1JQP A;  1YVB A;  3OVZ A;  1BQI A;  1AU3 A;  4N4Z A;  3BPF A;  1AU2 A;  4YV8 A;  1YK7 A;  4MSX A;  5J94 A;  5K16 A;  3CH2 X;  1F29 A;  4CDE B;  2ATO A;  4G54 A;  1NB5 A;  3AI8 A;  2E02 A;  3H6S A;  3LFY A;  1MS6 A;  3HHI A;  2NQA A;  2VHF A;  2R9C A;  4YYR A;  3S3R A;  1XKG A;  1MHW A;  4DMX A;  4XUI A;  2P86 A;  1MIR A;  1EWL A;  3U8E A;  2PRE A;  2P0R A;  1AYU A;  2YJ8 A;  1F2A A;  4MZS A;  4P6E A;  2NQG A;  5PAD A;  3F75 A;  1POP A;  4QBB A;  1CVZ A;  3OIS A;  3USV A;  3IMA A;  4MZO A;  2AS8 A;  3KW9 A;  3ZUA A;  3HWN A;  3KKU A;  5CVM A;  3IUT A;  1PPD A;  2FT2 A;  3HD3 A;  1PPO A;  1Y08 A;  3CH3 X;  3IHP A;  1KFX L;  1Y4H A;  2DZZ A;  5CHV A;  4OEM A;  1KFU L;  2E00 A;  1NLJ A;  2FYE A;  1EF7 A;  2JQG R;  2GHU A;  4QRX A;  4YYS A;  2YJ9 A;  9PAP A;  1PIP A;  2ARY A;  3ERV A;  4X6I A;  1F2B A;  2E03 A;  2XU3 A;  2DCA A;  1HUC B;  2XU4 A;  3KWZ A;  1ATK A;  2FTD A;  4K7C A;  1PXV A;  1CTE A;  4N79 A;  3QJ3 A;  3WXE A;  4ZUX U;  1TL9 A;  4FJC A;  4X6H A;  4BPV A;  5EGW A;  3RVX A;  2AVW A;  1BY8 A;  1QMY A;  3CBJ A;  1SP4 B;  2IBI A;  2OZ2 A;  1X9Y A;  3WXF A;  2E01 A;  2BDZ A;  1FH0 A;  1CB5 A;  4PP2 E;  3V6E A;  1U9Q X;  1M6D A;  5JH3 A;  4XR7 A;  1K3B B;  3IV2 A;  2FRQ A;  2G8J A;  1U5I A;  4I04 A;  1PPP A;  1MEG A;  3PNR A;  2AYN A;  2AUX A;  1ZCM A;  4BSQ A;  1NB3 A;  1DF0 A;  3GCB A;  1THE A;  1ME3 A;  3KSE A;  6PAD A;  1STF E;  2DC6 A;  4BQV A;  1NL6 A;  3MHS A;  3KFQ A;  1GCB A;  3O0U A;  3WXG A;  4W5B A;  1YK8 A;  3M99 A;  4PI3 A;  4RY2 A;  1CSB B;  1CPJ A;  2AIM A;  2DC8 A;  2DCD A;  1KXR A;  5CHT A;  1SNK A;  3K8U A;  1CQD A;  1QOL A;  1BGO A;  3BOW A;  2HH5 A;  3MTN A;  3OF8 A;  5EF4 A;  3CBK A;  3B79 A;  4OEL A;  1PCI A;  2B1M A;  3IEJ A;  5A24 A;  2Y5B A;  5JA7 A;  2DC9 A;  3O1G A;  2R9N A;  3K24 A;  1ICF A;  1VJV A;  4P6G A;  1AYV A;  4DMY A;  3OF9 A;  3N3G A;  4YYW A;  1YAL A;  2C0Y A;  1F2C A;  2YJC A;  1Q6K A;  1QDQ A;  1GEC E;  4YYU A;  1CS8 A;  2FO5 A;  2P7U A;  3I06 A;  1QXP A;  2Y6E A;  4AXL A;  3BPM A;  3N3K A;  2R9O A;  5F02 A;  1PAD A;  2OP3 A;  4QH6 A;  2H7J A;  5CVN B;  4PAD A;  3S3Q A;  2FUD A;  1KHQ A;  1NQC A;  3LXS A;  3TNX A;  2FRA A;  2DCC A;  3P5X A;  4YYV A;  1EWP A;  7PCK A;  3NHE A;  2AUZ A;  2DJF B;  3N4C A;  3DF0 A;  4PP1 A;  4CDF B;  2PAD A;  3BCN A;  1CJL A;  1CV8 A;  1A6R A;  2NQD B;  1O0E A;  3MOR A;  2IPP B;  3BC3 A;  3KWB X;  2G8E A;  2R6N A;  3HHA A;  3BWK A;  1KHP A;  2HD5 A;  1EWM A;  3H7D A;  3C9E A;  2F7D A;  3H89 A;  3P5W A;  4WA6 A;  4QRV A;  2AYO A;  2OUL A;  2DJG B;  4FIP A;  2FQ9 A;  1ZIV A;  4KLB A;  1AU0 A;  5FPW A;  1ITO A;  1U9X A;  4BS5 A;  3PDF A;  4Q8H A;  1EWO A;  2AU1 A;  4W4U A;  4CDC B;  4QRG A;  2F1G A;  2ACT A;  4HWY A;  2NQI A;  3IOQ A;  2YJ2 A;  3QSD A;  4FK5 A;  2CB5 A;  2DC7 A;  4W5C A;  2PBH A;  4Q8G A;  4I07 A; 
#chains in the Genus database with same CATH topology
 1AYW A;  3RVV A;  3OVX A;  3D6S A;  2Z84 A;  3BBA A;  4RKX A;  5KO3 A;  4WUR A;  3I3T A;  1BP4 A;  3PW3 A;  4AXM A;  1TU6 A;  1MDW A;  2BDL A;  2DCB A;  3K9M A;  3H8B A;  4OW0 A;  3QT4 A;  4CZW A;  4CDD B;  2CIO A;  3PSE A;  1U9W A;  3V6C A;  3PBH A;  1GMY A;  2O6X A;  3KX1 A;  1AIM A;  1GLO A;  3P5V A;  2FE8 A;  1S4V A;  2G7Y A;  4N8W A;  2YJB A;  2R9M A;  1IWD A;  3W30 A;  1ME4 A;  4YVA A;  2B1N A;  2VHS A;  1PE6 A;  4YYQ A;  1DEU A;  3H8C A;  1VSN A;  4D8E A;  3RVW A;  3O65 A;  3F5V A;  4I05 A;  4IUM A;  1MEM A;  2GFO A;  5CVO B;  1TLO A;  1NPZ A;  1YT7 A;  2XU5 A;  2XU1 A;  4PT5 A;  1AEC A;  2JQF R;  2R9F A;  2HXZ A;  2WBF X;  4X6J A;  2G6D A;  1AU4 A;  1PBH A;  8PCH A;  3MHH A;  3P5U A;  1PPN A;  2PNS A;  2DZY A;  4BS6 A;  1U9V A;  3E1Z B;  2HHN A;  1JQP A;  2BTW A;  1YVB A;  3OVZ A;  1BQI A;  1AU3 A;  4N4Z A;  3BPF A;  1AU2 A;  4YV8 A;  1YK7 A;  4MSX A;  5J94 A;  4M0W A;  5K16 A;  3CH2 X;  1F29 A;  4CDE B;  2ATO A;  4G54 A;  1NB5 A;  1YZB A;  3AI8 A;  2E02 A;  3H6S A;  3LFY A;  3PT2 A;  1MS6 A;  3HHI A;  2NQA A;  2VHF A;  2R9C A;  4MI7 A;  3W31 A;  4YYR A;  3S3R A;  1XKG A;  1MHW A;  4DMX A;  4XUI A;  2P86 A;  1MIR A;  1EWL A;  3U8E A;  2PRE A;  2P0R A;  1AYU A;  3C0R A;  4OVZ A;  2YJ8 A;  4HXD B;  1F2A A;  4MZS A;  4P6E A;  2NQG A;  3IFU A;  5PAD A;  4P16 A;  3F75 A;  1POP A;  4QBB A;  1CVZ A;  3OIS A;  3USV A;  3IMA A;  4MZO A;  2AS8 A;  3KW9 A;  3ZUA A;  3HWN A;  5E6J A;  4A5U A;  3KKU A;  5CVM A;  3IUT A;  1PPD A;  2FT2 A;  3HD3 A;  1PPO A;  1Y08 A;  3CH3 X;  3IHP A;  1KFX L;  1Y4H A;  2DZZ A;  5CHV A;  3RNV A;  4OEM A;  1KFU L;  4MM3 B;  2E00 A;  1NLJ A;  2FYE A;  3PHU A;  2JRI A;  1EF7 A;  2JQG R;  2BTW B;  2GHU A;  3PHW A;  4QRX A;  4YYS A;  3TRK A;  2YJ9 A;  3TMP A;  9PAP A;  1PIP A;  5EZS A;  2ARY A;  3ERV A;  4X6I A;  1F2B A;  2E03 A;  2XU3 A;  2DCA A;  4REZ A;  1HUC B;  2XU4 A;  3KWZ A;  1ATK A;  5EZQ A;  2FTD A;  4K7C A;  4RF1 A;  4BOS A;  1PXV A;  1CTE A;  4N79 A;  3QJ3 A;  3WXE A;  4ZUX U;  4RF0 A;  1TL9 A;  4FJC A;  4X6H A;  4BPV A;  5EGW A;  3RVX A;  2AVW A;  1BY8 A;  1QMY A;  2UZJ A;  4XZX A;  3CBJ A;  1SP4 B;  2IBI A;  4D8B A;  2OZ2 A;  1X9Y A;  3WXF A;  2E01 A;  2BDZ A;  1FH0 A;  1CB5 A;  4PP2 E;  3V6E A;  1U9Q X;  1M6D A;  5JH3 A;  4XR7 A;  3MJ5 A;  4OVZ B;  1K3B B;  3IV2 A;  3MTV A;  2FRQ A;  2G8J A;  1U5I A;  4I04 A;  3PRP A;  2J7Q C;  1PPP A;  1MEG A;  3PNR A;  2AYN A;  2AUX A;  2DOS A;  1ZCM A;  3OQC A;  4BSQ A;  3MP2 A;  1NB3 A;  4BOP A;  1DF0 A;  3GCB A;  1THE A;  1ME3 A;  3KSE A;  6PAD A;  2HWK A;  1STF E;  2DC6 A;  4BQV A;  1NL6 A;  3MHS A;  3KFQ A;  1GCB A;  3O0U A;  4GUA A;  3WXG A;  3E9S A;  4W5B A;  1YK8 A;  3M99 A;  4PI3 A;  4RY2 A;  4BOQ A;  1CSB B;  3PHX A;  1CPJ A;  2AIM A;  2DC8 A;  2DCD A;  1KXR A;  2JTC A;  5CHT A;  1SNK A;  3K8U A;  1CQD A;  1QOL A;  1BGO A;  3BOW A;  2HH5 A;  3MTN A;  3OF8 A;  5EF4 A;  3CBK A;  1PVJ A;  3B79 A;  4OEL A;  1PCI A;  2B1M A;  3IEJ A;  5A24 A;  2Y5B A;  5JA7 A;  2DC9 A;  3O1G A;  2R9N A;  3K24 A;  1ICF A;  1VJV A;  4P6G A;  4RNA A;  1AYV A;  2J7Q A;  4BOU A;  4DMY A;  3OF9 A;  1DKI A;  3N3G A;  4YYW A;  4ZTB A;  1YAL A;  2C0Y A;  1F2C A;  2YJC A;  1Q6K A;  1QDQ A;  1GEC E;  4YYU A;  3PRM A;  3B21 A;  1CS8 A;  2FO5 A;  2P7U A;  3I06 A;  1QXP A;  2Y6E A;  4AXL A;  3BPM A;  3N3K A;  2R9O A;  5F02 A;  1PAD A;  2OP3 A;  4QH6 A;  2AGA A;  2H7J A;  5CVN B;  4PAD A;  3S3Q A;  4BOZ A;  2FUD A;  1KHQ A;  1NQC A;  3LXS A;  3TNX A;  2FRA A;  2DCC A;  3P5X A;  4YYV A;  1EWP A;  7PCK A;  3NHE A;  3ZNH A;  2AUZ A;  3BY4 A;  2DJF B;  3N4C A;  3BB7 A;  3DF0 A;  4PP1 A;  4CDF B;  2PAD A;  3BCN A;  4D8I A;  1CJL A;  1CV8 A;  1A6R A;  2NQD B;  1O0E A;  3MOR A;  2IPP B;  3BC3 A;  3KWB X;  2G8E A;  2R6N A;  3HHA A;  3BWK A;  1KHP A;  2HD5 A;  1EWM A;  3H7D A;  3C9E A;  2F7D A;  3H89 A;  3P5W A;  4WA6 A;  4QRV A;  2AYO A;  2OUL A;  2DJG B;  4FIP A;  2FQ9 A;  1ZIV A;  4KLB A;  1AU0 A;  5FPW A;  1ITO A;  1U9X A;  4BS5 A;  3PDF A;  4Q8H A;  1EWO A;  2AU1 A;  4R3D A;  4W4U A;  4CDC B;  4QRG A;  2F1G A;  2ACT A;  4HWY A;  2NQI A;  2BU3 A;  3IOQ A;  2YJ2 A;  5JZE A;  4IP3 A;  3QSD A;  4FK5 A;  2CB5 A;  2DC7 A;  4W5C A;  2PBH A;  4Q8G A;  1UKF A;  4I07 A; 
#chains in the Genus database with same CATH homology
 1AYW A;  3RVV A;  3OVX A;  3D6S A;  3I3T A;  1BP4 A;  3PW3 A;  4AXM A;  1TU6 A;  1MDW A;  2BDL A;  2DCB A;  3K9M A;  3H8B A;  3QT4 A;  4CZW A;  4CDD B;  2CIO A;  1U9W A;  3V6C A;  3PBH A;  1GMY A;  2O6X A;  3KX1 A;  1AIM A;  1GLO A;  3P5V A;  1S4V A;  2G7Y A;  4N8W A;  2YJB A;  2R9M A;  1IWD A;  1ME4 A;  4YVA A;  2B1N A;  2VHS A;  1PE6 A;  4YYQ A;  1DEU A;  3H8C A;  1VSN A;  3RVW A;  3F5V A;  4I05 A;  1MEM A;  2GFO A;  5CVO B;  1TLO A;  1NPZ A;  1YT7 A;  2XU5 A;  2XU1 A;  1AEC A;  2JQF R;  2R9F A;  2HXZ A;  2WBF X;  4X6J A;  2G6D A;  1AU4 A;  1PBH A;  8PCH A;  3MHH A;  3P5U A;  1PPN A;  2PNS A;  2DZY A;  4BS6 A;  1U9V A;  3E1Z B;  2HHN A;  1JQP A;  1YVB A;  3OVZ A;  1BQI A;  1AU3 A;  4N4Z A;  3BPF A;  1AU2 A;  4YV8 A;  1YK7 A;  4MSX A;  5J94 A;  5K16 A;  3CH2 X;  1F29 A;  4CDE B;  2ATO A;  4G54 A;  1NB5 A;  3AI8 A;  2E02 A;  3H6S A;  3LFY A;  1MS6 A;  3HHI A;  2NQA A;  2VHF A;  2R9C A;  4YYR A;  3S3R A;  1XKG A;  1MHW A;  4DMX A;  4XUI A;  2P86 A;  4BGF A;  1MIR A;  1EWL A;  3U8E A;  2PRE A;  2P0R A;  1AYU A;  2YJ8 A;  1F2A A;  4MZS A;  4P6E A;  2NQG A;  5PAD A;  3F75 A;  1POP A;  4QBB A;  1CVZ A;  3OIS A;  3USV A;  3IMA A;  4MZO A;  2AS8 A;  3KW9 A;  3ZUA A;  3HWN A;  3KKU A;  5CVM A;  3IUT A;  1PPD A;  2FT2 A;  3HD3 A;  1PPO A;  1Y08 A;  3CH3 X;  3IHP A;  1KFX L;  1Y4H A;  2DZZ A;  5CHV A;  4OEM A;  1KFU L;  2BSZ A;  2E00 A;  1NLJ A;  2FYE A;  1EF7 A;  2JQG R;  2GHU A;  4QRX A;  4GUZ A;  4YYS A;  2YJ9 A;  9PAP A;  1PIP A;  2ARY A;  3ERV A;  4X6I A;  1F2B A;  2E03 A;  2XU3 A;  2DCA A;  1HUC B;  2XU4 A;  3KWZ A;  1W6F A;  1ATK A;  2FTD A;  4K7C A;  1PXV A;  1CTE A;  4N79 A;  3QJ3 A;  3WXE A;  4ZUX U;  1TL9 A;  4FJC A;  4X6H A;  4BPV A;  5EGW A;  3RVX A;  2AVW A;  1BY8 A;  1QMY A;  1W4T A;  3CBJ A;  1SP4 B;  2IBI A;  2OZ2 A;  1X9Y A;  3WXF A;  2E01 A;  2BDZ A;  1FH0 A;  1CB5 A;  4PP2 E;  3V6E A;  1U9Q X;  1M6D A;  5JH3 A;  4XR7 A;  1K3B B;  3IV2 A;  2FRQ A;  2G8J A;  1U5I A;  4I04 A;  1PPP A;  1MEG A;  3PNR A;  2AYN A;  2AUX A;  1ZCM A;  4BSQ A;  1NB3 A;  1DF0 A;  3GCB A;  1THE A;  1ME3 A;  3KSE A;  6PAD A;  1STF E;  2DC6 A;  4BQV A;  1NL6 A;  3MHS A;  3KFQ A;  1GCB A;  3O0U A;  3WXG A;  4W5B A;  1YK8 A;  3M99 A;  4PI3 A;  4RY2 A;  1CSB B;  1CPJ A;  2AIM A;  2DC8 A;  2DCD A;  1KXR A;  5CHT A;  1SNK A;  3K8U A;  1CQD A;  1QOL A;  1BGO A;  3BOW A;  2HH5 A;  3MTN A;  3OF8 A;  5EF4 A;  3CBK A;  3B79 A;  4OEL A;  1PCI A;  2B1M A;  3IEJ A;  5A24 A;  4C5P A;  2Y5B A;  5JA7 A;  2DC9 A;  3O1G A;  2R9N A;  3K24 A;  1ICF A;  1VJV A;  4P6G A;  1AYV A;  4DMY A;  3OF9 A;  3N3G A;  4YYW A;  1YAL A;  2C0Y A;  1F2C A;  2YJC A;  1Q6K A;  1QDQ A;  1GEC E;  4YYU A;  1CS8 A;  2FO5 A;  2P7U A;  3I06 A;  1QXP A;  2Y6E A;  4AXL A;  3BPM A;  1W5R A;  3N3K A;  2R9O A;  5F02 A;  1PAD A;  2OP3 A;  4QH6 A;  2H7J A;  5CVN B;  4PAD A;  3S3Q A;  2FUD A;  1KHQ A;  1NQC A;  3LXS A;  3TNX A;  2FRA A;  4B55 A;  2DCC A;  3P5X A;  4YYV A;  3LTW A;  1EWP A;  7PCK A;  3NHE A;  1GX3 A;  2AUZ A;  2DJF B;  3N4C A;  3DF0 A;  4PP1 A;  4CDF B;  2PAD A;  3BCN A;  1CJL A;  1CV8 A;  1A6R A;  2NQD B;  4NV8 A;  1O0E A;  3MOR A;  3D9W A;  2IPP B;  3BC3 A;  3KWB X;  1E2T A;  2G8E A;  2R6N A;  3HHA A;  3BWK A;  1KHP A;  2HD5 A;  1EWM A;  3H7D A;  3C9E A;  2F7D A;  3H89 A;  3P5W A;  4WA6 A;  4QRV A;  2AYO A;  2OUL A;  2DJG B;  4FIP A;  2VFB A;  2FQ9 A;  1ZIV A;  4KLB A;  1AU0 A;  4NV7 A;  5FPW A;  1ITO A;  1U9X A;  4BS5 A;  3PDF A;  4Q8H A;  1EWO A;  2AU1 A;  4W4U A;  4CDC B;  4QRG A;  2F1G A;  2ACT A;  4HWY A;  2NQI A;  3IOQ A;  2YJ2 A;  3QSD A;  4FK5 A;  2CB5 A;  2DC7 A;  4W5C A;  2PBH A;  4Q8G A;  2VFC A;  4I07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...