4REZA

Crystal structure of the middle-east respiratory syndrome coronavirus papain-like protease
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
320
structure length
311
Chain Sequence
TIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTAPDFVAFNVFQGGHYVHARLKLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSDCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Middle East Respiratory Syndrome Coronavirus (MERS-CoV) Papain-like Protease Bound to Ubiquitin Facilitates Targeted Disruption of Deubiquitinating Activity to Demonstrate Its Role in Innate Immune Suppression.
pubmed doi rcsb
source organism Human betacoronavirus 2c jordan-n3/2012
molecule tags Viral protein
molecule keywords ORF1ab protein
total genus 79
structure length 311
sequence length 320
ec nomenclature
pdb deposition date 2014-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4rezA02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rezA01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4rezA03
2FE8A 4M0WA 4MM3B 4OW0A 4P16A 4PT5A 4R3DA 4RF0A 3MP2A 4REZA 5KO3A 3E9SA 3MJ5A 4WURA 5E6JA 4RF1A 4OVZA 4OVZB 4RNAA
chains in the Genus database with same CATH superfamily
1PQSA 3BZDB 4C80A 1FM0D 4LGYA 3GQ3A 2KMMA 3GRVA 2KANA 2R18A 3AV0A 1WGGA 2W9NA 3I9V1 4IWQA 3RNGC 1ZOYB 4KT0F 4QOSA 3PV1A 1QOBA 2CB5A 1Q3BA 2NTSA 4GDKA 3CH2X 3MHVC 2DAIA 5FPWA 4S0RA 3TBLD 3RNAC 2AYNA 1ZMVA 1BT0A 3RMKC 5GXGB 1WF9A 1A5RA 3DOAA 1CVZA 1KFYB 1D0LA 4NNJB 2ZPYA 2Z0EB 2UU7A 2VZKD 2ASQA 4YHHM 4NRWA 2I7PA 4I8OA 4TUUA 1L6UA 2K8BA 2KAJA 2HWKA 1ITOA 1TU6A 5CVMA 2KDMA 3GQ4A 4C4VB 2JQFR 3HGIA 5EXXA 2NS5A 1E0ZA 1DOIA 3DVNU 2EMSA 3AE5B 3U60A 3N3KB 3PPAA 2BDLA 4JI1M 2ACZB 1V6EA 1I4GA 2WDQB 4YSXB 3IV2A 1DOXA 2C7NB 4QHTA 3TE6A 5BMIA 3HIZA 3P4RB 2LXAA 2JY5A 2N9LA 4HXDA 1PJTA 2J0JA 4IW0A 2NPTB 4KSKC 4GITA 5ITQA 2CHQA 3V6EA 2M1MA 2BTWA 1DKIA 2DBYA 5BMGA 2XU5A 2LJ5A 3EECA 3NJTA 5BYSA 1G59A 4YV8A 3U6PA 4JI5M 3I06A 2KMAA 1F2RI 4AZFA 2FBWB 2M19A 5IZ7D 3T6PA 1ISNA 4G4QA 4BOPA 2Q5WD 2JA2A 2FE8A 4W9LA 2R0IA 3QIJA 2MP2A 4IIWA 4GKJM 2OOBA 1KM7A 1PGXA 4EEWA 1XKGA 2C60A 3QWZB 4IG7B 3U6SA 3GE8C 3Q3OC 1V33A 3PGEA 3PREA 1LFDA 3PRPB 2DCDA 4M9SA 2FT2A 2O5RA 3WAPA 4P6GA 3MHZA 2JXXA 1F2AA 1NHGC 4UN2B 4WWOA 3W0LB 2BU3A 2C9OA 1XXHB 2DLBA 1B9RA 2DC9A 4KIKB 2Y5CA 4LZJA 3ZLZA 3H89A 4M9XA 4I6NB 2E02A 1TY0A 2BF8B 1WGLA 2WXQA 1NB3A 2WNMA 3UGJA 2DI0A 5E6JA 1K82A 1AWDA 1ACCA 3KLSX 4X65M 3SARA 1LGRA 3MC8A 3P63A 4FIPA 2LGSA 3KWZA 3WA0A 1J0GA 4W5WA 1GG3A 2ZTCA 5EQTA 4X64M 2LGDA 2IGGA 3BK2A 2JWZA 1NY6A 5G5HA 1MEGA 2VQEM 3CH3X 1UELA 1EWYC 4DUYM 2KMCA 1J09A 3GRRA 2R61A 3A9KB 4HL4A 3DBSA 2D3GA 2DWQA 3CBKA 3UQBA 2LVOA 3IUTA 4W5CA 1KOTA 1WI0A 2QQ8A 1AYFA 3Q14C 5BYQA 4HEA1 4MJSB 4OZBA 1ZXIA 3RULA 1DO0A 4OW0A 3WALA 2ACTA 1E8ZA 4HROA 2VF7A 2K5PA 3A46A 2KRKA 2K39A 3MORA 3DFZA 1GUAB 2QILA 1ZKHA 2XSZD 3ALBA 4BBNF 2J7QB 1TBEA 4ANVA 2MJEA 2XF3A 4NAWB 3CGWA 4GB9A 1WMHB 1RYJA 3C0RB 3GO8A 1XO3A 1C4PA 4C00A 1XXGA 4FXCA 3S3QA 3TWMA 4MH0E 3ZNHB 2FS1A 3HX3A 3OTOM 3IFWB 1F2BA 4XK8F 1FH0A 2FCQA 2KFJA 2V3SA 3VK8A 1XB2B 1NDDA 4I6PA 2BS3B 1GO5A 1DGBA 4GH9A 4DMYA 3CSFA 3B2FA 4PP1A 5KPRA 1V86A 4I81A 2HD5A 2Y5PA 4XUIA 2LNHC 3ENEA 3MHSA 4DXFA 5FSWA 3C0RA 4NRVA 1P7EA 3FUWA 5C18A 1WWTA 2AL6A 3HHZA 4GC5A 3JSVB 2KACA 3TL5A 3FUTA 4D82A 3O65A 1IQPA 3F75A 2JYEA 2DZOB 1V5TA 2KD0A 1L2DA 3GP7A 1ORYB 1QVRA 2V0GA 2NQAA 2JP7A 3N32A 1N34M 4HCPB 4PI3A 1Q10A 2LXCA 1QOGA 1IBLM 3KX1A 1TH4A 3EIHA 4USAA 1WXVA 4IM3A 2AL3A 2DZIA 3MC0B 3AL0C 2DNAA 3APFA 4IJEA 4G6ZA 2I7NA 3KW6A 4MGYE 1N78A 3DBHB 2PE9A 1XXHA 1L4ZB 3GB1A 3I01M 2WSCF 4MEMA 1O0EA 5EP4A 1FO4A 1Y4HA 1JWAD 1QANA 3GLHB 3T8MA 4TUWA 4W9IA 2LVOC 3IG5A 2BBCA 3KWLA 2VHSA 3VTVA 4ZPXA 3EC8A 2MQJA 2W82A 2VIIA 2CHGA 2NQ8C 1D5ZC 5KQ8A 2RR9A 2Z4SA 2HTHA 3VR9B 2NR2A 1P3QQ 4GDLB 4GOCA 1NY5A 2XU4A 4I6LB 4BOUA 3QA8A 5KQDA 2DYBA 4P6EA 3KVWA 3RCZA 4IM0A 1K3XA 1SXJA 1EWCA 2ZVOA 1UD7A 4X57B 1YD8U 4ZHPA 5EE1A 4IBDA 3A4SC 4D2KA 2RDGA 2V3PA 1WE7A 2BTWB 4LTUA 3J27B 3GLFB 1BXTA 1U9WA 2O6VB 4BQVA 2V4IB 4WW0A 4OVUA 2BYEA 1ESFA 1EUVB 2KN4A 2GHUA 2AYOA 4RM9A 1BQIA 8CATA 3U60B 3A1QA 4ZHOA 1DGJA 1G3IA 1V9JA 1P7FA 4NOOB 4DXGA 5EZQA 2R9OA 5BO4B 3W2DA 2YVCA 3RE8A 2INDC 4LJ5A 4BKTA 4BVUC 1ENFA 1ZXHA 2IPPB 1I4WA 1QXPA 3HY5A 2HHHM 3ILKA 1RM6C 4AUQC 4HLQA 2EUCA 4L1BA 1XMQM 4IC7B 4EOYA 4ASWC 2F5NA 2BYFA 1VCBA 5J17A 1QDQA 1IXSA 3PHWB 3V6CB 3KXEC 1MHWA 2AQ1B 2LASA 1N77A 1HT2E 3AEAB 4DV1M 3M3JA 1VSNA 3TJPA 1OJLA 1V92A 2Z59B 3BYYB 4K3CA 4LJOB 1ME3A 4QOZC 3L13A 2QHOB 2LVQA 3GP1A 3SAUA 2WXKA 3TRKA 2VF8A 1T43A 3DZDA 1WXSA 2K6DB 1Z6TA 3DHHC 2DCCA 7PCKA 1XXHE 3NZ3A 4H2AA 3TPZA 1OEYA 1AYWA 4G4RA 1N63A 2WXNA 3RNEC 3PLUA 4YYUA 1V80A 1VDDA 2G3QA 4Z6YA 1JQ4A 1EO6A 1GVNA 1STEA 3KWBX 2NBVB 3OG5A 1QAQA 3U6MA 5E26A 4LJ9A 3Q8AA 2C9WB 3NVZA 2F4VM 2B76B 1SP4B 3I3TA 2PNSA 2RPVA 4AP4C 1N5WA 1L2NA 1IBXA 4N6EB 2KNZA 1V1PB 5E6OA 2BDZA 3SD5A 1Z5SB 1DF0A 1YX5B 2K22A 4HPLB 2LHDA 1FNUA 4WJOA 3VR8B 1C9FA 3J7BA 2Y0QA 3GPYA 1LQBA 4IBBA 4WAFA 2WSFF 1TDZA 2CV0A 2KLCA 2DENA 4AG6A 1V97A 1I7HA 2VZKB 1L7YA 1I35A 3ONSA 1HUCB 2D5GA 3QCAA 4F2LA 3M95A 3KOYE 4B7HA 2BWBA 4KZCA 2B1NA 3LVVA 1VZ8A 2MBHA 4XR7A 3U8EA 1QQWA 2WXJA 1Z2MA 2L7RA 4MZSA 4YTMB 1AU0A 3P5UA 1EU3A 2ZW1A 2WU5B 4YWGG 4B3SM 1PPDA 3C58A 1EF1A 3R9XB 2PVGC 2K8CA 4KZ0A 1FXTB 5D3IB 4HDQA 1PADA 3SATA 4KKJA 3MJWA 1SXJD 3E1ZB 1L2BA 1L1ZA 1QQRA 5EJCA 1PGBA 5DNYA 4K81A 2D7GA 1YNTE 1RU3A 5KPTA 4XZXA 2HXZA 3VVWB 3A33B 1IY0A 3F92A 3QX1A 1E5WA 1V8CA 4P1BC 4LRSA 1V5OA 1J8CA 2DX5B 4GC9A 4LDTD 4NJ7A 5AUIA 1MVKA 1H8CA 1GLOA 2R6NA 1C79A 3P4SB 3TMPA 1FCCC 2L83A 1PYWD 5FTJA 1TF0B 1RFAA 5JI2E 5CHTA 4BBNC 3AECB 2FH0A 3K9OB 4DV3M 1LM8B 4HWIB 2DCAA 2ZAMA 1VQ1A 2UZJA 3L27A 3PLVA 2OZ2A 4NY0A 2KNBA 1TTNA 4MT5A 4OZCA 2XZUA 2E01A 1NEKB 2K0PA 3HHXA 2NQGA 1NB5A 2NTTA 2YEPB 1CZPA 1I4HA 3AE2B 2DAGA 1WM3A 5C3JB 3E9SA 3ZH9B 2I1JA 1QMYA 1K3BB 2I38A 1NYRA 2QCUA 2WHIA 5DCNA 1YT7A 3FKEA 3HU1A 1CV8A 2M4NA 1F77A 2JT4B 3GLHE 3RVWA 3KS4A 3K2LA 2YJ9A 5ITUA 1XMOM 2ZPNA 2M60A 2L3ZA 1FNWA 2KNAA 1XHBA 5A2QS 4EKUA 1R7RA 4LCBA 2CHWA 1OQYA 2AHMA 2L1AA 4TKNA 5L83A 3ZDTA 3SU8X 4JGHB 1WJ7A 5DYIA 1QT9A 1JRUA 4PS3A 1MIRA 2UXDM 2KOXA 1IY2A 1MHXA 3LFYA 2LUMA 4L16A 2JWUA 4ANXA 3RNCC 4N79A 2MJ3A 3V76A 3RGSA 2C7HA 2LVPA 2DHYA 4CO7A 2G45B 2WXGA 2Y5BA 4FN2A 3GLFE 3B08A 4XZ4A 4I5SA 2WZJA 1RWSA 2MH7A 4J6IA 2CU1A 4P1CC 1WYWB 3N3GA 4LJ8A 4BB9A 2PVOD 4Q8GA 2IJ0A 2F5OA 5CX3A 1J7KA 4RKUF 3W1SA 4FD2A 4LY6A 2W55A 3BWKA 1N75A 2Y6EA 5ITRA 3P4PB 3VXWA 2K6QA 1UBQA 3IAM1 2MBEA 4C7ZA 3AEEB 3X23A 4GIVA 1E9SA 1KLVA 1AARA 4FHKA 4IBEA 4DR1M 2JPHA 1G4AE 4GLSC 4MSMB 1CS8A 4GHAA 2FIFA 4NPNA 2DOSA 2MW5A 1J7BA 4CJ6A 5G2NA 3ERVA 3TCAA 3A98B 4BLCA 2ERCA 2XK5B 2G3QB 3IG3A 1YSYA 2MCNB 3KKUA 4M00A 4DHJD 4HPPA 4LK0M 4JXJA 1F52A 5BR8M 1IGDA 2WXIA 2A4ZA 4QBBA 3P5VA 1P98A 5H37D 4B0EA 3PXGA 4LJAA 1WR6E 2IY0B 3KSJA 3W31A 3I63C 1D0KA 3T3OA 2BS2B 4ITKA 4M9ZA 2L8JA 1L0YB 2EELA 2N7DA 2CP8A 2ZM6M 2ZNVC 4IJFA 3BYTB 4JPSA 2QBYB 2QC8A 2OPFA 3JR5A 4W9GA 2N7EA 3ML8A 3AI5A 4LLGM 1JQJC 2HJ8A 2FTDA 4YYVA 3V6CA 4RNAA 3HVZA 1IXSB 2J0MA 2K47A 3FYCA 4WQMA 3K8UA 3PHWA 2JY7A 4PDGA 2INCC 3GLFA 1FMAD 4KLBA 2XN9C 3H7DA 3RYTA 3BWUD 4FJVB 4G4NA 2N35A 2NPTA 2WXHA 1FPYA 2KNVA 3HZJA 3HHWA 3WXFA 4DV6M 2ATOA 3A9JB 3GS2A 4GDLA 4ZTBA 1AUAA 2IYDB 2QMTA 1QOLA 1YVBA 4YVAA 1OIPA 1CQVA 1VEKA 3FYDA 2C7MB 1HTOA 3MFGA 4K7CA 1R6BX 1TDHA 3FTDA 3GLHA 1AW7A 2HTME 2MX2A 3O13A 3QJZA 1T6BX 3FUVA 3AI8A 3C9PA 1ME4A 2HWJA 2HH5A 1SXTA 3KYDD 1V81A 3VKHA 3VHTC 3MHHA 3NHEA 2MJ5B 3AEDB 2SEBD 1DO2A 3GQ5A 3KSEA 3W68A 2ZAOA 5C1BA 1P0RA 4LF5M 3W30A 4A3VB 5J2RA 1ET6A 5LMUM 4LDTB 2AU1A 2CFOA 3L28A 3LB8C 4M8MA 4K1RB 1HNZM 2E5LM 1EF5A 4W9DA 3JSVA 3UIOB 2LMCA 3VTWA 4GGQA 1D5XC 3AEFB 3ZNID 1KLUD 1EWMA 4OZAA 3VUWA 4L6V6 1TR8A 2HD5B 3NS8A 4M02A 3PVSA 2ZW0A 3CF6E 2JZ0A 1F2CA 1QOFA 1JR3E 1FXAA 2ZTDA 3V61A 5AEKB 2LI5A 2XU3A 4YXDB 4FCTA 1GABA 4GIPA 3CSTA 1YZBA 3C9EA 3L17A 3KP0E 1ZQ9A 2Y21A 3SFDB 3KDSE 3M0EA 4L2YA 1IN4A 1PE6A 2JU6X 4WJNA 2JUJA 5KHOA 3R2TA 4ARIA 2REXA 2DYMA 2ICIA 5FR6A 3BPMA 2KW0A 4URKA 2HJ1A 3QYBA 1YN3A 4OEMA 4DHZE 4IBFA 2QIEB 2J7QA 4AXLA 5JZEB 4IKGA 2YR0A 1WX7A 4F1SA 3RZFA 6PADA 3UJNA 2GRIA 3JAMS 4I04A 1Z5CA 2XSZA 4LZZA 1WZ0A 4HWYA 2JY8A 2HHNA 5EDSA 2DWNA 1PPPA 3VQIA 4DV0M 4MJSA 1IUEA 2JWSA 4B3RM 4G50A 4MGKE 2ZBKB 3UI3A 1HNXM 4JI8M 5JZEA 3RPFC 1ZV1A 2G9HD 4RKXA 4LJ6A 3RZWC 4HPMB 4XGAB 2JX5A 1GAQB 1E94E 3H7PA 3QAUA 2RDHA 3DBLB 1A70A 3HWNA 1R2YA 2KFKA 3KFQA 4HKZE 4DMXA 4FW9A 2WS3B 3I04M 3K9OA 2LXEA 3C3DA 2DXIA 4ICVA 3TEWA 1JWMD 1TGUA 5D6JB 2WXFA 3DBRI 3MHSD 4FHJA 5EF4A 1IFYA 2DCBA 4M0WB 1K8RB 2LUEA 5A24A 1MG4A 3IHPA 4R7GA 3ZXRA 2Z8LA 1QAOA 4J3OD 3PW3A 2HKJA 1WRIA 1GKIA 2UYZB 1KH0A 3FUUA 1WXMA 4W9EA 2AIMA 2KJ6A 4LF9M 1K3WA 3SASA 4GKKM 1HXYD 3A42A 1S4VA 1SGHA 3PO0A 2G8EA 4DV2M 2KTFA 4FJZA 1GECE 2WDRB 2IGDA 2IO2B 3GE3C 1J5EM 3T3NA 2WXOA 3ZUAA 3ZNZB 4DHZB 2C98A 5EE3A 4IUMA 4CYEA 4KKIA 1KTKA 3PFIA 1TKEA 2YQZA 1D2NA 2GOWA 2DC8A 2HE7A 2V1YA 3T38A 2X38A 3PRPA 1ZP0B 1UNSA 1LTMA 4JL9A 2JXTA 3SYLA 3ZGZA 2Z84A 4F1IA 2DWZB 4CISA 2IO1B 1KJTA 3KQ4A 1TYGB 1XWIA 5ITXA 3I51A 4JYAM 1MJGM 2CU3A 4GUAA 1WJ6A 4AQ7A 3VDPA 4DXAB 1AECA 5HI1A 3R7QA 4XX5A 4BOZB 1FEHA 3KUZA 4XWTA 1JRPA 1PJSA 2CHVA 1M94A 1MS6A 4YYRA 4NJCA 1DGFA 4GEWA 4G3OA 3RUIB 3WCQA 3CBJA 2NQIA 3DPDA 3JW0X 2LJIA 4G4OA 3ZC7B 1UF0A 1WGYA 4IWOA 4NXNM 3ZVVA 2AS8A 5MPOA 2DWMA 3CF2A 5CHVC 3AOGA 1GPXA 4PP2E 2K9DA 3GPPA 1UUPA 1GB4A 4LF7M 4NC6A 4GDKB 3JVZX 2KX0A 2LRWA 2N0SB 4LCDE 3MTVA 4A6QA 4C4VA 3HJSA 1JALA 4RGNA 2KDIA 1D0MA 2F1GA 2R2QA 3CMMB 2MA9B 1Q6KA 2JUOA 3U7DA 4RGTA 3UINB 4LNKA 3ECIA 5G55A 2GFOA 4RF1A 2R9CA 1G41A 1LO5D 2AVWA 2FO5A 3K1JA 4K0KM 4ZDVA 2C5RA 3Q3FA 3SDLC 4LFCM 2ZJDA 1EWLA 2A5UA 2IGHA 2L76A 2KQ7A 3SAVA 2N9KA 2OO9A 1TIFA 4OVZA 2MBQA 5JI3E 4ZRKA 4JE3B 2JY6B 3U30A 1TGZB 4WAAA 5JH5C 3AE7B 2L2DA 3LCVB 3PRMB 2JRIA 4LF8M 3KVFB 3W0FA 1XNRM 2KTRB 3DOWA 2XGNA 2IBIA 1PDXA 1YX6B 2N9XA 3QARA 3AKZA 2L00B 1NV8A 1T5XD 1Q1OA 2V3NA 3FAHA 2LVNC 2PBHA 4KHPM 1ZUD2 3VFDA 3W1SC 2E3TA 1QZEA 5D3DA 3E56A 2PE6B 4DR6M 3HUIA 3ZJUA 4EUTA 2DAMA 4OHJA 1ZCMA 1XC8A 3BY4A 1ET9A 2XFTA 3IMAA 1GOZA 5EXTA 4AJWA 3VUYA 3ZNHA 3E21A 2EO2A 2MRPA 1BY8A 3GOEA 3H9DA 5HKHA 4DDID 4CGYB 1E7UA 4FCVA 2DJGB 3U61B 4CDDB 2D10A 4MH8A 2WP9B 4WQOB 4YTNB 5AZFA 2N9EB 3U52E 2KHWB 3BXWA 3OVXA 4DWFA 4BFRA 5FTNA 1I94M 2KC1A 1SJED 1YJJA 1JR3A 2JNHA 1Y08A 3AEGB 4WH4A 5JH3A 2NCNA 5EP2A 1X9YA 3UZUA 3LJ3A 2D7EA 1HQRD 2UUBM 4RGMA 5JHBA 1TTEA 4YYQA 3P5XA 4MGHA 2V1UA 1MJDA 1SIJA 2L32A 2JVCA 2N1WA 3N1ZC 4RMAA 4GHLA 3L2AA 1T0YA 2D3BA 3LXSA 5AUKA 2DZLA 2WX0A 1VEGA 2QEJC 3HU3A 2RRUA 1VG5A 3GLIB 1EWOA 1CK1A 3U61A 1N5XA 2R9FA 3PSEB 4KO8A 1VZ6A 3ZYYX 3SMPA 3TEYA 2UU9M 1UKFA 2L05A 2FUDA 1G8PA 3L54A 4DR5M 3R7RA 2ARYA 2E6XA 2FRQA 5EXSA 1D5MC 1E7PB 2EMTA 4B3TM 1PJIA 4MB7A 4WJQA 1KFXL 2DZMA 4YT0B 2KXJA 4MGZE 2FRAA 2RGFA 1NJGA 4LNFA 4RY2A 1GMYA 2WXPA 3WAOA 4DR4M 1MFWA 4WA6A 2CRUA 2IBIB 2H89B 1HT1E 4C7YA 2DAEA 1S3SG 4TQ0A 1WXAA 5LLIA 4NAWA 1EFUB 1E9MA 3AE1B 1V1PA 2DWLA 1HNWM 3U4EG 2P5TA 2R9NA 1SE3A 1WFYA 2FCSA 1CPJA 5CVNB 3UK6A 1KYIA 3OJ3A 4IP3A 4PCZA 4OVZB 1Q0WB 3R3MA 5D94A 2FUHB 4BAXA 2X4AA 5IN7A 1IY1A 4IBCA 4PYUA 5TR5A 2KJRA 4B6WA 4DR3M 3BOSA 4ACFA 4W9CA 1HZ6A 2J7OA 4II2B 4AOFA 1CUKA 1RFKA 4XDCA 3RT3B 1L1TA 3LYYA 2X49A 1WRDB 2VHFA 4D8EA 1K50A 1HZ5A 1QDTA 2OP3A 3BBAA 1TS5A 1STFE 3PRZA 1TLOA 2FCNA 5AZGA 1A5TA 1UZXB 5L95C 5LMNM 2K1FA 4ZUXU 2L09A 1OAOC 4CQNA 4R3DA 2GBJA 5IWAM 2I1KA 3OISA 4GMVA 3J81S 3ZW3A 3BK1A 1TKYA 1SE2A 3DVGY 4AXMA 2E03A 2YJ2A 1WY8A 2LGYA 2DZZA 1DV0A 4B9KA 1WH3A 4ZRQA 4EFOA 4S17A 3NVWA 1KFUL 3ZNGC 4NSOB 2C9CA 2KWVB 4REZA 2J53A 4HLEA 4KIKA 3FRHA 2QCZA 3B89A 4RH6A 4F8CB 3TIXA 4AKHA 3N1XC 2MHJA 3V05A 3ZQJA 1PPOA 3QWLA 2IZVB 4WWNA 2L0TA 4Q7JA 1IM2A 1T3TA 3TQSA 1P3QU 3KW5B 4KDLB 1NO1A 1AIPC 3RFZB 3K24A 1C3TA 4G3XB 4YYSA 2AWTA 1TL9A 1WIVA 1XLQA 1WXQA 4IBJA 4JIOU 4LJ4A 3AXCA 1JR3D 2D07B 3URYA 1AYVA 4FWDA 1MEMA 3V60A 4ANUA 2CJNA 2BS4B 3DF0A 1AU3A 1NBFC 1QDRA 1EF7A 1UH6A 3LXFA 3M63B 3Q3NC 2WXLA 4GU2A 4XDDA 1GJZA 1K53A 4DBGA 2P86A 4ANWA 3K9MA 4OVVA 3B9JA 2Q2EB 3HHMA 4GMQA 1S3SA 1Y8GA 3K8ZA 2F5PA 3Q8GA 5IP4D 3HM3A 5DPTA 3EHVA 1IYFA 2P0RA 1CSBB 1WR1B 4BOQA 4D80A 1YLAA 5KHQA 1R7SA 3H8CA 4JI4M 3B79A 3U6EA 1JROA 2MSED 3NZUA 2RD0A 1KHQA 4Q2JA 1XLNA 1YIWA 4JI7M 3I4VA 4P6VF 3VDUA 1IN7A 2QP9X 2J52A 1UBIA 4L23A 5K16A 2CV2A 1ZGUB 2O2VA 3ZUNA 4IUMB 1ICFA 3O0UA 4BBAA 4JI3M 1PXVA 1GL6A 3DBRB 4LJPB 3AN1A 1N60A 3RNVA 2MWSB 4TQ1A 1DOYA 3AE8B 2EKFA 2BJWA 1FD6A 3KUCB 1F9JA 1PM5A 3DHGC 5C1ZA 1VJKA 2APLA 2BWES 3QAQA 3OLMD 1PJQA 4LNNA 1TS4A 1E32A 1FNVA 4P17A 3DA1A 1JWUD 3APDA 2LHGA 2VQFM 3TMPB 1WJ4A 2O6VD 2R4EA 2G4SA 2K3UA 5J94A 4HJGE 2EKEC 3NZSA 3GLIE 3B7ZA 2KFKB 4KGSA 1G71A 3CIRB 3Q3MC 2QJLA 3S2AA 2G8JA 3RVXA 3EGRA 4LF6M 4E74A 1POPA 1GJTA 1WZ3A 3C8YA 3NBIA 2PADA 4GSWA 4M0DA 1N6ZA 2INPE 1YALA 2Z3XA 2WLBA 2VH2A 3J80S 1JWSD 3DBLI 1DGHA 5IA7A 1N33M 4A3PA 5HG2A 4QRXA 3KYCD 4LJ7A 1EE8A 1SIFA 1XT9B 5JA7A 4A90A 1DGHB 4HKQA 1KLGD 4FJCA 1XCTL 3ZTDA 3Q69A 2AX5A 1IN5A 2KJHB 3T1HM 3VRAB 1C78A 1MI0A 2KO3A 5GKNA 1VEJA 2ZZPB 5LXIB 2HDEA 2KWDA 1FRDA 3Q8XA 3SAWA 3PSEA 1J7CA 1AN8A 2WU2B 1HTQA 1R5LA 2AEHA 1SE9A 3H8BA 3DBHI 3IBEA 1IBXB 2JY6A 3U6QA 3S3RA 3NWLA 5CHVA 1TH2A 2LD9A 1C1YB 3L29A 2XU1A 2K6BA 4NZLB 1TH3A 2M8SA 3A45A 5IKCM 3DVNV 3MTNA 1C4AA 3AV8A 1BVSA 2Z8YM 5CHFA 3U2SC 3W5UB 3GLGA 1Q39A 3N1YC 1L5PA 1I4RA 5FKAC 2J5YA 4NXMM 3M62B 5JHAA 3ETRA 4N8WA 3KP1E 1QLBB 2AQ2B 2DAFA 3PT2A 2BWEA 1QOAA 1UGJA 2XEPA 2N4FA 2LVAA 2PEAA 3IOQA 1MG8A 3OVZA 1WGDA 1WR1A 4JQWC 3OF9A 3QT4A 2JRHA 5F3WA 2F5SA 4II7A 1AU2A 3QHTA 2UUCM 3QC8B 1RRBA 4MI7A 1E10A 4A55A 2JF5A 1E7VA 1YJIA 3ZJTA 3W5VB 3PZ8A 4DR2M 1YJ1A 2O2VB 4E3CA 4I4LA 2KRUA 1ZDXA 1L0VB 3IT4B 4P7IA 4E71A 4QHSA 4PD2A 3ML9A 2V6ZM 1YE9A 4N59A 3PHXB 4DQOC 4EE2A 3HKPA 2MGWA 2O25A 4PDIA 1NNUC 2RKOA 3BC3A 4X6JA 4ICUA 2GBKA 4ZRIA 1SE4A 2KTRA 2ZVNA 1FNNA 3H1UA 3N3KA 4K7SA 4HVBA 2WX1A 3CF0A 1E8XA 2UWQA 5LNK1 3GZNI 2CS4A 1T0RC 2ZEQA 4KGRA 2Y0TA 4XBOA 1V1OA 3IHPC 3OJ4B 5H92C 3AU5A 4RFBA 3EFUA 5IREB 2O6VA 3I3TB 3VDZA 3P2BA 3ZJVA 3PHXA 5FTKA 1GB1A 1P9DU 4KV2A 4L4UA 1U9XA 1IN8A 1Z5BA 3BVMA 3MP9A 3V6EB 4LNOA 4JN6A 3SHQA 1AU4A 1TY2A 2W54A 3NS1A 1F1HA 3AMZA 2GMIC 3VRBB 2V4LA 2QZ4A 2DHRA 4A8XC 2RMMA 4FA6A 4BSQA 3PBHA 1FRRA 4L15A 4IBKA 1YMHE 3JYUA 2R44A 1PUTA 2YLMA 2L7IA 2J0KA 4L78A 5BMHA 1R2ZA 4TMAB 2V9HA 1ZMUA 3HK0A 2OJRA 2GBNA 1E90A 4MSQB 4BOSC 3VAWA 2AGAA 2JZ3B 1LXDA 4B0MA 3FILA 3K92A 4WURA 4KX6B 5GMVA 2P7UA 1Z5AA 3H4JA 1PBHA 1D4BA 1NSFA 1QF6A 3ZDMC 3LW5F 2PLPA 4K7UA 1A6RA 3IEJA 1KSFX 1EIJA 1OQRA 2M17A 2NBUA 1KRHA 2OEDA 3OQCA 1NL6A 2WXRA 3DQVA 2J7QC 5HHDG 5J18A 2EA0A 3TL4X 4JI2M 1CJLA 2WXMA 2V1CA 2QSDA 3L26A 2GBRA 3N30A 3ABVB 2FNAA 2FNJB 3BIID 3IT6B 3B0AA 4EZJA 1FIQA 4JLCA 4M01A 2L52A 4NL4H 4W9FA 2JXNA 3SEBA 2DAKA 2B3TA 5EGWA 2Z4RA 2RGOA 4AKIA 1EM7A 2YJCA 2CIOA 4LFAM 3IG8A 5ITXE 2ZNVB 2EKIA 4JWSC 2LEKA 2G7YA 2KEBA 1AIMA 2H88B 4EZKA 1C77A 3SMSA 3HHYA 4CHTB 1CB5A 4JI0M 1L8QA 4GRIA 1FFVA 3TEZA 5D2MB 3CTWB 2Y5BB 1GNUA 3PNYA 2QPAA 4DDGD 2M0XA 4NAMA 4D81A 2BWFA 4A3OA 1JB0F 3PNRA 4YY3M 1G6JA 3FTEA 1L2CA 3L10B 5C23A 1ROEA 8PCHA 2LGXA 5TSSA 2XH9A 2FFJA 2KDBA 3K9PA 2KYWA 7CATA 2BW2A 3KSXA 4BKSD 1Q02A 4QH6A 2B3AA 1T0QC 3W9CB 4WIPA 3MP2A 5DPWA 2LGIA 1Q3CA 3Q8EA 1WYGA 1WGRA 5E6PA 4MELA 1K52A 3SR6A 1E8WA 1H4RA 3HHAA 2C96A 3IECA 2EKKA 4MM3B 4RF0A 1YN4A 2BB5A 2ZCBA 3L08A 3P42A 4F7ZA 1NPZA 3KOWE 4BPVA 2KDEB 2IO0B 3K9PB 4OU7A 4MACA 3BCNA 3H7PB 3IFUA 2HL7A 3LVWA 1CMXB 3THGA 3IXSA 1FFUA 3KW9A 3NUHB 3ZO5B 1NI3A 3HVDA 3L25A 4FCWA 4XC2A 2ONQA 1QAMA 3M7GA 1I4PA 4BKGA 4Z8XA 4KVGB 3D8BA 1TT5B 3NHEB 1NQCA 1PGYA 4ARCA 1N32M 3BY4B 2J42A 1YQ3B 2AUXA 4W5BA 3ZCBB 2M56B 2G4DB 3KUDB 3H6NA 2L0FA 3AOEA 1P1AA 1HQCA 2MBOA 4C56C 4FWHA 2BPSA 2L7HA 1PGAA 4Y28F 4IDIA 1JQPA 1TJEA 3AB5A 1ZDVA 2KDFB 3PS6A 4GXBA 4YYWA 2R6FA 2MP2B 3HJQA 3GPUA 4LF4M 3HD3A 4WWPA 4HEOA 4X6IA 3C19A 4M8NA 1SBBB 2WWZA 4KSLC 2KWCA 3MMPA 1WJNA 2DC6A 3PDFA 3DVGX 1C4CA 1YQBA 2CWBA 1BGOA 3RGPA 4DBGB 1PCIA 4EZLA 2I2YA 3VH3B 2XEWA 3UQAA 3ZKJC 4HXDB 3O1GA 3VTUA 1VZ7A 2PTLA 2Y20A 3W1YA 5FTMA 3SFEB 3W67A 2D7HA 2N9PC 5BPVA 3FTCA 4KDIC 3HWSA 4D8IA 1HA5A 1NVID 1QZMA 2R62A 4FLHA 2YFQA 2CUZA 1OFIA 4B7FA 3J9CA 1E6EB 3TWLA 1S1QB 4QNMA 2DZNB 1W5SA 1U4AA 3M99A 4AKGA 3AULA 3HU2A 5LXHA 2FYEA 3AEBB 4XGIA 5EE9A 3R2IA 4HCNB 1BMLC 3N9YC 1UWXA 2KT7A 2YNMD 3N20C 4NJ6A 3U8ZA 2Z7JA 2LVPC 1X1MA 3UMMA 3HRDD 1V49A 4N4ZA 4B95A 1YQ4B 1XNQM 3AH7A 5ITTA 2JQGR 2QHOA 1IBMM 2RDBC 4CDCB 4AJYB 3VLFB 3AFHA 3VKGA 2MLBA 3Q8BA 4HJKA 1V34A 5FLXS 2K9XA 3EA6A 1YUBA 5C2TB 4BKSA 1CQDA 3AE9B 3AOEC 4S12A 2DVWB 2GNOA 2IPKD 3KWVA 2XNAC 4MDKE 5D7GA 4CDEB 4XE0A 1VD2A 2LBCA 3FE3A 2KQSA 3A4RA 4EIWA 3J7AS 3U6OA 1ZE3D 4L8RC 4ZRPA 1JMLA 3PHUA 1DGGA 2K0BX 2L6OA 1OEYJ 2PJHA 2A5YB 5F02A 1FJGM 3L4PA 1GC7A 3FKYA 2DNFA 4W9JA 1WM2A 3TEXA 4AWJA 2KLGA 2OJWA 1IXRC 3ZQ4A 3KH0A 1F29A 4FJYA 2M0AA 3PTFC 3A1QB 2R46A 4ZOHC 4ANRA 3TWKA 1T3QA 3H4MA 2NBWB 2BYVE 4NQKE 1ZAEA 1XLOA 2K25A 3RD2A 3GRUA 4O1NA 2GLSA 4W4UA 2KN5A 1FCLA 2X8AA 3T15A 1L0XB 4QAYA 2KZUA 2WDVB 4A20A 4PS8A 1HE8A 1TS3A 4CHKA 3AE6B 2FQ9A 2NQDB 4JI6M 4G0NB 2J4XA 1YOVB 5I4DA 3R66C 2CJOA 3V62A 2OULA 4KODA 3QQ8B 1BUIC 3BVGA 1OTRA 2BTEA 2DHZA 3NY5A 1RLFA 1KFVA 3D6SA 1Z59A 2BGFA 4W9HA 2PW9A 1X37A 1U5IA 3RVVA 3N4CA 2D3AA 3Q8FA 2JTCA 3MJ5A 3BINA 3NOBA 3B74A 3P4QB 3BPFA 1D3ZA 1WJUA 1WHCA 3B7NA 2MROB 2N1VA 2J7NA 1XD3B 4MM3A 9PAPA 2L4FA 2Y3AA 2DC7A 4M0WA 1F2RC 4YSYB 3C3EA 2JZPA 2PPHA 2ZANA 3IAS1 1AYUA 2F7DA 2Z0DB 2CE7A 4W9KA 5G5GA 2M5ZA 1VR9A 3MTNB 1TS2A 3SC3A 1HQYE 3HJ8A 2BVCA 4NSRA 2W3RA 2OQ4A 4LGMA 4UDUC 2UXBM 2GBMA 4QRVA 2LRUA 1SSNA 4A9AA 3T9LA 4DHJB 1CTEA 3USVA 1OAIA 1TZ1A 5FTLA 3AM9A 2R4JA 1UGMA 3Q6BA 3O65B 1WGHA 4OELA 1OKSA 5ITYA 1WMHA 3FC4A 1T0SC 1PIPA 1U9QX 2H1RA 3PVLA 4I05A 1VDLA 3RN9C 3VFKA 1U9VA 3UGBB 2PIAA 3ZRFA 2INNE 3WHKA 2CEAA 1MU5A 4IWPA 2E00A 3WXEA 4RGOS 3E46A 2RSUA 1F4IA 2QENA 1XF5L 3F5VA 3FTFA 4PK1A 3NG0A 1F0ZA 1CJEA 1UWMA 4FVMA 3LCUA 4BOSA 3D8LA 1RAXA 4OX9M 4AI6A 1SJHD 4DV4M 3Q8CA 5IT9S 3WANA 2KHHA 5JXVA 1R4NI 2GI9A 1W5TA 5CVOB 3LQRA 1IGCA 1NI2A 4NQLB 2AQ3B 1K51A 1WGKA 2VDBB 2SAKA 2PMVA 3PZDA 4WJPA 1KHPA 3GCBA 1E9RA 1LV7A 1R4MB 4HDOA 2LHEA 2OOAA 2KC2A 3B7QA 4AG5A 1E8YA 4DV7M 1SF0A 3U5ZB 2BKFA 3EFCA 2RPQA 4PS7A 3GZNB 2D3CA 4PADA 1Q5WB 1BP4A 1HEZE 4YSZB 4II3B 4MSXA 3BB7A 1EWPA 5E6NA 3VUXA 1Y8RC 2R65A 3WIMA 1OQQA 1VLBA 2EJSA 4FBJB 3U7ZA 4KLNA 4B3MM 2DZYA 4X6HA 2O01F 2BT6A 2G1EA 2JSVX 1Y56A 1M6DA 3X0WA 2WDTB 4RM8A 4XWWA 1GLNA 1N61A 4DUZM 3B1LX 4CDFB 4FK5A 1SEBD 1OTRB 5AZHA 2MJDA 3DWMA 2KDLA 3D32A 1JCKB 4GN1A 3TSSA 2FAZA 4KGTA 4TV3A 1R4GA 3KS8A 4HK2A 2QDFA 1QUSA 4WWMA 2KZSA 1OFFA 2FIDA 5CHWA 3M6AA 2X8XX 4TSSA 5DPSA 2C5LC 1IN6A 2BKRB 2XZFA 5CTRC 3B2GA 5EZSA 2DENB 4IM2A 5IAAC 4G54A 4YL8A 3AE3B 3Q3JA 2MBBB 1T6OA 2OOBB 4RCOA 4BOZA 4US9A 2KWUB 2QBYA 3B9PA 3U6LA 3TNXA 3SBJA 2G8LA 4WP2A 4ZYNA 3LMMA 3A9JA 3P1MA 3ZIMA 3P5WA 1QILA 2DYOA 5EXPA 1L6VA 1J19A 1NNJA 3SFZA 1NVMA 4JV5M 2HCBA 3BOWA 1JWBD 3BBZA 3OF8A 3V3XA 4CIZA 1SXJE 2CHXA 4US8A 1C76A 2R45A 1M4VA 3T1YM 2LHCA 2LFIA 1UFZA 1MHHE 1PRBA 2F5QA 4LG2A 2PKOA 4AW4A 2IO3B 3J2PB 3MK6A 3I57A 2KZRA 4B7GA 1N36M 3FILB 3H6SA 4DV5M 3VH4B 4JX1C 1PFDA 3ZTCA 1SXJC 2D2QA 2FOIC 4P16A 2D11A 3H8HA 1ZMWA 2G5GX 2HAKA 1YN5A 1FXIA 3FUXA 3H7SA 4LNIA 5H8YE 3FRIA 4LRTA 1KF6B 2KVZA 4BZAA 3GLGE 2VRRB 1PJJA 1ATKA 4K3BA 3RFWA 1C7YA 3NBXX 5KO3A 2GB1A 2BB6A 4JWUC 5DPRA 2C99A 2XK5A 1ZIVA 4BS6A 1H6UA 5IOIA 4ITQA 2JZZA 2O6XA 1OIZA 1B1ZA 1XCQL 1ZPSA 4DR7M 3APCA 3U5ZA 2YEPF 3WAMA 3L0WB 4QRGA 1UM8A 4X66M 3RNBC 3AJIB 2CR5A 1SG9A 5EP1A 4YTPB 1MN3A 2PREA 2L4EA 2TSSA 3UF8A 1IXZA 2BQQA 1N62A 5PADA 4BS5A 2QSFX 2YJ8A 4AS1A 3E4RA 2AYOB 4FWGA 3GPXA 4ZYSA 1IWDA 1QUTA 3VK7A 2FCMA 1C1KA 2LVQD 2LTUA 3OWEB 3UIPB 1YK8A 4I07A 3WXGA 2VH1A 1GJSA 3KOZE 3PNVA 3DWGC 3ZXVA 1EU4A 1IP9A 4MZOA 3SHFA 3WHLA 2H5XA 3KFUG 3AE4B 2JYTA 4Q8HA 1HR0M 1I4QA 1DEUA 3ZRCA 2LZ6A 1SXJB 2WQYB 1PVJA 1OGWA 3R8BA 1QYRA 4N58A 2DAJA 1WGNA 3GLIA 1JW9D 2DZKA 2QNJA 4QNRA 2ZCCA 4AQYM 5KPZA 3PT2B 4CZWA 2CKHB 2UUAM 2FUG1 1QKZA 1I4XA 4FULA 2KK8A 2K8HA 5EE0A 1NLJA 2AUZA 2R9MA 1XLPA 1THEA 3GLGB 3Q2AC 3B21A 1HJPA 2KQ4X 2MEKA 3NVYA 2UXCM 2KKCA 4IBIA 1GC6A 3FD9A 4PYZA 1MPEA 3GRYA 2KX3A 2B1MA 3U6CA 2DZJA 3U6DA 2BJVA 3KOXE 3EUB2 3PZ7A 2DJFB 2H7JA 3QJ3A 1WX9A 2BYTA 1WSPA 3TUOA 4LFBM 5DYGA 4G11A 5DFLA 1SNKA 5EP3A 2DKLA 4D8BA 2NVUI 5T8IA 2WSEF 1ZW7A 1KXRA 2XBBC 1PPNA 2XLJA 2IDYA 1R4NB 4PT5A 2W3SA 2MR9A 3EIEA 3NRZA 3AU4A 1YK7A 4N9F4 2WBFX 2CV1A 2R2OA 4XYCA 3I5JC 1TZOA 3SHGB 2IY1B 3LDZE 1IBKM 3QSDA 4A5UA 1VRAB 3SYKA 2NMQA 5FR3A 1TKGA 5L8RF 1XEEA 4IOIE 1NJFA 3QK0A 2C0YA 1WE6A 3HHIA 3DCGA 3DHIC 3RI7C 4R71A 4B08A 5IO9A 5HFYA 1V2YA 1DYQA 2ON8A 3R8FA 2YJBA 1L4DB 2OHFA 3I4YA 3MC9A 4FADA 3JR4A 3BVZA 1WIAA 1D6EC 2JRIB 2WGSA 2G6DA 3LQQA 1GCBA 3PRMA 2LWXA 4HRSA 2LWPA 1I42A 2XFSA 1NHWC 3HM6X 2KVRA 1J7AA 5BYRA 3RNFC 1MX0A 2KXEA 1OFHA 2BNKA 3QYEA 2JQRB 4DK5A 1VJVA 2KA6B 1VDVA 1XQQA 3IVFA 3CWIA 4X62M 1NV9A 4ZRJA 4IBGA 2GQFA 2N7JA 2JZ1A 1NYQA 1SB3C 1GL7A 1NENB 2WYQA 4MGIE 2LH0A 4K7WA 2MH8A 1R4MI 3A9KA 3NVVA 3OAWA 1MDWA 2CHZA 2RGHA 3DDCB 1WX8A 5FK9C 1IPGA 3L16A
chains in the Genus database with same CATH topology
3BZDB 4C80A 1FM0D 4LGYA 3GQ3A 2KMMA 3GRVA 2R18A 3AV0A 3I9V1 1ZOYB 4QOSA 1QOBA 1Q3BA 2NTSA 3MHVC 5GXGB 3DOAA 1KFYB 2VZKD 4YHHM 4NRWA 2I7PA 4I8OA 1L6UA 2KAJA 2HWKA 2KDMA 3GQ4A 3HGIA 5EXXA 1E0ZA 1DOIA 3AE5B 3U60A 4JI1M 2ACZB 2WDQB 1I4GA 4YSXB 1DOXA 4QHTA 3TE6A 5BMIA 3P4RB 2N9LA 4GITA 5ITQA 2CHQA 2BTWA 1DKIA 2DBYA 5BMGA 5BYSA 1G59A 3U6PA 4JI5M 1F2RI 4AZFA 2FBWB 2M19A 5IZ7D 4G4QA 4BOPA 2Q5WD 2JA2A 2FE8A 4IIWA 4GKJM 1PGXA 3U6SA 4M9SA 2O5RA 3MHZA 1NHGC 3W0LB 2BU3A 2C9OA 1XXHB 2DLBA 1B9RA 2Y5CA 4LZJA 4M9XA 1TY0A 2WXQA 2WNMA 3UGJA 1K82A 5E6JA 1AWDA 1ACCA 3KLSX 4X65M 3SARA 3P63A 4W5WA 5EQTA 4X64M 2IGGA 3BK2A 1NY6A 5G5HA 2VQEM 1EWYC 4DUYM 1J09A 3GRRA 2R61A 4HL4A 2DWQA 1AYFA 5BYQA 4HEA1 4OZBA 1ZXIA 1DO0A 4OW0A 4HROA 2K5PA 3A46A 2KRKA 3DFZA 2QILA 2XSZD 2MJEA 2XF3A 4NAWB 1RYJA 3GO8A 1XO3A 1C4PA 1XXGA 4FXCA 3TWMA 4MH0E 3OTOM 3VK8A 2BS3B 1DGBA 4GH9A 3B2FA 5KPRA 4I81A 2Y5PA 2LNHC 4DXFA 5FSWA 3C0RA 4NRVA 1P7EA 3FUWA 5C18A 1WWTA 3HHZA 4GC5A 2KACA 3FUTA 4D82A 3O65A 1IQPA 2JYEA 2DZOB 3GP7A 1L2DA 1ORYB 1QVRA 2V0GA 1N34M 1Q10A 1QOGA 1IBLM 1TH4A 3EIHA 4USAA 3MC0B 3AL0C 4IJEA 4G6ZA 2I7NA 3KW6A 4MGYE 1N78A 1XXHA 1L4ZB 3GB1A 5EP4A 1FO4A 1JWAD 1QANA 3GLHB 4TUWA 3IG5A 2BBCA 3KWLA 4ZPXA 2W82A 2VIIA 2CHGA 2NQ8C 1D5ZC 5KQ8A 3VR9B 2Z4SA 4GDLB 1NY5A 4BOUA 5KQDA 3KVWA 1K3XA 1SXJA 1EWCA 4ZHPA 5EE1A 4IBDA 4D2KA 2RDGA 2V3PA 2BTWB 4LTUA 3J27B 3GLFB 1BXTA 2V4IB 4WW0A 1ESFA 2KN4A 8CATA 3U60B 4ZHOA 1DGJA 1G3IA 1P7FA 4NOOB 4DXGA 5EZQA 3W2DA 3RE8A 4LJ5A 1ENFA 1ZXHA 1I4WA 2HHHM 3ILKA 1RM6C 4HLQA 2EUCA 4L1BA 1XMQM 2F5NA 3KXEC 2AQ1B 1N77A 1HT2E 3AEAB 4DV1M 1OJLA 3BYYB 4QOZC 3GP1A 3SAUA 2WXKA 3TRKA 3DZDA 1Z6TA 3NZ3A 4H2AA 3TPZA 4G4RA 1N63A 2WXNA 1VDDA 4Z6YA 1JQ4A 1GVNA 1STEA 1QAQA 3U6MA 5E26A 4LJ9A 3Q8AA 3NVZA 2F4VM 2B76B 2RPVA 1N5WA 1IBXA 4N6EB 1V1PB 2K22A 2LHDA 1FNUA 3VR8B 1C9FA 3J7BA 2Y0QA 3GPYA 4IBBA 4WAFA 1TDZA 2CV0A 1V97A 4AG6A 1I7HA 2VZKB 2D5GA 3KOYE 4B7HA 3LVVA 1VZ8A 1QQWA 2WXJA 4YTMB 1EU3A 2ZW1A 2WU5B 4YWGG 4B3SM 3C58A 3R9XB 2PVGC 5D3IB 3SATA 4KKJA 1SXJD 1L2BA 1L1ZA 1QQRA 5EJCA 1PGBA 5DNYA 4XZXA 2D7GA 1YNTE 5KPTA 1IY0A 1V8CA 4LRSA 4GC9A 5AUIA 1MVKA 1C79A 3P4SB 3TMPA 1FCCC 2L83A 1PYWD 5FTJA 5JI2E 3AECB 4DV3M 2ZAMA 2UZJA 3L27A 4MT5A 4OZCA 2XZUA 1NEKB 2K0PA 3HHXA 2NTTA 2YEPB 1CZPA 1I4HA 3AE2B 5C3JB 3E9SA 3ZH9B 2I38A 1NYRA 2QCUA 3FKEA 3HU1A 1F77A 3KS4A 3K2LA 5ITUA 1XMOM 2M60A 1FNWA 1XHBA 5A2QS 1R7RA 4LCBA 2AHMA 2L1AA 5DYIA 1QT9A 2UXDM 1IY2A 1MHXA 2LUMA 4L16A 2JWUA 2MJ3A 3RGSA 2WXGA 4I5SA 1RWSA 2MH7A 4LJ8A 4BB9A 2PVOD 2IJ0A 2F5OA 1J7KA 3W1SA 4FD2A 4LY6A 2W55A 1N75A 5ITRA 3P4PB 3IAM1 4C7ZA 3AEEB 1E9SA 4IBEA 4DR1M 4GLSC 1G4AE 4GHAA 2DOSA 1J7BA 3A98B 4BLCA 2ERCA 1YSYA 4LK0M 4JXJA 1IGDA 5BR8M 2WXIA 4B0EA 5H37D 3PXGA 4LJAA 3KSJA 3W31A 3T3OA 2BS2B 4ITKA 4M9ZA 1L0YB 2EELA 2ZM6M 3BYTB 4IJFA 4JPSA 2QBYB 2OPFA 3JR5A 4LLGM 1JQJC 4RNAA 3HVZA 1IXSB 3PHWA 2K47A 3FYCA 4WQMA 4PDGA 3GLFA 1FMAD 2XN9C 3BWUD 4G4NA 2WXHA 3HHWA 4DV6M 3GS2A 4ZTBA 2QMTA 1CQVA 3FYDA 3MFGA 1R6BX 1TDHA 3FTDA 3GLHA 1AW7A 2HTME 3O13A 1T6BX 3FUVA 1SXTA 3VKHA 3AEDB 2SEBD 1DO2A 3GQ5A 2ZAOA 5C1BA 4LF5M 3W30A 4A3VB 1ET6A 5LMUM 2CFOA 3L28A 3LB8C 1HNZM 2E5LM 2LMCA 1D5XC 3AEFB 1KLUD 4OZAA 3PVSA 2ZW0A 3CF6E 1QOFA 1FXAA 4YXDB 4FCTA 4GIPA 1YZBA 3KP0E 1ZQ9A 2Y21A 3SFDB 3KDSE 3M0EA 4L2YA 1IN4A 2JU6X 3R2TA 4ARIA 2DYMA 2ICIA 2KW0A 1YN3A 4IBFA 2QIEB 2J7QA 4IKGA 2YR0A 3UJNA 2GRIA 3JAMS 1Z5CA 2XSZA 4LZZA 2DWNA 3VQIA 4DV0M 1IUEA 4B3RM 4MGKE 2ZBKB 3UI3A 1HNXM 4JI8M 5JZEA 3RPFC 2G9HD 4RKXA 4LJ6A 2JX5A 1GAQB 1E94E 3QAUA 2RDHA 1A70A 1R2YA 4HKZE 4FW9A 2WS3B 2LXEA 2DXIA 3TEWA 1JWMD 1TGUA 2WXFA 4R7GA 2Z8LA 1QAOA 4J3OD 2HKJA 1WRIA 1GKIA 1KH0A 3FUUA 4LF9M 1K3WA 3SASA 4GKKM 1HXYD 3A42A 3PO0A 4DV2M 2WDRB 2IGDA 1J5EM 3T3NA 2WXOA 2C98A 5EE3A 4IUMA 4KKIA 1KTKA 3PFIA 1TKEA 2YQZA 1D2NA 3T38A 2X38A 3PRPA 1ZP0B 1UNSA 2JXTA 3SYLA 3ZGZA 2Z84A 2DWZB 4CISA 3KQ4A 1TYGB 1XWIA 5ITXA 3I51A 4JYAM 2CU3A 4GUAA 4AQ7A 3VDPA 5HI1A 1FEHA 4XWTA 1JRPA 2CHVA 4NJCA 1DGFA 3WCQA 2LJIA 4G4OA 3ZC7B 4NXNM 5MPOA 2DWMA 3CF2A 1GPXA 3AOGA 3GPPA 1UUPA 1GB4A 4LF7M 4GDKB 2N0SB 3MTVA 4A6QA 3HJSA 1JALA 4RGNA 4RGTA 4RF1A 1G41A 1LO5D 3K1JA 4K0KM 2C5RA 4LFCM 2IGHA 3SAVA 2N9KA 4OVZA 5JI3E 4JE3B 3AE7B 2JRIA 4LF8M 3W0FA 1XNRM 2XGNA 1PDXA 3AKZA 1T5XD 2V3NA 3FAHA 4KHPM 1ZUD2 3VFDA 2E3TA 5D3DA 3E56A 4DR6M 3HUIA 3ZJUA 4OHJA 1XC8A 3BY4A 1ET9A 2XFTA 1GOZA 5EXTA 3ZNHA 2EO2A 4CGYB 4FCVA 3U61B 4MH8A 2WP9B 4YTNB 3U52E 5FTNA 1I94M 1SJED 1YJJA 1JR3A 3AEGB 4WH4A 5EP2A 3UZUA 2D7EA 1HQRD 2UUBM 4RGMA 4MGHA 2V1UA 1SIJA 2L32A 4GHLA 3L2AA 5AUKA 2QEJC 3HU3A 3GLIB 1CK1A 3U61A 1N5XA 4KO8A 1VZ6A 3ZYYX 3SMPA 3TEYA 2UU9M 1UKFA 1G8PA 4DR5M 2E6XA 5EXSA 1D5MC 1E7PB 4B3TM 1PJIA 4MB7A 4YT0B 4MGZE 1NJGA 2WXPA 4DR4M 2H89B 1HT1E 4C7YA 4TQ0A 1E9MA 3AE1B 1V1PA 2DWLA 1HNWM 3U4EG 2P5TA 1SE3A 3UK6A 1KYIA 4IP3A 4PCZA 4OVZB 2X4AA 1IY1A 4IBCA 4DR3M 3BOSA 1HZ6A 2J7OA 1RFKA 4XDCA 1L1TA 3LYYA 2X49A 4D8EA 1K50A 1HZ5A 3BBAA 1TS5A 5LMNM 2L09A 4CQNA 4R3DA 5IWAM 3J81S 3BK1A 1TKYA 1SE2A 4ZRQA 3NVWA 4NSOB 2C9CA 4REZA 2J53A 4RH6A 4AKHA 3V05A 3QWLA 1IM2A 1T3TA 3TQSA 3RFZB 1XLQA 1WXQA 4IBJA 4LJ4A 1JR3D 3URYA 4FWDA 2CJNA 2BS4B 3LXFA 2WXLA 4XDDA 1K53A 3B9JA 2Q2EB 4GMQA 1S3SA 3K8ZA 2F5PA 4BOQA 4D80A 1R7SA 4JI4M 3U6EA 1JROA 4Q2JA 1XLNA 4JI7M 3I4VA 4P6VF 3VDUA 1IN7A 2QP9X 2J52A 4L23A 2CV2A 4BBAA 4JI3M 1GL6A 3AN1A 1N60A 3RNVA 4TQ1A 1DOYA 3AE8B 2BJWA 1FD6A 1PM5A 1VJKA 1TS4A 1E32A 1FNVA 3DA1A 1JWUD 2VQFM 2R4EA 2K3UA 4HJGE 4KGSA 3CIRB 2QJLA 3EGRA 4LF6M 3C8YA 3NBIA 4M0DA 2INPE 2Z3XA 2WLBA 3J80S 1JWSD 1DGHA 1N33M 5HG2A 4LJ7A 1EE8A 4A90A 1DGHB 4HKQA 1KLGD 1XCTL 3Q69A 2AX5A 1IN5A 3VRAB 3T1HM 1C78A 1MI0A 5GKNA 2HDEA 2KWDA 1FRDA 3Q8XA 3SAWA 3PSEA 1J7CA 1AN8A 2WU2B 1IBXB 3U6QA 3NWLA 1TH2A 3L29A 4NZLB 1TH3A 3A45A 1C4AA 3AV8A 3U2SC 3W5UB 3GLGA 1Q39A 1L5PA 1I4RA 5FKAC 4NXMM 3ETRA 3KP1E 1QLBB 2AQ2B 3PT2A 1QOAA 1UGJA 2XEPA 5F3WA 2F5SA 4II7A 2UUCM 4MI7A 1E10A 4A55A 1YJIA 3ZJTA 3W5VB 3PZ8A 4DR2M 4I4LA 2KRUA 1ZDXA 1L0VB 3IT4B 4QHSA 4PD2A 2V6ZM 1YE9A 4N59A 4DQOC 4EE2A 3HKPA 4PDIA 1NNUC 2RKOA 1SE4A 1FNNA 3CF0A 5LNK1 4KGRA 2Y0TA 4XBOA 1V1OA 5H92C 4RFBA 5IREB 3ZJVA 3PHXA 5FTKA 1GB1A 4L4UA 1IN8A 1Z5BA 3BVMA 3MP9A 4JN6A 1TY2A 2W54A 3NS1A 3AMZA 3VRBB 2QZ4A 2DHRA 4A8XC 2RMMA 1FRRA 4L15A 4IBKA 1YMHE 1PUTA 2L7IA 4L78A 5BMHA 1R2ZA 4TMAB 2AGAA 4B0MA 3FILA 3K92A 4WURA 4KX6B 1Z5AA 1D4BA 1NSFA 1QF6A 2PLPA 1KSFX 1OQRA 1KRHA 2OEDA 3OQCA 2WXRA 2J7QC 5HHDG 2EA0A 3TL4X 4JI2M 2WXMA 2V1CA 2QSDA 3L26A 3ABVB 2FNAA 3BIID 3IT6B 1FIQA 2L52A 4NL4H 3SEBA 2Z4RA 2RGOA 4AKIA 1EM7A 4LFAM 3IG8A 5ITXE 4JWSC 2EKIA 2LEKA 2KEBA 2H88B 1C77A 3SMSA 3HHYA 4CHTB 4JI0M 1L8QA 4GRIA 1FFVA 3TEZA 3CTWB 3PNYA 2QPAA 4NAMA 4D81A 4YY3M 3FTEA 1L2CA 1ROEA 5TSSA 2XH9A 2FFJA 7CATA 2BW2A 3KSXA 3W9CB 4WIPA 3MP2A 2LGIA 1Q3CA 3Q8EA 1WYGA 1K52A 3SR6A 2C96A 1YN4A 2BB5A 4MM3B 4RF0A 3P42A 3KOWE 4OU7A 4MACA 3IFUA 2HL7A 3LVWA 3THGA 3IXSA 1FFUA 3NUHB 1NI3A 3HVDA 3L25A 4FCWA 2ONQA 1QAMA 3M7GA 1I4PA 4Z8XA 3D8BA 4ARCA 1N32M 2J42A 1YQ3B 3ZCBB 2M56B 3AOEA 4C56C 1HQCA 4FWHA 2L7HA 1PGAA 4IDIA 1TJEA 3AB5A 1ZDVA 3HJQA 3GPUA 4LF4M 1SBBB 1C4CA 3RGPA 2I2YA 4HXDB 1VZ7A 2PTLA 2Y20A 5FTMA 3SFEB 2D7HA 5BPVA 3FTCA 3HWSA 4D8IA 1HA5A 1NVID 1QZMA 2R62A 2YFQA 2CUZA 1OFIA 4B7FA 3J9CA 1E6EB 3TWLA 4QNMA 2DZNB 1W5SA 4AKGA 3HU2A 3AEBB 4XGIA 5EE9A 3R2IA 1BMLC 3N9YC 1UWXA 2YNMD 2Z7JA 3UMMA 3HRDD 1YQ4B 1XNQM 3AH7A 5ITTA 1IBMM 3VLFB 3AFHA 3VKGA 3Q8BA 5C2TB 5FLXS 2K9XA 3EA6A 1YUBA 3AE9B 3AOEC 4S12A 2DVWB 2IPKD 3KWVA 2XNAC 5D7GA 4XE0A 4EIWA 3J7AS 3U6OA 1ZE3D 4L8RC 4ZRPA 1JMLA 3PHUA 1DGGA 2L6OA 2A5YB 1FJGM 3L4PA 3TEXA 1IXRC 3ZQ4A 2M0AA 2R46A 4ZOHC 3TWKA 1T3QA 3H4MA 1ZAEA 1XLOA 3GRUA 4O1NA 1FCLA 2X8AA 3T15A 1L0XB 2KZUA 2WDVB 1TS3A 3AE6B 4JI6M 2J4XA 5I4DA 2CJOA 4KODA 1BUIC 3BVGA 2BTEA 1KFVA 1Z59A 2PW9A 1X37A 3Q8FA 2JTCA 3MJ5A 3P4QB 2J7NA 2Y3AA 4M0WA 1F2RC 4YSYB 3IAS1 2JZPA 2ZANA 2CE7A 5G5GA 2M5ZA 1VR9A 1TS2A 3SC3A 1HQYE 3HJ8A 4NSRA 2W3RA 2OQ4A 4LGMA 4UDUC 2UXBM 1SSNA 4A9AA 5FTLA 3AM9A 2R4JA 5ITYA 3FC4A 2H1RA 2PIAA 2INNE 3WHKA 2CEAA 1MU5A 4RGOS 2QENA 1XF5L 3FTFA 1F0ZA 1CJEA 1UWMA 4FVMA 4BOSA 3D8LA 4OX9M 4AI6A 1SJHD 4DV4M 3Q8CA 5IT9S 5JXVA 2GI9A 1W5TA 3LQRA 1IGCA 2AQ3B 1K51A 2SAKA 1WGKA 2PMVA 1E9RA 1LV7A 2LHEA 4AG5A 4DV7M 1SF0A 3U5ZB 1HEZE 4YSZB 3BB7A 2R65A 1OQQA 1VLBA 3U7ZA 4KLNA 4B3MM 2BT6A 2G1EA 2JSVX 1Y56A 4XWWA 1GLNA 1N61A 4DUZM 1SEBD 2MJDA 3DWMA 1JCKB 3TSSA 4KGTA 3KS8A 4WWMA 2KZSA 1OFFA 3M6AA 4TSSA 1IN6A 2XZFA 5EZSA 3B2GA 3AE3B 4RCOA 4BOZA 4US9A 2QBYA 3B9PA 3U6LA 3SBJA 2G8LA 3LMMA 3P1MA 1QILA 2DYOA 5EXPA 1L6VA 1NNJA 3SFZA 1NVMA 4JV5M 2HCBA 1JWBD 3V3XA 1SXJE 4US8A 1C76A 2R45A 1M4VA 3T1YM 2LFIA 1MHHE 2F5QA 4LG2A 2PKOA 4AW4A 3J2PB 3MK6A 3I57A 4B7GA 1N36M 3FILB 4DV5M 4JX1C 1PFDA 1SXJC 2FOIC 4P16A 3H8HA 2G5GX 1YN5A 1FXIA 3FUXA 5H8YE 4LRTA 1KF6B 1PJJA 3RFWA 5KO3A 2GB1A 2BB6A 4JWUC 2C99A 1H6UA 4ITQA 1B1ZA 1XCQL 1ZPSA 4DR7M 3U5ZA 2YEPF 1UM8A 4X66M 3AJIB 5EP1A 4YTPB 2TSSA 1IXZA 1N62A 4AS1A 3E4RA 4ZYSA 4FWGA 3GPXA 3VK7A 1C1KA 3OWEB 3DWGC 3KOZE 3PNVA 1EU4A 3SHFA 3WHLA 3KFUG 3AE4B 2JYTA 1HR0M 1I4QA 1SXJB 2WQYB 1PVJA 3R8BA 1QYRA 4N58A 3GLIA 1JW9D 4QNRA 4AQYM 5KPZA 2UUAM 2FUG1 1QKZA 1I4XA 5EE0A 1XLPA 3GLGB 3B21A 2KQ4X 2MEKA 3NVYA 2UXCM 4IBIA 3FD9A 1MPEA 3GRYA 3U6CA 3PZ7A 3U6DA 2BJVA 3KOXE 3EUB2 2BYTA 1WSPA 3TUOA 4LFBM 5DYGA 5EP3A 4D8BA 5T8IA 2XLJA 2IDYA 4PT5A 2W3SA 3EIEA 3NRZA 2CV1A 1TZOA 3SHGB 1IBKM 4A5UA 1VRAB 3SYKA 2NMQA 5FR3A 1TKGA 1XEEA 4IOIE 1NJFA 4B08A 5HFYA 1DYQA 2ON8A 3R8FA 1L4DB 2OHFA 3I4YA 3JR4A 3BVZA 1D6EC 3PRMA 3LQQA 2LWXA 4HRSA 2XFSA 1NHWC 1J7AA 5BYRA 1MX0A 2KXEA 1OFHA 2BNKA 2JQRB 2KA6B 1VDVA 3CWIA 4X62M 4IBGA 2N7JA 1NYQA 1SB3C 1GL7A 1NENB 4MGIE 2LH0A 3NVVA 2RGHA 5FK9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FE8 A;  4M0W A;  4MM3 B;  4OW0 A;  4P16 A;  4PT5 A;  4R3D A;  4RF0 A;  3MP2 A;  4REZ A;  5KO3 A;  3E9S A;  3MJ5 A;  4WUR A;  5E6J A;  4RF1 A;  4OVZ A;  4OVZ B;  4RNA A; 
#chains in the Genus database with same CATH topology
 1PQS A;  3BZD B;  4C80 A;  1FM0 D;  4LGY A;  3GQ3 A;  2KMM A;  3GRV A;  2KAN A;  2R18 A;  3AV0 A;  1WGG A;  2W9N A;  3I9V 1;  4IWQ A;  3RNG C;  1ZOY B;  4KT0 F;  4QOS A;  3PV1 A;  1QOB A;  2CB5 A;  1Q3B A;  2NTS A;  4GDK A;  3CH2 X;  3MHV C;  2DAI A;  5FPW A;  4S0R A;  3TBL D;  3RNA C;  2AYN A;  1ZMV A;  1BT0 A;  3RMK C;  5GXG B;  1WF9 A;  1A5R A;  3DOA A;  1CVZ A;  1KFY B;  1D0L A;  4NNJ B;  2ZPY A;  2Z0E B;  2UU7 A;  2VZK D;  2ASQ A;  4YHH M;  4NRW A;  2I7P A;  4I8O A;  4TUU A;  1L6U A;  2K8B A;  2KAJ A;  2HWK A;  1ITO A;  1TU6 A;  5CVM A;  2KDM A;  3GQ4 A;  4C4V B;  2JQF R;  3HGI A;  5EXX A;  2NS5 A;  1E0Z A;  1DOI A;  3DVN U;  2EMS A;  3AE5 B;  3U60 A;  3N3K B;  3PPA A;  2BDL A;  4JI1 M;  2ACZ B;  1V6E A;  1I4G A;  2WDQ B;  4YSX B;  3IV2 A;  1DOX A;  2C7N B;  4QHT A;  3TE6 A;  5BMI A;  3HIZ A;  3P4R B;  2LXA A;  2JY5 A;  2N9L A;  4HXD A;  1PJT A;  2J0J A;  4IW0 A;  2NPT B;  4KSK C;  4GIT A;  5ITQ A;  2CHQ A;  3V6E A;  2M1M A;  2BTW A;  1DKI A;  2DBY A;  5BMG A;  2XU5 A;  2LJ5 A;  3EEC A;  3NJT A;  5BYS A;  1G59 A;  4YV8 A;  3U6P A;  4JI5 M;  3I06 A;  2KMA A;  1F2R I;  4AZF A;  2FBW B;  2M19 A;  5IZ7 D;  3T6P A;  1ISN A;  4G4Q A;  4BOP A;  2Q5W D;  2JA2 A;  2FE8 A;  4W9L A;  2R0I A;  3QIJ A;  2MP2 A;  4IIW A;  4GKJ M;  2OOB A;  1KM7 A;  1PGX A;  4EEW A;  1XKG A;  2C60 A;  3QWZ B;  4IG7 B;  3U6S A;  3GE8 C;  3Q3O C;  1V33 A;  3PGE A;  3PRE A;  1LFD A;  3PRP B;  2DCD A;  4M9S A;  2FT2 A;  2O5R A;  3WAP A;  4P6G A;  3MHZ A;  2JXX A;  1F2A A;  1NHG C;  4UN2 B;  4WWO A;  3W0L B;  2BU3 A;  2C9O A;  1XXH B;  2DLB A;  1B9R A;  2DC9 A;  4KIK B;  2Y5C A;  4LZJ A;  3ZLZ A;  3H89 A;  4M9X A;  4I6N B;  2E02 A;  1TY0 A;  2BF8 B;  1WGL A;  2WXQ A;  1NB3 A;  2WNM A;  3UGJ A;  2DI0 A;  5E6J A;  1K82 A;  1AWD A;  1ACC A;  3KLS X;  4X65 M;  3SAR A;  1LGR A;  3MC8 A;  3P63 A;  4FIP A;  2LGS A;  3KWZ A;  3WA0 A;  1J0G A;  4W5W A;  1GG3 A;  2ZTC A;  5EQT A;  4X64 M;  2LGD A;  2IGG A;  3BK2 A;  2JWZ A;  1NY6 A;  5G5H A;  1MEG A;  2VQE M;  3CH3 X;  1UEL A;  1EWY C;  4DUY M;  2KMC A;  1J09 A;  3GRR A;  2R61 A;  3A9K B;  4HL4 A;  3DBS A;  2D3G A;  2DWQ A;  3CBK A;  3UQB A;  2LVO A;  3IUT A;  4W5C A;  1KOT A;  1WI0 A;  2QQ8 A;  1AYF A;  3Q14 C;  5BYQ A;  4HEA 1;  4MJS B;  4OZB A;  1ZXI A;  3RUL A;  1DO0 A;  4OW0 A;  3WAL A;  2ACT A;  1E8Z A;  4HRO A;  2VF7 A;  2K5P A;  3A46 A;  2KRK A;  2K39 A;  3MOR A;  3DFZ A;  1GUA B;  2QIL A;  1ZKH A;  2XSZ D;  3ALB A;  4BBN F;  2J7Q B;  1TBE A;  4ANV A;  2MJE A;  2XF3 A;  4NAW B;  3CGW A;  4GB9 A;  1WMH B;  1RYJ A;  3C0R B;  3GO8 A;  1XO3 A;  1C4P A;  4C00 A;  1XXG A;  4FXC A;  3S3Q A;  3TWM A;  4MH0 E;  3ZNH B;  2FS1 A;  3HX3 A;  3OTO M;  3IFW B;  1F2B A;  4XK8 F;  1FH0 A;  2FCQ A;  2KFJ A;  2V3S A;  3VK8 A;  1XB2 B;  1NDD A;  4I6P A;  2BS3 B;  1GO5 A;  1DGB A;  4GH9 A;  4DMY A;  3CSF A;  3B2F A;  4PP1 A;  5KPR A;  1V86 A;  4I81 A;  2HD5 A;  2Y5P A;  4XUI A;  2LNH C;  3ENE A;  3MHS A;  4DXF A;  5FSW A;  3C0R A;  4NRV A;  1P7E A;  3FUW A;  5C18 A;  1WWT A;  2AL6 A;  3HHZ A;  4GC5 A;  3JSV B;  2KAC A;  3TL5 A;  3FUT A;  4D82 A;  3O65 A;  1IQP A;  3F75 A;  2JYE A;  2DZO B;  1V5T A;  2KD0 A;  1L2D A;  3GP7 A;  1ORY B;  1QVR A;  2V0G A;  2NQA A;  2JP7 A;  3N32 A;  1N34 M;  4HCP B;  4PI3 A;  1Q10 A;  2LXC A;  1QOG A;  1IBL M;  3KX1 A;  1TH4 A;  3EIH A;  4USA A;  1WXV A;  4IM3 A;  2AL3 A;  2DZI A;  3MC0 B;  3AL0 C;  2DNA A;  3APF A;  4IJE A;  4G6Z A;  2I7N A;  3KW6 A;  4MGY E;  1N78 A;  3DBH B;  2PE9 A;  1XXH A;  1L4Z B;  3GB1 A;  3I01 M;  2WSC F;  4MEM A;  1O0E A;  5EP4 A;  1FO4 A;  1Y4H A;  1JWA D;  1QAN A;  3GLH B;  3T8M A;  4TUW A;  4W9I A;  2LVO C;  3IG5 A;  2BBC A;  3KWL A;  2VHS A;  3VTV A;  4ZPX A;  3EC8 A;  2MQJ A;  2W82 A;  2VII A;  2CHG A;  2NQ8 C;  1D5Z C;  5KQ8 A;  2RR9 A;  2Z4S A;  2HTH A;  3VR9 B;  2NR2 A;  1P3Q Q;  4GDL B;  4GOC A;  1NY5 A;  2XU4 A;  4I6L B;  4BOU A;  3QA8 A;  5KQD A;  2DYB A;  4P6E A;  3KVW A;  3RCZ A;  4IM0 A;  1K3X A;  1SXJ A;  1EWC A;  2ZVO A;  1UD7 A;  4X57 B;  1YD8 U;  4ZHP A;  5EE1 A;  4IBD A;  3A4S C;  4D2K A;  2RDG A;  2V3P A;  1WE7 A;  2BTW B;  4LTU A;  3J27 B;  3GLF B;  1BXT A;  1U9W A;  2O6V B;  4BQV A;  2V4I B;  4WW0 A;  4OVU A;  2BYE A;  1ESF A;  1EUV B;  2KN4 A;  2GHU A;  2AYO A;  4RM9 A;  1BQI A;  8CAT A;  3U60 B;  3A1Q A;  4ZHO A;  1DGJ A;  1G3I A;  1V9J A;  1P7F A;  4NOO B;  4DXG A;  5EZQ A;  2R9O A;  5BO4 B;  3W2D A;  2YVC A;  3RE8 A;  2IND C;  4LJ5 A;  4BKT A;  4BVU C;  1ENF A;  1ZXH A;  2IPP B;  1I4W A;  1QXP A;  3HY5 A;  2HHH M;  3ILK A;  1RM6 C;  4AUQ C;  4HLQ A;  2EUC A;  4L1B A;  1XMQ M;  4IC7 B;  4EOY A;  4ASW C;  2F5N A;  2BYF A;  1VCB A;  5J17 A;  1QDQ A;  1IXS A;  3PHW B;  3V6C B;  3KXE C;  1MHW A;  2AQ1 B;  2LAS A;  1N77 A;  1HT2 E;  3AEA B;  4DV1 M;  3M3J A;  1VSN A;  3TJP A;  1OJL A;  1V92 A;  2Z59 B;  3BYY B;  4K3C A;  4LJO B;  1ME3 A;  4QOZ C;  3L13 A;  2QHO B;  2LVQ A;  3GP1 A;  3SAU A;  2WXK A;  3TRK A;  2VF8 A;  1T43 A;  3DZD A;  1WXS A;  2K6D B;  1Z6T A;  3DHH C;  2DCC A;  7PCK A;  1XXH E;  3NZ3 A;  4H2A A;  3TPZ A;  1OEY A;  1AYW A;  4G4R A;  1N63 A;  2WXN A;  3RNE C;  3PLU A;  4YYU A;  1V80 A;  1VDD A;  2G3Q A;  4Z6Y A;  1JQ4 A;  1EO6 A;  1GVN A;  1STE A;  3KWB X;  2NBV B;  3OG5 A;  1QAQ A;  3U6M A;  5E26 A;  4LJ9 A;  3Q8A A;  2C9W B;  3NVZ A;  2F4V M;  2B76 B;  1SP4 B;  3I3T A;  2PNS A;  2RPV A;  4AP4 C;  1N5W A;  1L2N A;  1IBX A;  4N6E B;  2KNZ A;  1V1P B;  5E6O A;  2BDZ A;  3SD5 A;  1Z5S B;  1DF0 A;  1YX5 B;  2K22 A;  4HPL B;  2LHD A;  1FNU A;  4WJO A;  3VR8 B;  1C9F A;  3J7B A;  2Y0Q A;  3GPY A;  1LQB A;  4IBB A;  4WAF A;  2WSF F;  1TDZ A;  2CV0 A;  2KLC A;  2DEN A;  4AG6 A;  1V97 A;  1I7H A;  2VZK B;  1L7Y A;  1I35 A;  3ONS A;  1HUC B;  2D5G A;  3QCA A;  4F2L A;  3M95 A;  3KOY E;  4B7H A;  2BWB A;  4KZC A;  2B1N A;  3LVV A;  1VZ8 A;  2MBH A;  4XR7 A;  3U8E A;  1QQW A;  2WXJ A;  1Z2M A;  2L7R A;  4MZS A;  4YTM B;  1AU0 A;  3P5U A;  1EU3 A;  2ZW1 A;  2WU5 B;  4YWG G;  4B3S M;  1PPD A;  3C58 A;  1EF1 A;  3R9X B;  2PVG C;  2K8C A;  4KZ0 A;  1FXT B;  5D3I B;  4HDQ A;  1PAD A;  3SAT A;  4KKJ A;  3MJW A;  1SXJ D;  3E1Z B;  1L2B A;  1L1Z A;  1QQR A;  5EJC A;  1PGB A;  5DNY A;  4K81 A;  2D7G A;  1YNT E;  1RU3 A;  5KPT A;  4XZX A;  2HXZ A;  3VVW B;  3A33 B;  1IY0 A;  3F92 A;  3QX1 A;  1E5W A;  1V8C A;  4P1B C;  4LRS A;  1V5O A;  1J8C A;  2DX5 B;  4GC9 A;  4LDT D;  4NJ7 A;  5AUI A;  1MVK A;  1H8C A;  1GLO A;  2R6N A;  1C79 A;  3P4S B;  3TMP A;  1FCC C;  2L83 A;  1PYW D;  5FTJ A;  1TF0 B;  1RFA A;  5JI2 E;  5CHT A;  4BBN C;  3AEC B;  2FH0 A;  3K9O B;  4DV3 M;  1LM8 B;  4HWI B;  2DCA A;  2ZAM A;  1VQ1 A;  2UZJ A;  3L27 A;  3PLV A;  2OZ2 A;  4NY0 A;  2KNB A;  1TTN A;  4MT5 A;  4OZC A;  2XZU A;  2E01 A;  1NEK B;  2K0P A;  3HHX A;  2NQG A;  1NB5 A;  2NTT A;  2YEP B;  1CZP A;  1I4H A;  3AE2 B;  2DAG A;  1WM3 A;  5C3J B;  3E9S A;  3ZH9 B;  2I1J A;  1QMY A;  1K3B B;  2I38 A;  1NYR A;  2QCU A;  2WHI A;  5DCN A;  1YT7 A;  3FKE A;  3HU1 A;  1CV8 A;  2M4N A;  1F77 A;  2JT4 B;  3GLH E;  3RVW A;  3KS4 A;  3K2L A;  2YJ9 A;  5ITU A;  1XMO M;  2ZPN A;  2M60 A;  2L3Z A;  1FNW A;  2KNA A;  1XHB A;  5A2Q S;  4EKU A;  1R7R A;  4LCB A;  2CHW A;  1OQY A;  2AHM A;  2L1A A;  4TKN A;  5L83 A;  3ZDT A;  3SU8 X;  4JGH B;  1WJ7 A;  5DYI A;  1QT9 A;  1JRU A;  4PS3 A;  1MIR A;  2UXD M;  2KOX A;  1IY2 A;  1MHX A;  3LFY A;  2LUM A;  4L16 A;  2JWU A;  4ANX A;  3RNC C;  4N79 A;  2MJ3 A;  3V76 A;  3RGS A;  2C7H A;  2LVP A;  2DHY A;  4CO7 A;  2G45 B;  2WXG A;  2Y5B A;  4FN2 A;  3GLF E;  3B08 A;  4XZ4 A;  4I5S A;  2WZJ A;  1RWS A;  2MH7 A;  4J6I A;  2CU1 A;  4P1C C;  1WYW B;  3N3G A;  4LJ8 A;  4BB9 A;  2PVO D;  4Q8G A;  2IJ0 A;  2F5O A;  5CX3 A;  1J7K A;  4RKU F;  3W1S A;  4FD2 A;  4LY6 A;  2W55 A;  3BWK A;  1N75 A;  2Y6E A;  5ITR A;  3P4P B;  3VXW A;  2K6Q A;  1UBQ A;  3IAM 1;  2MBE A;  4C7Z A;  3AEE B;  3X23 A;  4GIV A;  1E9S A;  1KLV A;  1AAR A;  4FHK A;  4IBE A;  4DR1 M;  2JPH A;  1G4A E;  4GLS C;  4MSM B;  1CS8 A;  4GHA A;  2FIF A;  4NPN A;  2DOS A;  2MW5 A;  1J7B A;  4CJ6 A;  5G2N A;  3ERV A;  3TCA A;  3A98 B;  4BLC A;  2ERC A;  2XK5 B;  2G3Q B;  3IG3 A;  1YSY A;  2MCN B;  3KKU A;  4M00 A;  4DHJ D;  4HPP A;  4LK0 M;  4JXJ A;  1F52 A;  5BR8 M;  1IGD A;  2WXI A;  2A4Z A;  4QBB A;  3P5V A;  1P98 A;  5H37 D;  4B0E A;  3PXG A;  4LJA A;  1WR6 E;  2IY0 B;  3KSJ A;  3W31 A;  3I63 C;  1D0K A;  3T3O A;  2BS2 B;  4ITK A;  4M9Z A;  2L8J A;  1L0Y B;  2EEL A;  2N7D A;  2CP8 A;  2ZM6 M;  2ZNV C;  4IJF A;  3BYT B;  4JPS A;  2QBY B;  2QC8 A;  2OPF A;  3JR5 A;  4W9G A;  2N7E A;  3ML8 A;  3AI5 A;  4LLG M;  1JQJ C;  2HJ8 A;  2FTD A;  4YYV A;  3V6C A;  4RNA A;  3HVZ A;  1IXS B;  2J0M A;  2K47 A;  3FYC A;  4WQM A;  3K8U A;  3PHW A;  2JY7 A;  4PDG A;  2INC C;  3GLF A;  1FMA D;  4KLB A;  2XN9 C;  3H7D A;  3RYT A;  3BWU D;  4FJV B;  4G4N A;  2N35 A;  2NPT A;  2WXH A;  1FPY A;  2KNV A;  3HZJ A;  3HHW A;  3WXF A;  4DV6 M;  2ATO A;  3A9J B;  3GS2 A;  4GDL A;  4ZTB A;  1AUA A;  2IYD B;  2QMT A;  1QOL A;  1YVB A;  4YVA A;  1OIP A;  1CQV A;  1VEK A;  3FYD A;  2C7M B;  1HTO A;  3MFG A;  4K7C A;  1R6B X;  1TDH A;  3FTD A;  3GLH A;  1AW7 A;  2HTM E;  2MX2 A;  3O13 A;  3QJZ A;  1T6B X;  3FUV A;  3AI8 A;  3C9P A;  1ME4 A;  2HWJ A;  2HH5 A;  1SXT A;  3KYD D;  1V81 A;  3VKH A;  3VHT C;  3MHH A;  3NHE A;  2MJ5 B;  3AED B;  2SEB D;  1DO2 A;  3GQ5 A;  3KSE A;  3W68 A;  2ZAO A;  5C1B A;  1P0R A;  4LF5 M;  3W30 A;  4A3V B;  5J2R A;  1ET6 A;  5LMU M;  4LDT B;  2AU1 A;  2CFO A;  3L28 A;  3LB8 C;  4M8M A;  4K1R B;  1HNZ M;  2E5L M;  1EF5 A;  4W9D A;  3JSV A;  3UIO B;  2LMC A;  3VTW A;  4GGQ A;  1D5X C;  3AEF B;  3ZNI D;  1KLU D;  1EWM A;  4OZA A;  3VUW A;  4L6V 6;  1TR8 A;  2HD5 B;  3NS8 A;  4M02 A;  3PVS A;  2ZW0 A;  3CF6 E;  2JZ0 A;  1F2C A;  1QOF A;  1JR3 E;  1FXA A;  2ZTD A;  3V61 A;  5AEK B;  2LI5 A;  2XU3 A;  4YXD B;  4FCT A;  1GAB A;  4GIP A;  3CST A;  1YZB A;  3C9E A;  3L17 A;  3KP0 E;  1ZQ9 A;  2Y21 A;  3SFD B;  3KDS E;  3M0E A;  4L2Y A;  1IN4 A;  1PE6 A;  2JU6 X;  4WJN A;  2JUJ A;  5KHO A;  3R2T A;  4ARI A;  2REX A;  2DYM A;  2ICI A;  5FR6 A;  3BPM A;  2KW0 A;  4URK A;  2HJ1 A;  3QYB A;  1YN3 A;  4OEM A;  4DHZ E;  4IBF A;  2QIE B;  2J7Q A;  4AXL A;  5JZE B;  4IKG A;  2YR0 A;  1WX7 A;  4F1S A;  3RZF A;  6PAD A;  3UJN A;  2GRI A;  3JAM S;  4I04 A;  1Z5C A;  2XSZ A;  4LZZ A;  1WZ0 A;  4HWY A;  2JY8 A;  2HHN A;  5EDS A;  2DWN A;  1PPP A;  3VQI A;  4DV0 M;  4MJS A;  1IUE A;  2JWS A;  4B3R M;  4G50 A;  4MGK E;  2ZBK B;  3UI3 A;  1HNX M;  4JI8 M;  5JZE A;  3RPF C;  1ZV1 A;  2G9H D;  4RKX A;  4LJ6 A;  3RZW C;  4HPM B;  4XGA B;  2JX5 A;  1GAQ B;  1E94 E;  3H7P A;  3QAU A;  2RDH A;  3DBL B;  1A70 A;  3HWN A;  1R2Y A;  2KFK A;  3KFQ A;  4HKZ E;  4DMX A;  4FW9 A;  2WS3 B;  3I04 M;  3K9O A;  2LXE A;  3C3D A;  2DXI A;  4ICV A;  3TEW A;  1JWM D;  1TGU A;  5D6J B;  2WXF A;  3DBR I;  3MHS D;  4FHJ A;  5EF4 A;  1IFY A;  2DCB A;  4M0W B;  1K8R B;  2LUE A;  5A24 A;  1MG4 A;  3IHP A;  4R7G A;  3ZXR A;  2Z8L A;  1QAO A;  4J3O D;  3PW3 A;  2HKJ A;  1WRI A;  1GKI A;  2UYZ B;  1KH0 A;  3FUU A;  1WXM A;  4W9E A;  2AIM A;  2KJ6 A;  4LF9 M;  1K3W A;  3SAS A;  4GKK M;  1HXY D;  3A42 A;  1S4V A;  1SGH A;  3PO0 A;  2G8E A;  4DV2 M;  2KTF A;  4FJZ A;  1GEC E;  2WDR B;  2IGD A;  2IO2 B;  3GE3 C;  1J5E M;  3T3N A;  2WXO A;  3ZUA A;  3ZNZ B;  4DHZ B;  2C98 A;  5EE3 A;  4IUM A;  4CYE A;  4KKI A;  1KTK A;  3PFI A;  1TKE A;  2YQZ A;  1D2N A;  2GOW A;  2DC8 A;  2HE7 A;  2V1Y A;  3T38 A;  2X38 A;  3PRP A;  1ZP0 B;  1UNS A;  1LTM A;  4JL9 A;  2JXT A;  3SYL A;  3ZGZ A;  2Z84 A;  4F1I A;  2DWZ B;  4CIS A;  2IO1 B;  1KJT A;  3KQ4 A;  1TYG B;  1XWI A;  5ITX A;  3I51 A;  4JYA M;  1MJG M;  2CU3 A;  4GUA A;  1WJ6 A;  4AQ7 A;  3VDP A;  4DXA B;  1AEC A;  5HI1 A;  3R7Q A;  4XX5 A;  4BOZ B;  1FEH A;  3KUZ A;  4XWT A;  1JRP A;  1PJS A;  2CHV A;  1M94 A;  1MS6 A;  4YYR A;  4NJC A;  1DGF A;  4GEW A;  4G3O A;  3RUI B;  3WCQ A;  3CBJ A;  2NQI A;  3DPD A;  3JW0 X;  2LJI A;  4G4O A;  3ZC7 B;  1UF0 A;  1WGY A;  4IWO A;  4NXN M;  3ZVV A;  2AS8 A;  5MPO A;  2DWM A;  3CF2 A;  5CHV C;  3AOG A;  1GPX A;  4PP2 E;  2K9D A;  3GPP A;  1UUP A;  1GB4 A;  4LF7 M;  4NC6 A;  4GDK B;  3JVZ X;  2KX0 A;  2LRW A;  2N0S B;  4LCD E;  3MTV A;  4A6Q A;  4C4V A;  3HJS A;  1JAL A;  4RGN A;  2KDI A;  1D0M A;  2F1G A;  2R2Q A;  3CMM B;  2MA9 B;  1Q6K A;  2JUO A;  3U7D A;  4RGT A;  3UIN B;  4LNK A;  3ECI A;  5G55 A;  2GFO A;  4RF1 A;  2R9C A;  1G41 A;  1LO5 D;  2AVW A;  2FO5 A;  3K1J A;  4K0K M;  4ZDV A;  2C5R A;  3Q3F A;  3SDL C;  4LFC M;  2ZJD A;  1EWL A;  2A5U A;  2IGH A;  2L76 A;  2KQ7 A;  3SAV A;  2N9K A;  2OO9 A;  1TIF A;  4OVZ A;  2MBQ A;  5JI3 E;  4ZRK A;  4JE3 B;  2JY6 B;  3U30 A;  1TGZ B;  4WAA A;  5JH5 C;  3AE7 B;  2L2D A;  3LCV B;  3PRM B;  2JRI A;  4LF8 M;  3KVF B;  3W0F A;  1XNR M;  2KTR B;  3DOW A;  2XGN A;  2IBI A;  1PDX A;  1YX6 B;  2N9X A;  3QAR A;  3AKZ A;  2L00 B;  1NV8 A;  1T5X D;  1Q1O A;  2V3N A;  3FAH A;  2LVN C;  2PBH A;  4KHP M;  1ZUD 2;  3VFD A;  3W1S C;  2E3T A;  1QZE A;  5D3D A;  3E56 A;  2PE6 B;  4DR6 M;  3HUI A;  3ZJU A;  4EUT A;  2DAM A;  4OHJ A;  1ZCM A;  1XC8 A;  3BY4 A;  1ET9 A;  2XFT A;  3IMA A;  1GOZ A;  5EXT A;  4AJW A;  3VUY A;  3ZNH A;  3E21 A;  2EO2 A;  2MRP A;  1BY8 A;  3GOE A;  3H9D A;  5HKH A;  4DDI D;  4CGY B;  1E7U A;  4FCV A;  2DJG B;  3U61 B;  4CDD B;  2D10 A;  4MH8 A;  2WP9 B;  4WQO B;  4YTN B;  5AZF A;  2N9E B;  3U52 E;  2KHW B;  3BXW A;  3OVX A;  4DWF A;  4BFR A;  5FTN A;  1I94 M;  2KC1 A;  1SJE D;  1YJJ A;  1JR3 A;  2JNH A;  1Y08 A;  3AEG B;  4WH4 A;  5JH3 A;  2NCN A;  5EP2 A;  1X9Y A;  3UZU A;  3LJ3 A;  2D7E A;  1HQR D;  2UUB M;  4RGM A;  5JHB A;  1TTE A;  4YYQ A;  3P5X A;  4MGH A;  2V1U A;  1MJD A;  1SIJ A;  2L32 A;  2JVC A;  2N1W A;  3N1Z C;  4RMA A;  4GHL A;  3L2A A;  1T0Y A;  2D3B A;  3LXS A;  5AUK A;  2DZL A;  2WX0 A;  1VEG A;  2QEJ C;  3HU3 A;  2RRU A;  1VG5 A;  3GLI B;  1EWO A;  1CK1 A;  3U61 A;  1N5X A;  2R9F A;  3PSE B;  4KO8 A;  1VZ6 A;  3ZYY X;  3SMP A;  3TEY A;  2UU9 M;  1UKF A;  2L05 A;  2FUD A;  1G8P A;  3L54 A;  4DR5 M;  3R7R A;  2ARY A;  2E6X A;  2FRQ A;  5EXS A;  1D5M C;  1E7P B;  2EMT A;  4B3T M;  1PJI A;  4MB7 A;  4WJQ A;  1KFX L;  2DZM A;  4YT0 B;  2KXJ A;  4MGZ E;  2FRA A;  2RGF A;  1NJG A;  4LNF A;  4RY2 A;  1GMY A;  2WXP A;  3WAO A;  4DR4 M;  1MFW A;  4WA6 A;  2CRU A;  2IBI B;  2H89 B;  1HT1 E;  4C7Y A;  2DAE A;  1S3S G;  4TQ0 A;  1WXA A;  5LLI A;  4NAW A;  1EFU B;  1E9M A;  3AE1 B;  1V1P A;  2DWL A;  1HNW M;  3U4E G;  2P5T A;  2R9N A;  1SE3 A;  1WFY A;  2FCS A;  1CPJ A;  5CVN B;  3UK6 A;  1KYI A;  3OJ3 A;  4IP3 A;  4PCZ A;  4OVZ B;  1Q0W B;  3R3M A;  5D94 A;  2FUH B;  4BAX A;  2X4A A;  5IN7 A;  1IY1 A;  4IBC A;  4PYU A;  5TR5 A;  2KJR A;  4B6W A;  4DR3 M;  3BOS A;  4ACF A;  4W9C A;  1HZ6 A;  2J7O A;  4II2 B;  4AOF A;  1CUK A;  1RFK A;  4XDC A;  3RT3 B;  1L1T A;  3LYY A;  2X49 A;  1WRD B;  2VHF A;  4D8E A;  1K50 A;  1HZ5 A;  1QDT A;  2OP3 A;  3BBA A;  1TS5 A;  1STF E;  3PRZ A;  1TLO A;  2FCN A;  5AZG A;  1A5T A;  1UZX B;  5L95 C;  5LMN M;  2K1F A;  4ZUX U;  2L09 A;  1OAO C;  4CQN A;  4R3D A;  2GBJ A;  5IWA M;  2I1K A;  3OIS A;  4GMV A;  3J81 S;  3ZW3 A;  3BK1 A;  1TKY A;  1SE2 A;  3DVG Y;  4AXM A;  2E03 A;  2YJ2 A;  1WY8 A;  2LGY A;  2DZZ A;  1DV0 A;  4B9K A;  1WH3 A;  4ZRQ A;  4EFO A;  4S17 A;  3NVW A;  1KFU L;  3ZNG C;  4NSO B;  2C9C A;  2KWV B;  4REZ A;  2J53 A;  4HLE A;  4KIK A;  3FRH A;  2QCZ A;  3B89 A;  4RH6 A;  4F8C B;  3TIX A;  4AKH A;  3N1X C;  2MHJ A;  3V05 A;  3ZQJ A;  1PPO A;  3QWL A;  2IZV B;  4WWN A;  2L0T A;  4Q7J A;  1IM2 A;  1T3T A;  3TQS A;  1P3Q U;  3KW5 B;  4KDL B;  1NO1 A;  1AIP C;  3RFZ B;  3K24 A;  1C3T A;  4G3X B;  4YYS A;  2AWT A;  1TL9 A;  1WIV A;  1XLQ A;  1WXQ A;  4IBJ A;  4JIO U;  4LJ4 A;  3AXC A;  1JR3 D;  2D07 B;  3URY A;  1AYV A;  4FWD A;  1MEM A;  3V60 A;  4ANU A;  2CJN A;  2BS4 B;  3DF0 A;  1AU3 A;  1NBF C;  1QDR A;  1EF7 A;  1UH6 A;  3LXF A;  3M63 B;  3Q3N C;  2WXL A;  4GU2 A;  4XDD A;  1GJZ A;  1K53 A;  4DBG A;  2P86 A;  4ANW A;  3K9M A;  4OVV A;  3B9J A;  2Q2E B;  3HHM A;  4GMQ A;  1S3S A;  1Y8G A;  3K8Z A;  2F5P A;  3Q8G A;  5IP4 D;  3HM3 A;  5DPT A;  3EHV A;  1IYF A;  2P0R A;  1CSB B;  1WR1 B;  4BOQ A;  4D80 A;  1YLA A;  5KHQ A;  1R7S A;  3H8C A;  4JI4 M;  3B79 A;  3U6E A;  1JRO A;  2MSE D;  3NZU A;  2RD0 A;  1KHQ A;  4Q2J A;  1XLN A;  1YIW A;  4JI7 M;  3I4V A;  4P6V F;  3VDU A;  1IN7 A;  2QP9 X;  2J52 A;  1UBI A;  4L23 A;  5K16 A;  2CV2 A;  1ZGU B;  2O2V A;  3ZUN A;  4IUM B;  1ICF A;  3O0U A;  4BBA A;  4JI3 M;  1PXV A;  1GL6 A;  3DBR B;  4LJP B;  3AN1 A;  1N60 A;  3RNV A;  2MWS B;  4TQ1 A;  1DOY A;  3AE8 B;  2EKF A;  2BJW A;  1FD6 A;  3KUC B;  1F9J A;  1PM5 A;  3DHG C;  5C1Z A;  1VJK A;  2APL A;  2BWE S;  3QAQ A;  3OLM D;  1PJQ A;  4LNN A;  1TS4 A;  1E32 A;  1FNV A;  4P17 A;  3DA1 A;  1JWU D;  3APD A;  2LHG A;  2VQF M;  3TMP B;  1WJ4 A;  2O6V D;  2R4E A;  2G4S A;  2K3U A;  5J94 A;  4HJG E;  2EKE C;  3NZS A;  3GLI E;  3B7Z A;  2KFK B;  4KGS A;  1G71 A;  3CIR B;  3Q3M C;  2QJL A;  3S2A A;  2G8J A;  3RVX A;  3EGR A;  4LF6 M;  4E74 A;  1POP A;  1GJT A;  1WZ3 A;  3C8Y A;  3NBI A;  2PAD A;  4GSW A;  4M0D A;  1N6Z A;  2INP E;  1YAL A;  2Z3X A;  2WLB A;  2VH2 A;  3J80 S;  1JWS D;  3DBL I;  1DGH A;  5IA7 A;  1N33 M;  4A3P A;  5HG2 A;  4QRX A;  3KYC D;  4LJ7 A;  1EE8 A;  1SIF A;  1XT9 B;  5JA7 A;  4A90 A;  1DGH B;  4HKQ A;  1KLG D;  4FJC A;  1XCT L;  3ZTD A;  3Q69 A;  2AX5 A;  1IN5 A;  2KJH B;  3T1H M;  3VRA B;  1C78 A;  1MI0 A;  2KO3 A;  5GKN A;  1VEJ A;  2ZZP B;  5LXI B;  2HDE A;  2KWD A;  1FRD A;  3Q8X A;  3SAW A;  3PSE A;  1J7C A;  1AN8 A;  2WU2 B;  1HTQ A;  1R5L A;  2AEH A;  1SE9 A;  3H8B A;  3DBH I;  3IBE A;  1IBX B;  2JY6 A;  3U6Q A;  3S3R A;  3NWL A;  5CHV A;  1TH2 A;  2LD9 A;  1C1Y B;  3L29 A;  2XU1 A;  2K6B A;  4NZL B;  1TH3 A;  2M8S A;  3A45 A;  5IKC M;  3DVN V;  3MTN A;  1C4A A;  3AV8 A;  1BVS A;  2Z8Y M;  5CHF A;  3U2S C;  3W5U B;  3GLG A;  1Q39 A;  3N1Y C;  1L5P A;  1I4R A;  5FKA C;  2J5Y A;  4NXM M;  3M62 B;  5JHA A;  3ETR A;  4N8W A;  3KP1 E;  1QLB B;  2AQ2 B;  2DAF A;  3PT2 A;  2BWE A;  1QOA A;  1UGJ A;  2XEP A;  2N4F A;  2LVA A;  2PEA A;  3IOQ A;  1MG8 A;  3OVZ A;  1WGD A;  1WR1 A;  4JQW C;  3OF9 A;  3QT4 A;  2JRH A;  5F3W A;  2F5S A;  4II7 A;  1AU2 A;  3QHT A;  2UUC M;  3QC8 B;  1RRB A;  4MI7 A;  1E10 A;  4A55 A;  2JF5 A;  1E7V A;  1YJI A;  3ZJT A;  3W5V B;  3PZ8 A;  4DR2 M;  1YJ1 A;  2O2V B;  4E3C A;  4I4L A;  2KRU A;  1ZDX A;  1L0V B;  3IT4 B;  4P7I A;  4E71 A;  4QHS A;  4PD2 A;  3ML9 A;  2V6Z M;  1YE9 A;  4N59 A;  3PHX B;  4DQO C;  4EE2 A;  3HKP A;  2MGW A;  2O25 A;  4PDI A;  1NNU C;  2RKO A;  3BC3 A;  4X6J A;  4ICU A;  2GBK A;  4ZRI A;  1SE4 A;  2KTR A;  2ZVN A;  1FNN A;  3H1U A;  3N3K A;  4K7S A;  4HVB A;  2WX1 A;  3CF0 A;  1E8X A;  2UWQ A;  5LNK 1;  3GZN I;  2CS4 A;  1T0R C;  2ZEQ A;  4KGR A;  2Y0T A;  4XBO A;  1V1O A;  3IHP C;  3OJ4 B;  5H92 C;  3AU5 A;  4RFB A;  3EFU A;  5IRE B;  2O6V A;  3I3T B;  3VDZ A;  3P2B A;  3ZJV A;  3PHX A;  5FTK A;  1GB1 A;  1P9D U;  4KV2 A;  4L4U A;  1U9X A;  1IN8 A;  1Z5B A;  3BVM A;  3MP9 A;  3V6E B;  4LNO A;  4JN6 A;  3SHQ A;  1AU4 A;  1TY2 A;  2W54 A;  3NS1 A;  1F1H A;  3AMZ A;  2GMI C;  3VRB B;  2V4L A;  2QZ4 A;  2DHR A;  4A8X C;  2RMM A;  4FA6 A;  4BSQ A;  3PBH A;  1FRR A;  4L15 A;  4IBK A;  1YMH E;  3JYU A;  2R44 A;  1PUT A;  2YLM A;  2L7I A;  2J0K A;  4L78 A;  5BMH A;  1R2Z A;  4TMA B;  2V9H A;  1ZMU A;  3HK0 A;  2OJR A;  2GBN A;  1E90 A;  4MSQ B;  4BOS C;  3VAW A;  2AGA A;  2JZ3 B;  1LXD A;  4B0M A;  3FIL A;  3K92 A;  4WUR A;  4KX6 B;  5GMV A;  2P7U A;  1Z5A A;  3H4J A;  1PBH A;  1D4B A;  1NSF A;  1QF6 A;  3ZDM C;  3LW5 F;  2PLP A;  4K7U A;  1A6R A;  3IEJ A;  1KSF X;  1EIJ A;  1OQR A;  2M17 A;  2NBU A;  1KRH A;  2OED A;  3OQC A;  1NL6 A;  2WXR A;  3DQV A;  2J7Q C;  5HHD G;  5J18 A;  2EA0 A;  3TL4 X;  4JI2 M;  1CJL A;  2WXM A;  2V1C A;  2QSD A;  3L26 A;  2GBR A;  3N30 A;  3ABV B;  2FNA A;  2FNJ B;  3BII D;  3IT6 B;  3B0A A;  4EZJ A;  1FIQ A;  4JLC A;  4M01 A;  2L52 A;  4NL4 H;  4W9F A;  2JXN A;  3SEB A;  2DAK A;  2B3T A;  5EGW A;  2Z4R A;  2RGO A;  4AKI A;  1EM7 A;  2YJC A;  2CIO A;  4LFA M;  3IG8 A;  5ITX E;  2ZNV B;  2EKI A;  4JWS C;  2LEK A;  2G7Y A;  2KEB A;  1AIM A;  2H88 B;  4EZK A;  1C77 A;  3SMS A;  3HHY A;  4CHT B;  1CB5 A;  4JI0 M;  1L8Q A;  4GRI A;  1FFV A;  3TEZ A;  5D2M B;  3CTW B;  2Y5B B;  1GNU A;  3PNY A;  2QPA A;  4DDG D;  2M0X A;  4NAM A;  4D81 A;  2BWF A;  4A3O A;  1JB0 F;  3PNR A;  4YY3 M;  1G6J A;  3FTE A;  1L2C A;  3L10 B;  5C23 A;  1ROE A;  8PCH A;  2LGX A;  5TSS A;  2XH9 A;  2FFJ A;  2KDB A;  3K9P A;  2KYW A;  7CAT A;  2BW2 A;  3KSX A;  4BKS D;  1Q02 A;  4QH6 A;  2B3A A;  1T0Q C;  3W9C B;  4WIP A;  3MP2 A;  5DPW A;  2LGI A;  1Q3C A;  3Q8E A;  1WYG A;  1WGR A;  5E6P A;  4MEL A;  1K52 A;  3SR6 A;  1E8W A;  1H4R A;  3HHA A;  2C96 A;  3IEC A;  2EKK A;  4MM3 B;  4RF0 A;  1YN4 A;  2BB5 A;  2ZCB A;  3L08 A;  3P42 A;  4F7Z A;  1NPZ A;  3KOW E;  4BPV A;  2KDE B;  2IO0 B;  3K9P B;  4OU7 A;  4MAC A;  3BCN A;  3H7P B;  3IFU A;  2HL7 A;  3LVW A;  1CMX B;  3THG A;  3IXS A;  1FFU A;  3KW9 A;  3NUH B;  3ZO5 B;  1NI3 A;  3HVD A;  3L25 A;  4FCW A;  4XC2 A;  2ONQ A;  1QAM A;  3M7G A;  1I4P A;  4BKG A;  4Z8X A;  4KVG B;  3D8B A;  1TT5 B;  3NHE B;  1NQC A;  1PGY A;  4ARC A;  1N32 M;  3BY4 B;  2J42 A;  1YQ3 B;  2AUX A;  4W5B A;  3ZCB B;  2M56 B;  2G4D B;  3KUD B;  3H6N A;  2L0F A;  3AOE A;  1P1A A;  1HQC A;  2MBO A;  4C56 C;  4FWH A;  2BPS A;  2L7H A;  1PGA A;  4Y28 F;  4IDI A;  1JQP A;  1TJE A;  3AB5 A;  1ZDV A;  2KDF B;  3PS6 A;  4GXB A;  4YYW A;  2R6F A;  2MP2 B;  3HJQ A;  3GPU A;  4LF4 M;  3HD3 A;  4WWP A;  4HEO A;  4X6I A;  3C19 A;  4M8N A;  1SBB B;  2WWZ A;  4KSL C;  2KWC A;  3MMP A;  1WJN A;  2DC6 A;  3PDF A;  3DVG X;  1C4C A;  1YQB A;  2CWB A;  1BGO A;  3RGP A;  4DBG B;  1PCI A;  4EZL A;  2I2Y A;  3VH3 B;  2XEW A;  3UQA A;  3ZKJ C;  4HXD B;  3O1G A;  3VTU A;  1VZ7 A;  2PTL A;  2Y20 A;  3W1Y A;  5FTM A;  3SFE B;  3W67 A;  2D7H A;  2N9P C;  5BPV A;  3FTC A;  4KDI C;  3HWS A;  4D8I A;  1HA5 A;  1NVI D;  1QZM A;  2R62 A;  4FLH A;  2YFQ A;  2CUZ A;  1OFI A;  4B7F A;  3J9C A;  1E6E B;  3TWL A;  1S1Q B;  4QNM A;  2DZN B;  1W5S A;  1U4A A;  3M99 A;  4AKG A;  3AUL A;  3HU2 A;  5LXH A;  2FYE A;  3AEB B;  4XGI A;  5EE9 A;  3R2I A;  4HCN B;  1BML C;  3N9Y C;  1UWX A;  2KT7 A;  2YNM D;  3N20 C;  4NJ6 A;  3U8Z A;  2Z7J A;  2LVP C;  1X1M A;  3UMM A;  3HRD D;  1V49 A;  4N4Z A;  4B95 A;  1YQ4 B;  1XNQ M;  3AH7 A;  5ITT A;  2JQG R;  2QHO A;  1IBM M;  2RDB C;  4CDC B;  4AJY B;  3VLF B;  3AFH A;  3VKG A;  2MLB A;  3Q8B A;  4HJK A;  1V34 A;  5FLX S;  2K9X A;  3EA6 A;  1YUB A;  5C2T B;  4BKS A;  1CQD A;  3AE9 B;  3AOE C;  4S12 A;  2DVW B;  2GNO A;  2IPK D;  3KWV A;  2XNA C;  4MDK E;  5D7G A;  4CDE B;  4XE0 A;  1VD2 A;  2LBC A;  3FE3 A;  2KQS A;  3A4R A;  4EIW A;  3J7A S;  3U6O A;  1ZE3 D;  4L8R C;  4ZRP A;  1JML A;  3PHU A;  1DGG A;  2K0B X;  2L6O A;  1OEY J;  2PJH A;  2A5Y B;  5F02 A;  1FJG M;  3L4P A;  1GC7 A;  3FKY A;  2DNF A;  4W9J A;  1WM2 A;  3TEX A;  4AWJ A;  2KLG A;  2OJW A;  1IXR C;  3ZQ4 A;  3KH0 A;  1F29 A;  4FJY A;  2M0A A;  3PTF C;  3A1Q B;  2R46 A;  4ZOH C;  4ANR A;  3TWK A;  1T3Q A;  3H4M A;  2NBW B;  2BYV E;  4NQK E;  1ZAE A;  1XLO A;  2K25 A;  3RD2 A;  3GRU A;  4O1N A;  2GLS A;  4W4U A;  2KN5 A;  1FCL A;  2X8A A;  3T15 A;  1L0X B;  4QAY A;  2KZU A;  2WDV B;  4A20 A;  4PS8 A;  1HE8 A;  1TS3 A;  4CHK A;  3AE6 B;  2FQ9 A;  2NQD B;  4JI6 M;  4G0N B;  2J4X A;  1YOV B;  5I4D A;  3R66 C;  2CJO A;  3V62 A;  2OUL A;  4KOD A;  3QQ8 B;  1BUI C;  3BVG A;  1OTR A;  2BTE A;  2DHZ A;  3NY5 A;  1RLF A;  1KFV A;  3D6S A;  1Z59 A;  2BGF A;  4W9H A;  2PW9 A;  1X37 A;  1U5I A;  3RVV A;  3N4C A;  2D3A A;  3Q8F A;  2JTC A;  3MJ5 A;  3BIN A;  3NOB A;  3B74 A;  3P4Q B;  3BPF A;  1D3Z A;  1WJU A;  1WHC A;  3B7N A;  2MRO B;  2N1V A;  2J7N A;  1XD3 B;  4MM3 A;  9PAP A;  2L4F A;  2Y3A A;  2DC7 A;  4M0W A;  1F2R C;  4YSY B;  3C3E A;  2JZP A;  2PPH A;  2ZAN A;  3IAS 1;  1AYU A;  2F7D A;  2Z0D B;  2CE7 A;  4W9K A;  5G5G A;  2M5Z A;  1VR9 A;  3MTN B;  1TS2 A;  3SC3 A;  1HQY E;  3HJ8 A;  2BVC A;  4NSR A;  2W3R A;  2OQ4 A;  4LGM A;  4UDU C;  2UXB M;  2GBM A;  4QRV A;  2LRU A;  1SSN A;  4A9A A;  3T9L A;  4DHJ B;  1CTE A;  3USV A;  1OAI A;  1TZ1 A;  5FTL A;  3AM9 A;  2R4J A;  1UGM A;  3Q6B A;  3O65 B;  1WGH A;  4OEL A;  1OKS A;  5ITY A;  1WMH A;  3FC4 A;  1T0S C;  1PIP A;  1U9Q X;  2H1R A;  3PVL A;  4I05 A;  1VDL A;  3RN9 C;  3VFK A;  1U9V A;  3UGB B;  2PIA A;  3ZRF A;  2INN E;  3WHK A;  2CEA A;  1MU5 A;  4IWP A;  2E00 A;  3WXE A;  4RGO S;  3E46 A;  2RSU A;  1F4I A;  2QEN A;  1XF5 L;  3F5V A;  3FTF A;  4PK1 A;  3NG0 A;  1F0Z A;  1CJE A;  1UWM A;  4FVM A;  3LCU A;  4BOS A;  3D8L A;  1RAX A;  4OX9 M;  4AI6 A;  1SJH D;  4DV4 M;  3Q8C A;  5IT9 S;  3WAN A;  2KHH A;  5JXV A;  1R4N I;  2GI9 A;  1W5T A;  5CVO B;  3LQR A;  1IGC A;  1NI2 A;  4NQL B;  2AQ3 B;  1K51 A;  1WGK A;  2VDB B;  2SAK A;  2PMV A;  3PZD A;  4WJP A;  1KHP A;  3GCB A;  1E9R A;  1LV7 A;  1R4M B;  4HDO A;  2LHE A;  2OOA A;  2KC2 A;  3B7Q A;  4AG5 A;  1E8Y A;  4DV7 M;  1SF0 A;  3U5Z B;  2BKF A;  3EFC A;  2RPQ A;  4PS7 A;  3GZN B;  2D3C A;  4PAD A;  1Q5W B;  1BP4 A;  1HEZ E;  4YSZ B;  4II3 B;  4MSX A;  3BB7 A;  1EWP A;  5E6N A;  3VUX A;  1Y8R C;  2R65 A;  3WIM A;  1OQQ A;  1VLB A;  2EJS A;  4FBJ B;  3U7Z A;  4KLN A;  4B3M M;  2DZY A;  4X6H A;  2O01 F;  2BT6 A;  2G1E A;  2JSV X;  1Y56 A;  1M6D A;  3X0W A;  2WDT B;  4RM8 A;  4XWW A;  1GLN A;  1N61 A;  4DUZ M;  3B1L X;  4CDF B;  4FK5 A;  1SEB D;  1OTR B;  5AZH A;  2MJD A;  3DWM A;  2KDL A;  3D32 A;  1JCK B;  4GN1 A;  3TSS A;  2FAZ A;  4KGT A;  4TV3 A;  1R4G A;  3KS8 A;  4HK2 A;  2QDF A;  1QUS A;  4WWM A;  2KZS A;  1OFF A;  2FID A;  5CHW A;  3M6A A;  2X8X X;  4TSS A;  5DPS A;  2C5L C;  1IN6 A;  2BKR B;  2XZF A;  5CTR C;  3B2G A;  5EZS A;  2DEN B;  4IM2 A;  5IAA C;  4G54 A;  4YL8 A;  3AE3 B;  3Q3J A;  2MBB B;  1T6O A;  2OOB B;  4RCO A;  4BOZ A;  4US9 A;  2KWU B;  2QBY A;  3B9P A;  3U6L A;  3TNX A;  3SBJ A;  2G8L A;  4WP2 A;  4ZYN A;  3LMM A;  3A9J A;  3P1M A;  3ZIM A;  3P5W A;  1QIL A;  2DYO A;  5EXP A;  1L6V A;  1J19 A;  1NNJ A;  3SFZ A;  1NVM A;  4JV5 M;  2HCB A;  3BOW A;  1JWB D;  3BBZ A;  3OF8 A;  3V3X A;  4CIZ A;  1SXJ E;  2CHX A;  4US8 A;  1C76 A;  2R45 A;  1M4V A;  3T1Y M;  2LHC A;  2LFI A;  1UFZ A;  1MHH E;  1PRB A;  2F5Q A;  4LG2 A;  2PKO A;  4AW4 A;  2IO3 B;  3J2P B;  3MK6 A;  3I57 A;  2KZR A;  4B7G A;  1N36 M;  3FIL B;  3H6S A;  4DV5 M;  3VH4 B;  4JX1 C;  1PFD A;  3ZTC A;  1SXJ C;  2D2Q A;  2FOI C;  4P16 A;  2D11 A;  3H8H A;  1ZMW A;  2G5G X;  2HAK A;  1YN5 A;  1FXI A;  3FUX A;  3H7S A;  4LNI A;  5H8Y E;  3FRI A;  4LRT A;  1KF6 B;  2KVZ A;  4BZA A;  3GLG E;  2VRR B;  1PJJ A;  1ATK A;  4K3B A;  3RFW A;  1C7Y A;  3NBX X;  5KO3 A;  2GB1 A;  2BB6 A;  4JWU C;  5DPR A;  2C99 A;  2XK5 A;  1ZIV A;  4BS6 A;  1H6U A;  5IOI A;  4ITQ A;  2JZZ A;  2O6X A;  1OIZ A;  1B1Z A;  1XCQ L;  1ZPS A;  4DR7 M;  3APC A;  3U5Z A;  2YEP F;  3WAM A;  3L0W B;  4QRG A;  1UM8 A;  4X66 M;  3RNB C;  3AJI B;  2CR5 A;  1SG9 A;  5EP1 A;  4YTP B;  1MN3 A;  2PRE A;  2L4E A;  2TSS A;  3UF8 A;  1IXZ A;  2BQQ A;  1N62 A;  5PAD A;  4BS5 A;  2QSF X;  2YJ8 A;  4AS1 A;  3E4R A;  2AYO B;  4FWG A;  3GPX A;  4ZYS A;  1IWD A;  1QUT A;  3VK7 A;  2FCM A;  1C1K A;  2LVQ D;  2LTU A;  3OWE B;  3UIP B;  1YK8 A;  4I07 A;  3WXG A;  2VH1 A;  1GJS A;  3KOZ E;  3PNV A;  3DWG C;  3ZXV A;  1EU4 A;  1IP9 A;  4MZO A;  3SHF A;  3WHL A;  2H5X A;  3KFU G;  3AE4 B;  2JYT A;  4Q8H A;  1HR0 M;  1I4Q A;  1DEU A;  3ZRC A;  2LZ6 A;  1SXJ B;  2WQY B;  1PVJ A;  1OGW A;  3R8B A;  1QYR A;  4N58 A;  2DAJ A;  1WGN A;  3GLI A;  1JW9 D;  2DZK A;  2QNJ A;  4QNR A;  2ZCC A;  4AQY M;  5KPZ A;  3PT2 B;  4CZW A;  2CKH B;  2UUA M;  2FUG 1;  1QKZ A;  1I4X A;  4FUL A;  2KK8 A;  2K8H A;  5EE0 A;  1NLJ A;  2AUZ A;  2R9M A;  1XLP A;  1THE A;  3GLG B;  3Q2A C;  3B21 A;  1HJP A;  2KQ4 X;  2MEK A;  3NVY A;  2UXC M;  2KKC A;  4IBI A;  1GC6 A;  3FD9 A;  4PYZ A;  1MPE A;  3GRY A;  2KX3 A;  2B1M A;  3U6C A;  2DZJ A;  3U6D A;  2BJV A;  3KOX E;  3EUB 2;  3PZ7 A;  2DJF B;  2H7J A;  3QJ3 A;  1WX9 A;  2BYT A;  1WSP A;  3TUO A;  4LFB M;  5DYG A;  4G11 A;  5DFL A;  1SNK A;  5EP3 A;  2DKL A;  4D8B A;  2NVU I;  5T8I A;  2WSE F;  1ZW7 A;  1KXR A;  2XBB C;  1PPN A;  2XLJ A;  2IDY A;  1R4N B;  4PT5 A;  2W3S A;  2MR9 A;  3EIE A;  3NRZ A;  3AU4 A;  1YK7 A;  4N9F 4;  2WBF X;  2CV1 A;  2R2O A;  4XYC A;  3I5J C;  1TZO A;  3SHG B;  2IY1 B;  3LDZ E;  1IBK M;  3QSD A;  4A5U A;  1VRA B;  3SYK A;  2NMQ A;  5FR3 A;  1TKG A;  5L8R F;  1XEE A;  4IOI E;  1NJF A;  3QK0 A;  2C0Y A;  1WE6 A;  3HHI A;  3DCG A;  3DHI C;  3RI7 C;  4R71 A;  4B08 A;  5IO9 A;  5HFY A;  1V2Y A;  1DYQ A;  2ON8 A;  3R8F A;  2YJB A;  1L4D B;  2OHF A;  3I4Y A;  3MC9 A;  4FAD A;  3JR4 A;  3BVZ A;  1WIA A;  1D6E C;  2JRI B;  2WGS A;  2G6D A;  3LQQ A;  1GCB A;  3PRM A;  2LWX A;  4HRS A;  2LWP A;  1I42 A;  2XFS A;  1NHW C;  3HM6 X;  2KVR A;  1J7A A;  5BYR A;  3RNF C;  1MX0 A;  2KXE A;  1OFH A;  2BNK A;  3QYE A;  2JQR B;  4DK5 A;  1VJV A;  2KA6 B;  1VDV A;  1XQQ A;  3IVF A;  3CWI A;  4X62 M;  1NV9 A;  4ZRJ A;  4IBG A;  2GQF A;  2N7J A;  2JZ1 A;  1NYQ A;  1SB3 C;  1GL7 A;  1NEN B;  2WYQ A;  4MGI E;  2LH0 A;  4K7W A;  2MH8 A;  1R4M I;  3A9K A;  3NVV A;  3OAW A;  1MDW A;  2CHZ A;  2RGH A;  3DDC B;  1WX8 A;  5FK9 C;  1IPG A;  3L16 A; 
#chains in the Genus database with same CATH homology
 3BZD B;  4C80 A;  1FM0 D;  4LGY A;  3GQ3 A;  2KMM A;  3GRV A;  2R18 A;  3AV0 A;  3I9V 1;  1ZOY B;  4QOS A;  1QOB A;  1Q3B A;  2NTS A;  3MHV C;  5GXG B;  3DOA A;  1KFY B;  2VZK D;  4YHH M;  4NRW A;  2I7P A;  4I8O A;  1L6U A;  2KAJ A;  2HWK A;  2KDM A;  3GQ4 A;  3HGI A;  5EXX A;  1E0Z A;  1DOI A;  3AE5 B;  3U60 A;  4JI1 M;  2ACZ B;  2WDQ B;  1I4G A;  4YSX B;  1DOX A;  4QHT A;  3TE6 A;  5BMI A;  3P4R B;  2N9L A;  4GIT A;  5ITQ A;  2CHQ A;  2BTW A;  1DKI A;  2DBY A;  5BMG A;  5BYS A;  1G59 A;  3U6P A;  4JI5 M;  1F2R I;  4AZF A;  2FBW B;  2M19 A;  5IZ7 D;  4G4Q A;  4BOP A;  2Q5W D;  2JA2 A;  2FE8 A;  4IIW A;  4GKJ M;  1PGX A;  3U6S A;  4M9S A;  2O5R A;  3MHZ A;  1NHG C;  3W0L B;  2BU3 A;  2C9O A;  1XXH B;  2DLB A;  1B9R A;  2Y5C A;  4LZJ A;  4M9X A;  1TY0 A;  2WXQ A;  2WNM A;  3UGJ A;  1K82 A;  5E6J A;  1AWD A;  1ACC A;  3KLS X;  4X65 M;  3SAR A;  3P63 A;  4W5W A;  5EQT A;  4X64 M;  2IGG A;  3BK2 A;  1NY6 A;  5G5H A;  2VQE M;  1EWY C;  4DUY M;  1J09 A;  3GRR A;  2R61 A;  4HL4 A;  2DWQ A;  1AYF A;  5BYQ A;  4HEA 1;  4OZB A;  1ZXI A;  1DO0 A;  4OW0 A;  4HRO A;  2K5P A;  3A46 A;  2KRK A;  3DFZ A;  2QIL A;  2XSZ D;  2MJE A;  2XF3 A;  4NAW B;  1RYJ A;  3GO8 A;  1XO3 A;  1C4P A;  1XXG A;  4FXC A;  3TWM A;  4MH0 E;  3OTO M;  3VK8 A;  2BS3 B;  1DGB A;  4GH9 A;  3B2F A;  5KPR A;  4I81 A;  2Y5P A;  2LNH C;  4DXF A;  5FSW A;  3C0R A;  4NRV A;  1P7E A;  3FUW A;  5C18 A;  1WWT A;  3HHZ A;  4GC5 A;  2KAC A;  3FUT A;  4D82 A;  3O65 A;  1IQP A;  2JYE A;  2DZO B;  3GP7 A;  1L2D A;  1ORY B;  1QVR A;  2V0G A;  1N34 M;  1Q10 A;  1QOG A;  1IBL M;  1TH4 A;  3EIH A;  4USA A;  3MC0 B;  3AL0 C;  4IJE A;  4G6Z A;  2I7N A;  3KW6 A;  4MGY E;  1N78 A;  1XXH A;  1L4Z B;  3GB1 A;  5EP4 A;  1FO4 A;  1JWA D;  1QAN A;  3GLH B;  4TUW A;  3IG5 A;  2BBC A;  3KWL A;  4ZPX A;  2W82 A;  2VII A;  2CHG A;  2NQ8 C;  1D5Z C;  5KQ8 A;  3VR9 B;  2Z4S A;  4GDL B;  1NY5 A;  4BOU A;  5KQD A;  3KVW A;  1K3X A;  1SXJ A;  1EWC A;  4ZHP A;  5EE1 A;  4IBD A;  4D2K A;  2RDG A;  2V3P A;  2BTW B;  4LTU A;  3J27 B;  3GLF B;  1BXT A;  2V4I B;  4WW0 A;  1ESF A;  2KN4 A;  8CAT A;  3U60 B;  4ZHO A;  1DGJ A;  1G3I A;  1P7F A;  4NOO B;  4DXG A;  5EZQ A;  3W2D A;  3RE8 A;  4LJ5 A;  1ENF A;  1ZXH A;  1I4W A;  2HHH M;  3ILK A;  1RM6 C;  4HLQ A;  2EUC A;  4L1B A;  1XMQ M;  2F5N A;  3KXE C;  2AQ1 B;  1N77 A;  1HT2 E;  3AEA B;  4DV1 M;  1OJL A;  3BYY B;  4QOZ C;  3GP1 A;  3SAU A;  2WXK A;  3TRK A;  3DZD A;  1Z6T A;  3NZ3 A;  4H2A A;  3TPZ A;  4G4R A;  1N63 A;  2WXN A;  1VDD A;  4Z6Y A;  1JQ4 A;  1GVN A;  1STE A;  1QAQ A;  3U6M A;  5E26 A;  4LJ9 A;  3Q8A A;  3NVZ A;  2F4V M;  2B76 B;  2RPV A;  1N5W A;  1IBX A;  4N6E B;  1V1P B;  2K22 A;  2LHD A;  1FNU A;  3VR8 B;  1C9F A;  3J7B A;  2Y0Q A;  3GPY A;  4IBB A;  4WAF A;  1TDZ A;  2CV0 A;  1V97 A;  4AG6 A;  1I7H A;  2VZK B;  2D5G A;  3KOY E;  4B7H A;  3LVV A;  1VZ8 A;  1QQW A;  2WXJ A;  4YTM B;  1EU3 A;  2ZW1 A;  2WU5 B;  4YWG G;  4B3S M;  3C58 A;  3R9X B;  2PVG C;  5D3I B;  3SAT A;  4KKJ A;  1SXJ D;  1L2B A;  1L1Z A;  1QQR A;  5EJC A;  1PGB A;  5DNY A;  4XZX A;  2D7G A;  1YNT E;  5KPT A;  1IY0 A;  1V8C A;  4LRS A;  4GC9 A;  5AUI A;  1MVK A;  1C79 A;  3P4S B;  3TMP A;  1FCC C;  2L83 A;  1PYW D;  5FTJ A;  5JI2 E;  3AEC B;  4DV3 M;  2ZAM A;  2UZJ A;  3L27 A;  4MT5 A;  4OZC A;  2XZU A;  1NEK B;  2K0P A;  3HHX A;  2NTT A;  2YEP B;  1CZP A;  1I4H A;  3AE2 B;  5C3J B;  3E9S A;  3ZH9 B;  2I38 A;  1NYR A;  2QCU A;  3FKE A;  3HU1 A;  1F77 A;  3KS4 A;  3K2L A;  5ITU A;  1XMO M;  2M60 A;  1FNW A;  1XHB A;  5A2Q S;  1R7R A;  4LCB A;  2AHM A;  2L1A A;  5DYI A;  1QT9 A;  2UXD M;  1IY2 A;  1MHX A;  2LUM A;  4L16 A;  2JWU A;  2MJ3 A;  3RGS A;  2WXG A;  4I5S A;  1RWS A;  2MH7 A;  4LJ8 A;  4BB9 A;  2PVO D;  2IJ0 A;  2F5O A;  1J7K A;  3W1S A;  4FD2 A;  4LY6 A;  2W55 A;  1N75 A;  5ITR A;  3P4P B;  3IAM 1;  4C7Z A;  3AEE B;  1E9S A;  4IBE A;  4DR1 M;  4GLS C;  1G4A E;  4GHA A;  2DOS A;  1J7B A;  3A98 B;  4BLC A;  2ERC A;  1YSY A;  4LK0 M;  4JXJ A;  1IGD A;  5BR8 M;  2WXI A;  4B0E A;  5H37 D;  3PXG A;  4LJA A;  3KSJ A;  3W31 A;  3T3O A;  2BS2 B;  4ITK A;  4M9Z A;  1L0Y B;  2EEL A;  2ZM6 M;  3BYT B;  4IJF A;  4JPS A;  2QBY B;  2OPF A;  3JR5 A;  4LLG M;  1JQJ C;  4RNA A;  3HVZ A;  1IXS B;  3PHW A;  2K47 A;  3FYC A;  4WQM A;  4PDG A;  3GLF A;  1FMA D;  2XN9 C;  3BWU D;  4G4N A;  2WXH A;  3HHW A;  4DV6 M;  3GS2 A;  4ZTB A;  2QMT A;  1CQV A;  3FYD A;  3MFG A;  1R6B X;  1TDH A;  3FTD A;  3GLH A;  1AW7 A;  2HTM E;  3O13 A;  1T6B X;  3FUV A;  1SXT A;  3VKH A;  3AED B;  2SEB D;  1DO2 A;  3GQ5 A;  2ZAO A;  5C1B A;  4LF5 M;  3W30 A;  4A3V B;  1ET6 A;  5LMU M;  2CFO A;  3L28 A;  3LB8 C;  1HNZ M;  2E5L M;  2LMC A;  1D5X C;  3AEF B;  1KLU D;  4OZA A;  3PVS A;  2ZW0 A;  3CF6 E;  1QOF A;  1FXA A;  4YXD B;  4FCT A;  4GIP A;  1YZB A;  3KP0 E;  1ZQ9 A;  2Y21 A;  3SFD B;  3KDS E;  3M0E A;  4L2Y A;  1IN4 A;  2JU6 X;  3R2T A;  4ARI A;  2DYM A;  2ICI A;  2KW0 A;  1YN3 A;  4IBF A;  2QIE B;  2J7Q A;  4IKG A;  2YR0 A;  3UJN A;  2GRI A;  3JAM S;  1Z5C A;  2XSZ A;  4LZZ A;  2DWN A;  3VQI A;  4DV0 M;  1IUE A;  4B3R M;  4MGK E;  2ZBK B;  3UI3 A;  1HNX M;  4JI8 M;  5JZE A;  3RPF C;  2G9H D;  4RKX A;  4LJ6 A;  2JX5 A;  1GAQ B;  1E94 E;  3QAU A;  2RDH A;  1A70 A;  1R2Y A;  4HKZ E;  4FW9 A;  2WS3 B;  2LXE A;  2DXI A;  3TEW A;  1JWM D;  1TGU A;  2WXF A;  4R7G A;  2Z8L A;  1QAO A;  4J3O D;  2HKJ A;  1WRI A;  1GKI A;  1KH0 A;  3FUU A;  4LF9 M;  1K3W A;  3SAS A;  4GKK M;  1HXY D;  3A42 A;  3PO0 A;  4DV2 M;  2WDR B;  2IGD A;  1J5E M;  3T3N A;  2WXO A;  2C98 A;  5EE3 A;  4IUM A;  4KKI A;  1KTK A;  3PFI A;  1TKE A;  2YQZ A;  1D2N A;  3T38 A;  2X38 A;  3PRP A;  1ZP0 B;  1UNS A;  2JXT A;  3SYL A;  3ZGZ A;  2Z84 A;  2DWZ B;  4CIS A;  3KQ4 A;  1TYG B;  1XWI A;  5ITX A;  3I51 A;  4JYA M;  2CU3 A;  4GUA A;  4AQ7 A;  3VDP A;  5HI1 A;  1FEH A;  4XWT A;  1JRP A;  2CHV A;  4NJC A;  1DGF A;  3WCQ A;  2LJI A;  4G4O A;  3ZC7 B;  4NXN M;  5MPO A;  2DWM A;  3CF2 A;  1GPX A;  3AOG A;  3GPP A;  1UUP A;  1GB4 A;  4LF7 M;  4GDK B;  2N0S B;  3MTV A;  4A6Q A;  3HJS A;  1JAL A;  4RGN A;  4RGT A;  4RF1 A;  1G41 A;  1LO5 D;  3K1J A;  4K0K M;  2C5R A;  4LFC M;  2IGH A;  3SAV A;  2N9K A;  4OVZ A;  5JI3 E;  4JE3 B;  3AE7 B;  2JRI A;  4LF8 M;  3W0F A;  1XNR M;  2XGN A;  1PDX A;  3AKZ A;  1T5X D;  2V3N A;  3FAH A;  4KHP M;  1ZUD 2;  3VFD A;  2E3T A;  5D3D A;  3E56 A;  4DR6 M;  3HUI A;  3ZJU A;  4OHJ A;  1XC8 A;  3BY4 A;  1ET9 A;  2XFT A;  1GOZ A;  5EXT A;  3ZNH A;  2EO2 A;  4CGY B;  4FCV A;  3U61 B;  4MH8 A;  2WP9 B;  4YTN B;  3U52 E;  5FTN A;  1I94 M;  1SJE D;  1YJJ A;  1JR3 A;  3AEG B;  4WH4 A;  5EP2 A;  3UZU A;  2D7E A;  1HQR D;  2UUB M;  4RGM A;  4MGH A;  2V1U A;  1SIJ A;  2L32 A;  4GHL A;  3L2A A;  5AUK A;  2QEJ C;  3HU3 A;  3GLI B;  1CK1 A;  3U61 A;  1N5X A;  4KO8 A;  1VZ6 A;  3ZYY X;  3SMP A;  3TEY A;  2UU9 M;  1UKF A;  1G8P A;  4DR5 M;  2E6X A;  5EXS A;  1D5M C;  1E7P B;  4B3T M;  1PJI A;  4MB7 A;  4YT0 B;  4MGZ E;  1NJG A;  2WXP A;  4DR4 M;  2H89 B;  1HT1 E;  4C7Y A;  4TQ0 A;  1E9M A;  3AE1 B;  1V1P A;  2DWL A;  1HNW M;  3U4E G;  2P5T A;  1SE3 A;  3UK6 A;  1KYI A;  4IP3 A;  4PCZ A;  4OVZ B;  2X4A A;  1IY1 A;  4IBC A;  4DR3 M;  3BOS A;  1HZ6 A;  2J7O A;  1RFK A;  4XDC A;  1L1T A;  3LYY A;  2X49 A;  4D8E A;  1K50 A;  1HZ5 A;  3BBA A;  1TS5 A;  5LMN M;  2L09 A;  4CQN A;  4R3D A;  5IWA M;  3J81 S;  3BK1 A;  1TKY A;  1SE2 A;  4ZRQ A;  3NVW A;  4NSO B;  2C9C A;  4REZ A;  2J53 A;  4RH6 A;  4AKH A;  3V05 A;  3QWL A;  1IM2 A;  1T3T A;  3TQS A;  3RFZ B;  1XLQ A;  1WXQ A;  4IBJ A;  4LJ4 A;  1JR3 D;  3URY A;  4FWD A;  2CJN A;  2BS4 B;  3LXF A;  2WXL A;  4XDD A;  1K53 A;  3B9J A;  2Q2E B;  4GMQ A;  1S3S A;  3K8Z A;  2F5P A;  4BOQ A;  4D80 A;  1R7S A;  4JI4 M;  3U6E A;  1JRO A;  4Q2J A;  1XLN A;  4JI7 M;  3I4V A;  4P6V F;  3VDU A;  1IN7 A;  2QP9 X;  2J52 A;  4L23 A;  2CV2 A;  4BBA A;  4JI3 M;  1GL6 A;  3AN1 A;  1N60 A;  3RNV A;  4TQ1 A;  1DOY A;  3AE8 B;  2BJW A;  1FD6 A;  1PM5 A;  1VJK A;  1TS4 A;  1E32 A;  1FNV A;  3DA1 A;  1JWU D;  2VQF M;  2R4E A;  2K3U A;  4HJG E;  4KGS A;  3CIR B;  2QJL A;  3EGR A;  4LF6 M;  3C8Y A;  3NBI A;  4M0D A;  2INP E;  2Z3X A;  2WLB A;  3J80 S;  1JWS D;  1DGH A;  1N33 M;  5HG2 A;  4LJ7 A;  1EE8 A;  4A90 A;  1DGH B;  4HKQ A;  1KLG D;  1XCT L;  3Q69 A;  2AX5 A;  1IN5 A;  3VRA B;  3T1H M;  1C78 A;  1MI0 A;  5GKN A;  2HDE A;  2KWD A;  1FRD A;  3Q8X A;  3SAW A;  3PSE A;  1J7C A;  1AN8 A;  2WU2 B;  1IBX B;  3U6Q A;  3NWL A;  1TH2 A;  3L29 A;  4NZL B;  1TH3 A;  3A45 A;  1C4A A;  3AV8 A;  3U2S C;  3W5U B;  3GLG A;  1Q39 A;  1L5P A;  1I4R A;  5FKA C;  4NXM M;  3ETR A;  3KP1 E;  1QLB B;  2AQ2 B;  3PT2 A;  1QOA A;  1UGJ A;  2XEP A;  5F3W A;  2F5S A;  4II7 A;  2UUC M;  4MI7 A;  1E10 A;  4A55 A;  1YJI A;  3ZJT A;  3W5V B;  3PZ8 A;  4DR2 M;  4I4L A;  2KRU A;  1ZDX A;  1L0V B;  3IT4 B;  4QHS A;  4PD2 A;  2V6Z M;  1YE9 A;  4N59 A;  4DQO C;  4EE2 A;  3HKP A;  4PDI A;  1NNU C;  2RKO A;  1SE4 A;  1FNN A;  3CF0 A;  5LNK 1;  4KGR A;  2Y0T A;  4XBO A;  1V1O A;  5H92 C;  4RFB A;  5IRE B;  3ZJV A;  3PHX A;  5FTK A;  1GB1 A;  4L4U A;  1IN8 A;  1Z5B A;  3BVM A;  3MP9 A;  4JN6 A;  1TY2 A;  2W54 A;  3NS1 A;  3AMZ A;  3VRB B;  2QZ4 A;  2DHR A;  4A8X C;  2RMM A;  1FRR A;  4L15 A;  4IBK A;  1YMH E;  1PUT A;  2L7I A;  4L78 A;  5BMH A;  1R2Z A;  4TMA B;  2AGA A;  4B0M A;  3FIL A;  3K92 A;  4WUR A;  4KX6 B;  1Z5A A;  1D4B A;  1NSF A;  1QF6 A;  2PLP A;  1KSF X;  1OQR A;  1KRH A;  2OED A;  3OQC A;  2WXR A;  2J7Q C;  5HHD G;  2EA0 A;  3TL4 X;  4JI2 M;  2WXM A;  2V1C A;  2QSD A;  3L26 A;  3ABV B;  2FNA A;  3BII D;  3IT6 B;  1FIQ A;  2L52 A;  4NL4 H;  3SEB A;  2Z4R A;  2RGO A;  4AKI A;  1EM7 A;  4LFA M;  3IG8 A;  5ITX E;  4JWS C;  2EKI A;  2LEK A;  2KEB A;  2H88 B;  1C77 A;  3SMS A;  3HHY A;  4CHT B;  4JI0 M;  1L8Q A;  4GRI A;  1FFV A;  3TEZ A;  3CTW B;  3PNY A;  2QPA A;  4NAM A;  4D81 A;  4YY3 M;  3FTE A;  1L2C A;  1ROE A;  5TSS A;  2XH9 A;  2FFJ A;  7CAT A;  2BW2 A;  3KSX A;  3W9C B;  4WIP A;  3MP2 A;  2LGI A;  1Q3C A;  3Q8E A;  1WYG A;  1K52 A;  3SR6 A;  2C96 A;  1YN4 A;  2BB5 A;  4MM3 B;  4RF0 A;  3P42 A;  3KOW E;  4OU7 A;  4MAC A;  3IFU A;  2HL7 A;  3LVW A;  3THG A;  3IXS A;  1FFU A;  3NUH B;  1NI3 A;  3HVD A;  3L25 A;  4FCW A;  2ONQ A;  1QAM A;  3M7G A;  1I4P A;  4Z8X A;  3D8B A;  4ARC A;  1N32 M;  2J42 A;  1YQ3 B;  3ZCB B;  2M56 B;  3AOE A;  4C56 C;  1HQC A;  4FWH A;  2L7H A;  1PGA A;  4IDI A;  1TJE A;  3AB5 A;  1ZDV A;  3HJQ A;  3GPU A;  4LF4 M;  1SBB B;  1C4C A;  3RGP A;  2I2Y A;  4HXD B;  1VZ7 A;  2PTL A;  2Y20 A;  5FTM A;  3SFE B;  2D7H A;  5BPV A;  3FTC A;  3HWS A;  4D8I A;  1HA5 A;  1NVI D;  1QZM A;  2R62 A;  2YFQ A;  2CUZ A;  1OFI A;  4B7F A;  3J9C A;  1E6E B;  3TWL A;  4QNM A;  2DZN B;  1W5S A;  4AKG A;  3HU2 A;  3AEB B;  4XGI A;  5EE9 A;  3R2I A;  1BML C;  3N9Y C;  1UWX A;  2YNM D;  2Z7J A;  3UMM A;  3HRD D;  1YQ4 B;  1XNQ M;  3AH7 A;  5ITT A;  1IBM M;  3VLF B;  3AFH A;  3VKG A;  3Q8B A;  5C2T B;  5FLX S;  2K9X A;  3EA6 A;  1YUB A;  3AE9 B;  3AOE C;  4S12 A;  2DVW B;  2IPK D;  3KWV A;  2XNA C;  5D7G A;  4XE0 A;  4EIW A;  3J7A S;  3U6O A;  1ZE3 D;  4L8R C;  4ZRP A;  1JML A;  3PHU A;  1DGG A;  2L6O A;  2A5Y B;  1FJG M;  3L4P A;  3TEX A;  1IXR C;  3ZQ4 A;  2M0A A;  2R46 A;  4ZOH C;  3TWK A;  1T3Q A;  3H4M A;  1ZAE A;  1XLO A;  3GRU A;  4O1N A;  1FCL A;  2X8A A;  3T15 A;  1L0X B;  2KZU A;  2WDV B;  1TS3 A;  3AE6 B;  4JI6 M;  2J4X A;  5I4D A;  2CJO A;  4KOD A;  1BUI C;  3BVG A;  2BTE A;  1KFV A;  1Z59 A;  2PW9 A;  1X37 A;  3Q8F A;  2JTC A;  3MJ5 A;  3P4Q B;  2J7N A;  2Y3A A;  4M0W A;  1F2R C;  4YSY B;  3IAS 1;  2JZP A;  2ZAN A;  2CE7 A;  5G5G A;  2M5Z A;  1VR9 A;  1TS2 A;  3SC3 A;  1HQY E;  3HJ8 A;  4NSR A;  2W3R A;  2OQ4 A;  4LGM A;  4UDU C;  2UXB M;  1SSN A;  4A9A A;  5FTL A;  3AM9 A;  2R4J A;  5ITY A;  3FC4 A;  2H1R A;  2PIA A;  2INN E;  3WHK A;  2CEA A;  1MU5 A;  4RGO S;  2QEN A;  1XF5 L;  3FTF A;  1F0Z A;  1CJE A;  1UWM A;  4FVM A;  4BOS A;  3D8L A;  4OX9 M;  4AI6 A;  1SJH D;  4DV4 M;  3Q8C A;  5IT9 S;  5JXV A;  2GI9 A;  1W5T A;  3LQR A;  1IGC A;  2AQ3 B;  1K51 A;  2SAK A;  1WGK A;  2PMV A;  1E9R A;  1LV7 A;  2LHE A;  4AG5 A;  4DV7 M;  1SF0 A;  3U5Z B;  1HEZ E;  4YSZ B;  3BB7 A;  2R65 A;  1OQQ A;  1VLB A;  3U7Z A;  4KLN A;  4B3M M;  2BT6 A;  2G1E A;  2JSV X;  1Y56 A;  4XWW A;  1GLN A;  1N61 A;  4DUZ M;  1SEB D;  2MJD A;  3DWM A;  1JCK B;  3TSS A;  4KGT A;  3KS8 A;  4WWM A;  2KZS A;  1OFF A;  3M6A A;  4TSS A;  1IN6 A;  2XZF A;  5EZS A;  3B2G A;  3AE3 B;  4RCO A;  4BOZ A;  4US9 A;  2QBY A;  3B9P A;  3U6L A;  3SBJ A;  2G8L A;  3LMM A;  3P1M A;  1QIL A;  2DYO A;  5EXP A;  1L6V A;  1NNJ A;  3SFZ A;  1NVM A;  4JV5 M;  2HCB A;  1JWB D;  3V3X A;  1SXJ E;  4US8 A;  1C76 A;  2R45 A;  1M4V A;  3T1Y M;  2LFI A;  1MHH E;  2F5Q A;  4LG2 A;  2PKO A;  4AW4 A;  3J2P B;  3MK6 A;  3I57 A;  4B7G A;  1N36 M;  3FIL B;  4DV5 M;  4JX1 C;  1PFD A;  1SXJ C;  2FOI C;  4P16 A;  3H8H A;  2G5G X;  1YN5 A;  1FXI A;  3FUX A;  5H8Y E;  4LRT A;  1KF6 B;  1PJJ A;  3RFW A;  5KO3 A;  2GB1 A;  2BB6 A;  4JWU C;  2C99 A;  1H6U A;  4ITQ A;  1B1Z A;  1XCQ L;  1ZPS A;  4DR7 M;  3U5Z A;  2YEP F;  1UM8 A;  4X66 M;  3AJI B;  5EP1 A;  4YTP B;  2TSS A;  1IXZ A;  1N62 A;  4AS1 A;  3E4R A;  4ZYS A;  4FWG A;  3GPX A;  3VK7 A;  1C1K A;  3OWE B;  3DWG C;  3KOZ E;  3PNV A;  1EU4 A;  3SHF A;  3WHL A;  3KFU G;  3AE4 B;  2JYT A;  1HR0 M;  1I4Q A;  1SXJ B;  2WQY B;  1PVJ A;  3R8B A;  1QYR A;  4N58 A;  3GLI A;  1JW9 D;  4QNR A;  4AQY M;  5KPZ A;  2UUA M;  2FUG 1;  1QKZ A;  1I4X A;  5EE0 A;  1XLP A;  3GLG B;  3B21 A;  2KQ4 X;  2MEK A;  3NVY A;  2UXC M;  4IBI A;  3FD9 A;  1MPE A;  3GRY A;  3U6C A;  3PZ7 A;  3U6D A;  2BJV A;  3KOX E;  3EUB 2;  2BYT A;  1WSP A;  3TUO A;  4LFB M;  5DYG A;  5EP3 A;  4D8B A;  5T8I A;  2XLJ A;  2IDY A;  4PT5 A;  2W3S A;  3EIE A;  3NRZ A;  2CV1 A;  1TZO A;  3SHG B;  1IBK M;  4A5U A;  1VRA B;  3SYK A;  2NMQ A;  5FR3 A;  1TKG A;  1XEE A;  4IOI E;  1NJF A;  4B08 A;  5HFY A;  1DYQ A;  2ON8 A;  3R8F A;  1L4D B;  2OHF A;  3I4Y A;  3JR4 A;  3BVZ A;  1D6E C;  3PRM A;  3LQQ A;  2LWX A;  4HRS A;  2XFS A;  1NHW C;  1J7A A;  5BYR A;  1MX0 A;  2KXE A;  1OFH A;  2BNK A;  2JQR B;  2KA6 B;  1VDV A;  3CWI A;  4X62 M;  4IBG A;  2N7J A;  1NYQ A;  1SB3 C;  1GL7 A;  1NEN B;  4MGI E;  2LH0 A;  3NVV A;  2RGH A;  5FK9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...