4REZA

Crystal structure of the middle-east respiratory syndrome coronavirus papain-like protease
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
320
structure length
311
Chain Sequence
TIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTAPDFVAFNVFQGGHYVHARLKLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSDCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ORF1ab protein
publication title Crystal Structure of the Middle East Respiratory Syndrome Coronavirus (MERS-CoV) Papain-like Protease Bound to Ubiquitin Facilitates Targeted Disruption of Deubiquitinating Activity to Demonstrate Its Role in Innate Immune Suppression.
pubmed doi rcsb
source organism Human betacoronavirus 2c jordan-n3/2012
molecule tags Viral protein
total genus 79
structure length 311
sequence length 320
ec nomenclature
pdb deposition date 2014-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4rezA02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rezA01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4rezA03
4WURA 2FE8A 3MP2A 5KO3A 4P16A 3MJ5A 4R3DA 4OVZA 3E9SA 4M0WA 4PT5A 4RF1A 4OVZB 5E6JA 4MM3B 4OW0A 4REZA 4RNAA 4RF0A
chains in the Genus database with same CATH superfamily
4LCBA 1GVNA 5KO3A 3PZ8A 3UI3A 2OOBB 1KXRA 1CV8A 2LI5A 2M19A 1MHXA 3ZW3A 1N60A 2WXFA 4B7FA 2LHDA 2J7QB 1PJSA 3RT3B 2UUBM 2N4FA 4LGMA 3WALA 5EXSA 1KOTA 4IIWA 4MGHA 4LDTD 3RNEC 2D3CA 2ATOA 8PCHA 1PBHA 2FO5A 2KLCA 3AN1A 2JZPA 3BOWA 4IUMB 3PRMA 1UWXA 5J2RA 3R3MA 3SAVA 3U7DA 4K7WA 2A4ZA 3U6OA 2X38A 1XXHB 2G9HD 2OPFA 1J7KA 1YK8A 5JZEB 2KNAA 1K8RB 4NC6A 1N77A 2CHVA 2MEKA 4JI8M 4HCNB 3I51A 2YJ8A 1C4PA 1WYGA 1HQCA 3I4VA 1N32M 3ZIMA 2WBFX 1IY1A 2V6ZM 3AMZA 3TEXA 1UF0A 4G54A 4W5CA 3QAUA 3DBSA 1MDWA 2K6QA 1PPPA 1ESFA 4MEMA 4Q7JA 3NWLA 4MGKE 3CMMB 1CQDA 3BC3A 4YV8A 2BWEA 2V1UA 1WZ3A 2XSZD 5CHTA 4LJ9A 1N34M 1Z5CA 4PT5A 2TSSA 1V92A 2M5ZA 1P7EA 1VJKA 4MT5A 1SXJB 3C58A 2JZ0A 2L0FA 3JYUA 1D5XC 2F5PA 4JI7M 3F92A 1GAQB 4EFOA 2K6DB 4HXDB 3DWMA 4GDLA 3R66C 3AEFB 2Y20A 1WXAA 4ANXA 3RYTA 1IPGA 1FXTB 5BYQA 3U6DA 1UGMA 5JHAA 3FKYA 3I06A 3CBJA 4X64M 3Q8CA 2JQRB 1P3QQ 2DYBA 3LJ3A 3NY5A 2FCNA 5EE0A 2KANA 3TEYA 2ZVNA 5FTKA 3B79A 1NV9A 3IT6B 1WXVA 1FIQA 4G4OA 3DHHC 3J7AS 5TR5A 1QOLA 1X1MA 4MJSA 3ZJVA 1WJNA 3B9PA 2LXEA 3PV1A 2JXNA 2BYFA 1ZGUB 2ERCA 3TE6A 1U9QX 4EOYA 2C9OA 1ROEA 3IOQA 3KS4A 3HM6X 2YNMD 1BQIA 2D7EA 2IO2B 2RPQA 4FWDA 3QCAA 3HHXA 4K7SA 1PQSA 2DC9A 3SR6A 3IUTA 2BJWA 5DCNA 2KTRA 1THEA 2GQFA 3FD9A 4HPLB 4CHTB 3I3TA 4AW4A 2CHXA 2PEAA 2FRQA 1FFVA 2PJHA 1FFUA 3QA8A 4DR6M 1YJIA 1V8CA 2RKOA 2LWPA 3M6AA 2BF8B 4KSLC 5AZHA 1NHGC 1OAOC 4XZ4A 3ZC7B 4NRWA 3H7DA 2PVOD 3DPDA 4DK5A 3BWUD 2MP2A 2I1JA 3N1YC 3FYDA 1L4DB 1F9JA 2BWBA 4GUAA 3GLFB 3V60A 3Q3OC 4LJ7A 4JI6M 2R18A 1D4BA 2Y6EA 2C98A 1ZXHA 2M4NA 3LVVA 1NBFC 1XEEA 1YN5A 4X57B 3R9XB 3E1ZB 3U8EA 2OOBA 5EE3A 4WH4A 4HL4A 2DC6A 2OJWA 2OO9A 2L7HA 1T6BX 4YYVA 2J7QA 3JVZX 2JT4B 1PPOA 1NPZA 3HHAA 3I4YA 3LCUA 1ET6A 1MS6A 4YXDB 4EE2A 1WGHA 3AEAB 2D10A 5FK9C 2MH7A 2LVQA 1WGDA 4G50A 2Z59B 2ZJDA 2O25A 2OOAA 5IN7A 3LDZE 4W9DA 2JY7A 4IUMA 3T3OA 1V5OA 4GMQA 2L2DA 2PE9A 2QCZA 2LVQD 3QARA 1IY0A 1E6EB 4FJVB 3V05A 1DGBA 3C0RB 1L8QA 1XXHA 3ZVVA 3M3JA 1WGLA 5JZEA 1C9FA 1F29A 2FCQA 3RFWA 1NSFA 2UXDM 1QZMA 1MX0A 4PADA 4TSSA 4IM0A 1YE9A 2JRHA 2W3SA 2JQGR 4IOIE 4DV3M 5F02A 2XBBC 3HY5A 3LYYA 1XXGA 2C7NB 4QRXA 1UBQA 5LXIB 4GC9A 2INCC 3HD3A 4KSKC 1FD6A 2VF7A 4I8OA 2E01A 4YYQA 2YJBA 2MH8A 2QP9X 2ZNVC 4C7YA 2Z84A 3MORA 3A45A 2MJDA 1YNTE 1YQ4B 4JE3B 4WAAA 4BOUA 2KC1A 3GZNI 5FTNA 4ZYNA 1M94A 1GABA 3NZ3A 1UM8A 4QH6A 4ZRJA 3VDZA 5KHQA 2NPTB 4DDGD 3K1JA 1TS5A 2BPSA 2KDFB 1T3QA 1SXJA 3PTFC 4Q2JA 1WXSA 4LJ4A 3J7BA 3KH0A 1OIZA 2Z8LA 5KQ8A 1ACCA 1VEKA 4OHJA 3A9KB 5H92C 2LNHC 1VZ6A 5BMHA 4HXDA 4AKHA 1ZMWA 1YSYA 3Q3MC 4MSXA 2MBOA 1K53A 2XNAC 4X66M 1QUTA 2VF8A 4JL9A 4B6WA 3KOZE 1SXJD 5FTMA 2K9DA 2DBYA 4OX9M 1T0QC 4DDID 3VRAB 4BOZB 1BUIC 1ZXIA 4WJOA 3ONSA 5CX3A 4BOSC 4YSXB 4I07A 2DZJA 2NBWB 2C96A 3AU4A 2DAMA 2J0JA 3H4MA 4HLQA 3I5JC 3L2AA 1C4AA 2R4JA 2ACZB 2Y21A 4OVZB 2R9CA 4D80A 2GBMA 3GLIA 1S1QB 1YJJA 1F1HA 4NOOB 2K3UA 4GIVA 2LHEA 1KFVA 1CVZA 3KW5B 3AE5B 4ZOHC 3T15A 3TIXA 4DR7M 1SGHA 4TV3A 4A3PA 2RSUA 4K0KM 2V1YA 2DVWB 2PKOA 2CRUA 3PSEB 3QC8B 3DOAA 1IBXB 1YVBA 3VTWA 1IFYA 4YTPB 2AQ2B 2R2OA 1MVKA 2OZ2A 2W54A 2FT2A 3ILKA 1V5TA 4FWHA 2N7JA 1XXHE 2DXIA 3H8CA 2PPHA 3MC8A 2V4IB 3PPAA 3RPFC 3BPFA 5LMNM 2JVCA 1WJUA 1AYWA 4TUUA 5ITYA 4KO8A 2CHWA 4HWYA 5G5HA 1CJEA 1SIFA 1FCLA 3RE8A 1HJPA 1VZ7A 4F1IA 1MPEA 3UINB 4WIPA 4EZLA 3TQSA 2JNHA 3ZNGC 3TNXA 1UNSA 1GC7A 4RCOA 1T5XD 4W9CA 3ZTDA 1YUBA 3K8UA 2L7RA 2DZLA 2HJ8A 1D0KA 2HTHA 4JLCA 4M8NA 5C1ZA 2ZAOA 1EU4A 3FAHA 1F2RI 3GLFA 2DZIA 1SF0A 2GB1A 1R4MB 1HR0M 1I4PA 1WRIA 2NVUI 4M0WB 5E26A 2WNMA 1EFUB 1SXJE 2GMIC 2OHFA 3IAM1 3L08A 1DO2A 3ZGZA 3OAWA 4DXFA 4A3VB 1WX9A 2R44A 4L78A 2EKEC 5KQDA 1XLPA 1V97A 4AOFA 3P4QB 4JIOU 4AXMA 5C1BA 3KUDB 4XZXA 5D6JB 3Q3NC 2C99A 1VZ8A 3JSVB 4OZBA 1YMHE 3DDCB 2L05A 3V3XA 1NB3A 4JGHB 2WXKA 3TRKA 1ZMVA 4LF6M 1UKFA 3BVMA 2HD5A 3AE6B 4OELA 2O5RA 4BB9A 3AU5A 5DYIA 3TL4X 1WRDB 2FYEA 2CHZA 1RFKA 2DZYA 2IPPB 4LY6A 3PXGA 1DOXA 3GLIE 1LXDA 4FN2A 2ZTCA 3VFDA 2EMTA 3C0RA 1JWMD 1IBMM 2N9XA 4IG7B 3UIOB 1YQ3B 5C23A 4ASWC 1EE8A 4AWJA 2XEWA 2H5XA 1V33A 5D3IB 2E5LM 2WHIA 4KLNA 3L0WB 1C4CA 4WW0A 1R6BX 2B3TA 3AH7A 3OJ4B 5K16A 1Z6TA 3WHKA 1XKGA 4Q8GA 3VUWA 1OEYJ 1TS2A 4KGRA 4DR1M 1NEKB 3KUZA 3AB5A 3U6CA 1EWMA 1ICFA 4MH0E 4LF8M 2BS2B 2KWDA 1KYIA 4MSQB 2MGWA 4BFRA 3IAS1 2LD9A 2ZTDA 3DVNU 3IXSA 4W9GA 2APLA 1R2ZA 2CKHB 2NPTA 2YLMA 1A5TA 4ZYSA 4PP2E 3SFZA 4PP1A 1JALA 4P16A 2WU5B 4XGAB 2WXJA 3RZFA 1R5LA 1E90A 3LB8C 1ZDVA 3A9KA 4HPMB 1I42A 3AULA 3PBHA 4B0MA 4LNNA 3KSEA 4IJFA 1XLNA 3BCNA 2EUCA 2CJNA 2RDHA 4UN2B 4IW0A 1PM5A 3GRRA 4XDDA 1EWYC 4DUYM 3GLFE 2KC2A 2L6OA 3Q69A 2WXRA 1V81A 1U4AA 4FIPA 2PADA 1K52A 5CTRC 4S0RA 2KYWA 3ZNHB 1I4XA 3THGA 5EE1A 1ZW7A 1EWLA 4LNFA 4BPVA 1IGCA 3KVFB 5ITUA 1MHHE 3Q8XA 2C5LC 3LMMA 2K9XA 1V34A 1F0ZA 2MBQA 3MHHA 4ACFA 4OVZA 2K5PA 4KT0F 4GGQA 1TZOA 3N4CA 1F52A 3W5VB 3IVFA 4I4LA 1PJQA 3FRHA 2WP9B 1U5IA 4IBJA 1I7HA 2J0KA 1IQPA 2JY5A 1WGKA 4FULA 1TT5B 2C9WB 4IKGA 3PSEA 3UQBA 4QHTA 5L8RF 2Y5PA 3OF8A 2XFSA 4R7GA 2UU9M 4N8WA 2V3NA 3KSJA 1WGYA 2LEKA 4LRTA 3RGPA 2XZUA 2KD0A 3AEDB 4GOCA 3ZRFA 3KOWE 1N61A 1J5EM 2HWJA 2JZ1A 3SYLA 1OQQA 2F5OA 2IY1B 2UWQA 1J7CA 4L4UA 2JYEA 4LFAM 2KWUB 2FFJA 1BGOA 3BINA 2W82A 2CEAA 3L54A 2DX5B 3N3GA 1GB1A 2QC8A 5FPWA 2WYQA 1HNXM 2R2QA 3PGEA 1XNQM 3USVA 3H9DA 3IG5A 4LFBM 3DBHB 1Q39A 1T3TA 2XLJA 1RLFA 3K9MA 3RUIB 2VHFA 3NBIA 4RY2A 4KODA 2Y3AA 1Q0WB 3AL0C 3C9PA 2ZEQA 3TWLA 4M0WA 5HI1A 1KLVA 2JQFR 3ZNID 1TYGB 3RZWC 1Z5SB 1DOYA 4FJYA 3T3NA 1UELA 5ITXA 3SAUA 2DENB 4RM9A 3HM3A 3GE8C 3L13A 1C3TA 4TKNA 4JQWC 2GBKA 4P17A 4DV6M 2MCNB 4S17A 4GDKB 4ARCA 1ZCMA 1XWIA 3CF6E 3JSVA 1DOIA 3GPPA 2W9NA 2KNBA 3OTOM 1ZOYB 3MFGA 1LQBA 1SNKA 2XZFA 2KXJA 5HG2A 4D8EA 1SE4A 3IHPA 2JWUA 4I6PA 2OJRA 1GC6A 2AYNA 4YYWA 3IEJA 3OWEB 4K7UA 3ZDMC 2XH9A 2M8SA 3ZXVA 4JWUC 3I04M 2X8AA 3AE1B 3I57A 3AOEA 4NNJB 1L2NA 1GLOA 2KJRA 2N1WA 2QDFA 2V3SA 3W0FA 2NQDB 1QDTA 4YL8A 2R4EA 2WXHA 4B3TM 2C7HA 2NQ8C 3H7SA 3PT2B 2K0BX 3PW3A 2N35A 4M9XA 4OU7A 3FYCA 1TL9A 2QQ8A 2SEBD 2HCBA 4C4VB 3Q6BA 3EUB2 4GHLA 4J3OD 4RGOS 2Q2EB 3VDUA 1NY6A 4QOSA 4AJYB 2FIFA 4D82A 4FD2A 5EXTA 1TKGA 1LO5D 1WE7A 2Y5BA 3U6EA 4REZA 4YYRA 1BT0A 4N59A 3L10B 1QILA 2DCCA 3AXCA 1WZ0A 3AOGA 1DYQA 2WLBA 1FM0D 3ZNZB 3L25A 1OJLA 1FRRA 3SMSA 4MB7A 1ZP0B 2YJ2A 1FJGM 2DNAA 2MA9B 5CHFA 1HZ5A 3HHYA 2K8BA 2KO3A 2BTWB 2IJ0A 1TGUA 1KLUD 3PZDA 3ZNHA 4BSQA 3WA0A 3HIZA 3N32A 3X0WA 3J2PB 5ITXE 4I04A 4X65M 1JCKB 1MEMA 7PCKA 1Z5AA 2K6BA 1JWBD 3I63C 2K39A 4ZRIA 3DVNV 1HTOA 2DJFB 1EIJA 4ANVA 3K92A 1TKYA 2BQQA 2LGYA 1PDXA 2R6NA 1UH6A 1YQBA 4DHZB 1DO0A 4WJQA 3S3QA 2G6DA 3KX1A 3GLHB 5CHVA 1DGJA 3Q3FA 3KWLA 3K9PB 3KYDD 3B08A 3IT4B 2XK5B 4TUWA 3A4RA 2PREA 3L26A 4W5BA 2PE6B 3HJSA 2D5GA 1SJHD 2C7MB 3H8HA 3B7QA 1PIPA 2G7YA 4Q8HA 1Y56A 1TF0B 3DHGC 3H8BA 1GJSA 3H7PB 3FC4A 4I81A 3AE7B 2PMVA 4GXBA 4YSZB 3D6SA 3BYYB 1JWSD 2ZW1A 4XWWA 3M99A 3RNBC 2ZBKB 3OLMD 3VRBB 2WXQA 4XUIA 1IM2A 3GQ4A 2XN9C 3KKUA 5J94A 4QOZC 2K25A 3IG3A 4DQOC 2KFJA 2JSVX 4HKZE 3MHSA 4GHAA 2ICIA 4ARIA 1BY8A 4N79A 3B1LX 2LVPC 4W9FA 4RF0A 3Q2AC 2MROB 2DCDA 4DBGA 4B0EA 1HXYD 4IBCA 1MI0A 3MHSD 4A6QA 5IT9S 2O01F 3UF8A 4QBBA 1ZE3D 5JHBA 2DENA 3GRUA 2L8JA 2FIDA 2VHSA 2RDBC 1FO4A 4GDKA 1AIMA 1VEJA 1GOZA 3GB1A 2IO1B 1NLJA 4DXAB 4IWQA 3V6CB 2J53A 3VKGA 4CZWA 4CJ6A 2RMMA 4A8XC 3IV2A 4WJPA 1IWDA 4MGZE 4ZTBA 5A24A 2YEPF 3HHMA 3N9YC 1ZPSA 3V62A 1MG4A 2GLSA 2LFIA 3NOBA 4US9A 2MBEA 3GRYA 2DHRA 1HQRD 2DHZA 5BPVA 1H4RA 1SJED 3SEBA 4NRVA 2WDRB 3QAQA 2O6XA 2ONQA 1GJTA 2JY6B 1S3SA 3I01M 4WJNA 5PADA 3SAWA 4DV4M 3EECA 1A6RA 3W1SA 4FHJA 3RNVA 4ZUXU 3VLFB 2LRUA 4NQLB 2MR9A 4IM3A 1Q3CA 2N7EA 4MSMB 1V6EA 1PGYA 3UK6A 1D6EC 3AEGB 4AXLA 2NTTA 3PT2A 1EUVB 2O6VB 4NY0A 4ZRQA 2X8XX 3ZJTA 1MIRA 3DF0A 4YSYB 3AE2B 3QSDA 4C4VA 3TEZA 2RDGA 2EA0A 3TMPA 4LK0M 4CDCB 2KW0A 3H4JA 3T38A 3ALBA 1DGFA 4HEA1 3GP7A 1GL6A 2EMSA 1N63A 4ANUA 3RNAC 1QF6A 2XU1A 3LFYA 1XCTL 1MN3A 1YALA 2FRAA 1PGXA 3O0UA 2LBCA 1UD7A 1R4NB 1IGDA 3CBKA 2V1CA 3CF2A 5I4DA 4LF9M 4C56C 1WJ4A 2WXGA 3L28A 3ZUAA 2KX3A 4L2YA 2DOSA 2LVAA 3OJ3A 4AQ7A 4AQYM 3OISA 5BMGA 1OAIA 5C2TB 4FJZA 2BTWA 3PRPB 2QCUA 1XT9B 1ET9A 1XMQM 2LXAA 2NR2A 2N9LA 1E9RA 1T0RC 2J7NA 1AYUA 4M8MA 5H37D 3IFUA 1FEHA 1XLQA 4KDLB 3N1XC 2HDEA 3ZXRA 3U30A 3DHIC 3P5XA 2KRUA 1E8WA 2N9KA 2EKFA 2JUJA 1QOGA 3ZDTA 2KJHB 4D8BA 4RFBA 3DOWA 3SFDB 1G41A 2AHMA 4WQOB 2DZMA 2KMAA 3ML8A 3S2AA 3A98B 2ON8A 1KFUL 3FILB 5C18A 1WWTA 2HXZA 3K9OB 2DWQA 3U52E 4RH6A 3VUYA 3GLHA 3R2IA 1CB5A 4AZFA 2DYOA 3TWMA 3A42A 4Z6YA 5BMIA 2P0RA 3DQVA 4W9EA 4PD2A 4CISA 2XK5A 4KDIC 3AEBB 3NVYA 2DI0A 3P4SB 2LH0A 1O0EA 3VUXA 1V1PB 1WR6E 1NENB 4HROA 1T0SC 1F2AA 2L00B 4TQ1A 4HWIB 1QOFA 1VQ1A 4L8RC 3K8ZA 3MTVA 1E8XA 2SAKA 2FUDA 1R2YA 3H7PA 4IM2A 4MI7A 1P7FA 2Y0TA 2MHJA 3KW9A 4BLCA 4B3MM 4NAMA 1GECE 1IN8A 3U6MA 2J7OA 2DYMA 4JX1C 1JQJC 2HJ1A 5KPZA 3U2SC 1EWCA 2M0AA 2JZZA 1KHQA 3NRZA 2DWLA 4RGNA 3HHZA 3ZH9B 1SE9A 1DGHB 1E7UA 2L0TA 3DBLI 4JI1M 4KX6B 3K2LA 1ZV1A 7CATA 1W5SA 1F2RC 1MJGM 4JI3M 3QWZB 4Y28F 2QIEB 4YHHM 2ARYA 5EE9A 1P1AA 4K81A 1UFZA 3U60B 2DC8A 1CQVA 1L5PA 2KDEB 4AG6A 5IAAC 4LTUA 1J7AA 2JZ3B 2WXNA 3B74A 3BB7A 4JPSA 2B1MA 5G2NA 3GCBA 4AG5A 2ASQA 4LZZA 4MACA 4M9ZA 3UQAA 2LHCA 4IWOA 2HHNA 3QIJA 3A9JB 1PXVA 1VJVA 3TWKA 1SE3A 2QNJA 1T0YA 5D2MB 3BYTB 3DBHI 1OTRB 3K24A 2KRKA 2JXXA 1ISNA 2R9OA 1I4QA 4L15A 2IO3B 1NJFA 2L09A 3P5WA 2J4XA 1EF1A 1VSNA 2AIMA 2RRUA 1QOBA 4NJ6A 4F2LA 2FH0A 3OF9A 4A90A 3SYKA 1Z5BA 2YJCA 2JY6A 3VTUA 2KQ7A 2Q5WD 4FCVA 2J7QC 4DHZE 2NQAA 4ZHPA 3HX3A 4FJCA 2DLBA 1E0ZA 3AEEB 3GS2A 4WQMA 5G55A 2AQ1B 4S12A 2Z8YM 1C7YA 3GLHE 2R45A 3KVWA 5HFYA 4BBAA 2K47A 1GO5A 1KFYB 2O2VB 5FR3A 2FNAA 3SC3A 3V6EB 4NL4H 2KFKB 2O6VA 3CWIA 1F77A 1G8PA 1OIPA 2UU7A 1TJEA 4GU2A 5CHWA 4LNOA 1WF9A 3DCGA 4ICUA 2BU3A 1VRAB 4QRVA 3NBXX 3GPYA 4FVMA 1RWSA 2J52A 4MZOA 2KDBA 4PYZA 3RVVA 4EKUA 1YJ1A 3SMPA 2VZKB 1BVSA 3UIPB 4DR2M 3A46A 1K3BB 3ENEA 2KQ4X 3T1HM 1ORYB 2D2QA 3BK2A 4MM3B 1HZ6A 1IBKM 1FNUA 2BGFA 4LRSA 1Q6KA 1N78A 2IYDB 4JN6A 1K3XA 2ZCBA 3R8BA 4PCZA 3SBJA 4DV1M 1KTKA 1N5WA 1D0MA 4C7ZA 5EP1A 3BVZA 4CO7A 3PRPA 2E6XA 2IGHA 1WGGA 1OFIA 3ZJUA 4B08A 2R61A 1Z59A 4N6EB 5IKCM 3RNGC 3ERVA 1SXJC 4HDOA 5DPWA 3LVWA 2RD0A 1F2CA 1RYJA 5CVOB 1IXZA 1RRBA 1Q02A 3CF0A 3HHIA 2E02A 3HU2A 3T1YM 1OFFA 3B7ZA 3ZUNA 4KIKB 2HL7A 2LJIA 4LGYA 1E32A 2LVNC 1K3WA 3RFZB 2KNVA 3N30A 2FTDA 5BYSA 4I6NB 3P5VA 1JWAD 1FNVA 3K9OA 1AARA 1ITOA 4LF5M 5DFLA 1XNRM 1IYFA 3RULA 3QJZA 2DAJA 3ZLZA 1LFDA 3PREA 1Z2MA 3VTVA 2CHGA 4HPPA 5AZFA 4DV7M 1CPJA 4FA6A 3OVXA 1IN6A 1QAOA 2JA2A 1WMHB 2OEDA 4ZRPA 3VHTC 3FRIA 2YR0A 2KN5A 3MC9A 1GB4A 3E46A 8CATA 2QBYB 4I6LB 1EWOA 2AUZA 4NPNA 1TKEA 5EXPA 2KNZA 3FE3A 2IBIB 2H7JA 4BVUC 2DCAA 3KWVA 4B7HA 4AI6A 1A70A 3L27A 2FNJB 3NJTA 1JROA 1F2BA 1DGHA 4G3OA 3O65B 2KHWB 2CUZA 3HWNA 2C60A 2JTCA 1I4GA 3PLUA 2UUCM 2RGOA 3HRDD 4W9LA 3DA1A 2RR9A 3GPXA 2AYOB 1I4WA 5EGWA 2KDMA 3U60A 3AI5A 4K7CA 1DF0A 1WHCA 2RGFA 3ZKJC 4R71A 2IY0B 5E6PA 3GPUA 1C1KA 2N1VA 1KF6B 5ITQA 3GE3C 2B76B 2L7IA 2CWBA 1JR3A 3MP2A 3FTCA 1VDLA 2PBHA 3JAMS 3A9JA 3UZUA 4FHKA 4LF4M 3AJIB 4G4RA 1TY2A 4O1NA 1IUEA 4EZJA 3KXEC 1AUAA 2Z0DB 4ANWA 4CGYB 1OTRA 1JR3D 2JP7A 3KSXA 1J09A 2D11A 1QVRA 2NS5A 2WXPA 1ZAEA 3ZO5B 1ATKA 4BOZA 1FH0A 3AV8A 1FNNA 4TMAB 4BOPA 3E4RA 4OEMA 4NSOB 2JRIB 4PDGA 1TY0A 2Y5CA 3SU8X 4K3BA 2G3QB 2W3RA 4KKIA 1BP4A 3S3RA 3AE8B 1TDZA 3TPZA 2BKRB 2MJEA 4IC7B 3PHXB 4GRIA 2O2VA 1VCBA 2DHYA 4A5UA 4IBKA 2NBUA 2QMTA 2KFKA 3OQCA 1KSFX 3APFA 4PI3A 2HTME 2VRRB 2F5QA 4WWPA 3AE9B 4B95A 4P6VF 3FTDA 1OGWA 1BMLC 1IBXA 5GXGB 1HA5A 3HUIA 2LZ6A 2GNOA 1CSBB 2B3AA 5JI3E 4AKGA 1EWPA 1MU5A 1AYVA 3RNCC 1V80A 1I35A 5FTLA 1SEBD 3W1YA 2G8EA 3JW0X 1HE8A 2J0MA 2F4VM 2AVWA 2Z0EB 1JB0F 5IO9A 1EF5A 3KFQA 4RGMA 4MM3A 2M60A 3U6LA 2K22A 2H89B 4I05A 1QQWA 5LMUM 4JI4M 2VIIA 2UYZB 3W2DA 2DWMA 1B9RA 2CFOA 1SP4B 3D8LA 5FR6A 1AU0A 3U7ZA 1D3ZA 5JXVA 3HJ8A 3EIEA 4GKKM 2CV2A 3CH2X 3BY4B 3GZNB 1TH2A 1QMYA 3KUCB 2AUXA 4MH8A 1L7YA 1FNWA 2QENA 1JR3E 4FK5A 4QRGA 3Q8GA 2DJGB 3P5UA 3H1UA 1PCIA 1NNUC 4KIKA 2LVOA 4FW9A 4LG2A 3T8MA 1AU4A 2KZUA 1R7SA 5BYRA 1JMLA 4B3RM 4NQKE 2ZM6M 1VR9A 4A3OA 3OG5A 4MELA 2BT6A 2D3AA 3GP1A 3APCA 2K1FA 2JPHA 1E9SA 3ML9A 4LCDE 4M01A 5DPTA 2BB6A 3AV0A 2K8HA 4BS6A 4JYAM 1LM8B 2EO2A 3FUWA 1TS3A 2YQZA 2RPVA 3X23A 4BKTA 3NZSA 3QWLA 2KMMA 1WMHA 1CZPA 3C3EA 3EA6A 4LNKA 2BWES 1L2BA 4HJKA 2MW5A 2QBYA 5E6JA 2KX0A 1L6VA 1E7VA 1PFDA 3RD2A 1IN7A 5JI2E 4XR7A 3Q8FA 2DAKA 2IBIA 2Y0QA 1Y08A 2XU5A 3KWBX 1UGJA 3TSSA 2QPAA 2NCNA 1NDDA 4A20A 2UUAM 2WU2B 2DAEA 4GDLB 1M6DA 5TSSA 4LFCM 4KGSA 1E8ZA 1LV7A 1PGBA 3NVZA 3O65A 1N75A 1V49A 3PZ7A 2EKIA 4CDEB 5A2QS 4RKUF 3VK7A 1S3SG 3QX1A 2DKLA 3H6SA 1RM6C 1KJTA 2KZSA 4FWGA 4UDUC 2AYOA 2GBRA 5CVMA 4HCPB 2XEPA 1KHPA 3VFKA 2MWSB 3ZQJA 1XCQL 1XB2B 4HVBA 2G8LA 3PLVA 5HKHA 1FMAD 2A5YB 3PNYA 5KHOA 3RI7C 4G3XB 3CIRB 3BK1A 2E3TA 4XC2A 4LLGM 2L83A 1GMYA 2CIOA 2LWXA 1SE2A 4ZPXA 4W9IA 2JXTA 2YFQA 1N6ZA 2FE8A 2HKJA 2LXCA 2AU1A 4XYCA 2FCMA 3SHGB 1J0GA 4URKA 4LJ8A 4FCWA 2J5YA 1VD2A 3MTNB 4P6GA 1QUSA 2ZPYA 3TL5A 4KZCA 4QHSA 2KXEA 2Z3XA 3N20C 3VR8B 1AECA 3O1GA 5KPTA 5E6OA 3IECA 4BAXA 4YVAA 5FTJA 4Z8XA 3P1MA 2FCSA 4KLBA 2ZNVB 5LXHA 2AWTA 4RNAA 1MHWA 4ICVA 2G3QA 2KHHA 1CMXB 2PW9A 3J9CA 1JWUD 4FXCA 4BS5A 1IBLM 1D5ZC 2KT7A 2G45B 3ETRA 4NXMM 1J8CA 1STEA 1ZDXA 4W9JA 2EELA 3H6NA 4L1BA 3PHXA 3PNRA 1ENFA 1PGAA 1MEGA 3AKZA 1GLNA 1L0XB 2BW2A 5FKAC 2MP2B 2DAIA 4EEWA 3IHPC 2JU6X 1UUPA 1NI3A 3ZYYX 1GJZA 2UXBM 2WXMA 1AN8A 3C9EA 4CYEA 5CVNB 1P0RA 2AL6A 4YWGG 1G6JA 3GRVA 1LTMA 2BBCA 2ZCCA 4DR5M 1KM7A 2KJ6A 3AOEC 4GITA 5EP3A 2ZPNA 2WZJA 2ZW0A 4GLSC 4PYUA 3VXWA 3WAOA 3PDFA 3SARA 4II2B 4NAWB 5F3WA 3Q14C 3GQ5A 1VLBA 1WXQA 3R8FA 4LJOB 2V0GA 1MFWA 2DCBA 1YLAA 5E6NA 4DMXA 2EJSA 3PNVA 2M0XA 1HEZE 2INDC 1NV8A 2KWCA 1PADA 5G5GA 1YD8U 5DYGA 2V9HA 5JH5C 2MJ3A 1TGZB 3GLGB 2OULA 3BPMA 1ZKHA 3TBLD 2WDVB 1WX7A 2BYVE 3KS8A 3NVVA 3TEWA 4X62M 3L4PA 3BY4A 2R9NA 4TQ0A 3U6QA 3PVLA 4HEOA 1V1OA 2GBNA 3EIHA 2QILA 2AX5A 5IWAM 1ZMUA 2QSFX 4JI0M 1IN4A 1E8YA 3U4EG 2K8CA 3BZDB 1UWMA 3CSFA 2A5UA 3UGBB 4H2AA 2XSZA 4WA6A 3GOEA 3TJPA 3LW5F 2CS4A 3B2FA 3WHLA 2H1RA 4QNMA 1Q10A 4KHPM 4DWFA 4LJAA 1IY2A 1WR1B 3VKHA 2QJLA 1TDHA 2VH1A 3EC8A 3RCZA 3IBEA 5AUKA 2KDLA 1QANA 1YIWA 1TH4A 1AU2A 3TCAA 1R4MI 4IBBA 2G4DB 3PHUA 2KVZA 2VDBB 1T6OA 5DPSA 3GQ3A 4E74A 1SSNA 1FCCC 1WJ6A 1ZIVA 3HK0A 2EKKA 2HWKA 1AWDA 3PFIA 2DZKA 5CHVC 1JW9D 4DR3M 1ZQ9A 2P5TA 3RGSA 1TTEA 4PS3A 3B7NA 3DVGX 2DNFA 2L32A 4JWSC 4XK8F 2GOWA 1C1YB 3P2BA 1S4VA 4USAA 4DR4M 2E03A 1OEYA 2XFTA 2REXA 3FUTA 2WSCF 4G11A 3VAWA 4M00A 4W5WA 3MP9A 5GMVA 1YN3A 3A1QB 1FPYA 4HKQA 4M02A 2NQIA 1E9MA 3GLIB 3NHEB 1L4ZB 1GCBA 2KAJA 3SFEB 3D32A 3KYCD 5LLIA 2FAZA 2MBBB 4HLEA 4XE0A 5H8YE 1ME3A 1A5RA 1NJGA 3KFUG 1STFE 2DC7A 3MTNA 2LGIA 4AJWA 4L23A 1MJDA 5EJCA 4W4UA 2LMCA 2ZANA 4JXJA 3E9SA 4M0DA 1JQPA 2M17A 4HJGE 2KOXA 2LGSA 4KKJA 2BKFA 4OZAA 2NBVB 4P1CC 3CH3X 1JRUA 5EP4A 4CDDB 1DGGA 1HT2E 3EFCA 1KFXL 3MHZA 3WIMA 1MG8A 2XF3A 5T8IA 2DWZB 1PPNA 1NO1A 3E56A 1VDDA 1QOAA 2VQFM 2QHOB 2MX2A 4PS8A 4GB9A 2WDTB 3MC0B 2NQGA 1LGRA 4CIZA 2JUOA 3U5ZB 2PLPA 4YYUA 2BS3B 2G5GX 4JI2M 1K50A 3K9PA 1IN5A 2CU3A 4ITQA 4XGIA 3AI8A 1WY8A 1FRDA 4F1SA 1SG9A 3W1SC 2WXOA 4OVUA 2G1EA 5EQTA 1DKIA 3OVZA 2WX0A 4BOSA 3DWGC 3LXFA 3C3DA 1NVMA 1WGRA 2MLBA 3PO0A 4FLHA 4NAWA 5D7GA 4NJCA 1QXPA 2KTFA 4BQVA 1QDRA 2LRWA 3B21A 2HH5A 2UXCM 2AQ3B 2CB5A 1JRPA 1WIVA 3NZUA 1E10A 1GG3A 4C80A 1QDQA 1QKZA 4BKGA 1X37A 1IXRC 1U9WA 3HGIA 1DEUA 1EM7A 3M63B 2BDZA 3WANA 1WYWB 3GLGA 4ZHOA 2X4AA 3UGJA 3HU3A 3V76A 4KGTA 4JV5M 5JA7A 2HD5B 2GBJA 3JR5A 1WGNA 1PE6A 3B2GA 2R65A 3HJQA 1WI0A 3IG8A 4AKIA 3HZJA 3U61B 2UZJA 2Z7JA 2MJ5B 1HQYE 1JQ4A 3QYBA 3C8YA 4FBJB 2R62A 2KACA 3KW6A 4IDIA 3HWSA 3WXEA 1PJTA 1VG5A 5IREB 2YEPB 4RM8A 1T43A 2L52A 1YZBA 1EF7A 4G6ZA 2D07B 1NB5A 1NYRA 4G4NA 3DBRB 3FTFA 5DPRA 3V6CA 1Y8GA 1B1ZA 3GO8A 1QZEA 3IMAA 1QQRA 2N0SB 2XU3A 2CJOA 5IZ7D 1P98A 1WR1A 5ITTA 3B9JA 3KP0E 1R7RA 4MGIE 1EO6A 4NZLB 3P4RB 2KEBA 2I2YA 1PRBA 2M56B 3AM9A 3VK8A 1GKIA 1DV0A 5KPRA 2V3PA 5AEKB 2F7DA 4DV5M 1NHWC 3TUOA 2BYEA 2KA6B 2WSEF 1IXSB 4WP2A 2X49A 1QAMA 1NL6A 1G3IA 1G59A 3WAMA 5J18A 2G8JA 3SASA 1XF5L 3ECIA 1WXMA 3AFHA 4RKXA 1M4VA 3W68A 2WS3B 2R9FA 2KWVB 3BXWA 2FUHB 2INNE 3URYA 4YYSA 3CSTA 3WXFA 3HVDA 2D3GA 2ZAMA 1TR8A 2BVCA 3KDSE 3PHWB 2NMQA 3APDA 3HVZA 2FUG1 3L29A 2BWFA 1XHBA 5EDSA 3Q8EA 4L16A 1PJIA 2BJVA 2L3ZA 2LJ5A 2C9CA 5L83A 2JY8A 2P7UA 1OKSA 3A1QA 3FUUA 2O6VD 1L2DA 2HE7A 1GL7A 2PVGC 4RGTA 2MSED 1L0VB 1N36M 3NHEA 2N9EB 5IP4D 2JF5A 2PIAA 2DAFA 3A4SC 4CQNA 1PJJA 3LQQA 4D2KA 4PS7A 2L4FA 4GH9A 3BVGA 3GLGE 3RVXA 1E94E 2AEHA 2R9MA 2LGXA 5EZSA 2N7DA 1CTEA 1ZUD2 1AIPC 3DFZA 2AGAA 4CHKA 2ZZPB 3JR4A 3N3KB 3SD5A 5DNYA 2IPKD 2OP3A 3AE4B 1FXIA 1QYRA 5IOIA 4RF1A 2CE7A 2LTUA 3F75A 3Q8AA 4GKJM 3ZRCA 5ITRA 2R0IA 1QLBB 2MBHA 4AP4C 2VQEM 1Q3BA 3IFWB 2B1NA 2WQYB 3LCVB 1NI2A 2QHOA 4XDCA 1D2NA 1TH3A 4US8A 4XX5A 2BNKA 4MDKE 1E5WA 2I38A 4P7IA 3FILA 3M7GA 3U5ZA 5BO4B 2HHHM 3SATA 3M95A 4GIPA 1G71A 4WWMA 4BKSA 4HK2A 2XGNA 1CJLA 4GSWA 2QZ4A 3O13A 4X6HA 3RVWA 1J19A 3L16A 3KQ4A 4IBEA 1V1PA 3QT4A 5L95C 2Z4SA 2KK8A 4BKSD 2L76A 3BWKA 4N58A 1NQCA 3E21A 3SHQA 1SXTA 3DVGY 2M1MA 4E71A 1IP9A 1HTQA 1OQRA 2IO0B 3NVWA 5JH3A 1G4AE 3ZCBB 1D0LA 1SBBB 2WXLA 4DHJB 5HHDG 1WM3A 3SHFA 2DZZA 5GKNA 2DWNA 4MGYE 2MRPA 1SIJA 3EGRA 3Q3JA 2CV0A 5EXXA 1C76A 3HHWA 2BYTA 4WWOA 2LASA 5EF4A 3KOYE 3A33B 3I9V1 4N4ZA 3J27B 3T6PA 4P6EA 1WM2A 2FBWB 1TBEA 2F1GA 4M9SA 1HT1E 2BTEA 2Z4RA 5FSWA 3U61A 1PUTA 3QHTA 4HDQA 1AU3A 4ITKA 3ZQ4A 1U9XA 4BOQA 4BBNC 4GC5A 3U6PA 4KVGB 4EIWA 1TTNA 1PPDA 3PVSA 3FKEA 5C3JB 3W9CB 1V86A 2HAKA 2WSFF 3MK6A 1E7PB 1H6UA 1V9JA 3QK0A 4NSRA 2KQSA 4X6JA 1YN4A 3M62B 3W5UB 2WDQB 2KVRA 2ACTA 3U6SA 3MJWA 2CV1A 3WCQA 1XD3B 5D3DA 2DAGA 4OZCA 1AW7A 2BS4B 3W31A 1YX6B 2MQJA 3LQRA 4IP3A 1WX8A 2AL3A 1EU3A 2IDYA 2Y5BB 3FTEA 2INPE 4P1BC 3T9LA 5EZQA 1OQYA 1IXSA 1SB3C 1I4HA 3F5VA 1YOVB 3BIID 1KLGD 2DZNB 3D8BA 4R3DA 4XBOA 2PTLA 1TLOA 2XU4A 2BDLA 1L0YB 2KLGA 3J81S 2WWZA 1K82A 1YT7A 4DUZM 1YX5B 1N62A 1U9VA 2W55A 3VR9B 1OFHA 3W0LB 1C78A 2I1KA 3NUHB 3MHVC 1GUAB 1C77A 2N9PC 3V6EA 1CK1A 2NTSA 4XWTA 3PHWA 4W9HA 4DMYA 2KMCA 2CHQA 4WWNA 1PVJA 4IBDA 1L2CA 2JWSA 1L1TA 4B3SM 4B9KA 1J7BA 1NNJA 4GEWA 1I94M 1R4GA 2ZVOA 5AZGA 4II3B 2WX1A 1WSPA 4K1RB 2L1AA 4ANRA 3W30A 2KN4A 2KZRA 4LDTB 1TIFA 3SDLC 3LXSA 4AUQC 1NY5A 3AECB 1HNWM 4OVVA 4W9KA 2GHUA 4NXNM 1POPA 4IWPA 1BXTA 3FUXA 2VZKD 4OW0A 3DBLB 1ME4A 4IBFA 3R7QA 4HRSA 2FQ9A 3N3KA 2KDIA 3N1ZC 4LNIA 1CUKA 5BR8M 4WURA 4A55A 4N9F4 3L17A 1NYQA 5EP2A 2LUEA 3FUVA 3P4PB 3KWZA 1I4RA 4F8CB 1NVID 1RFAA 3PRMB 2E00A 3QQ8B 3H89A 6PADA 4DV2M 1WH3A 1XC8A 1F4IA 3NS1A 1KH0A 2AS8A 1R4NI 3QJ3A 2C5RA 1QT9A 3ABVB 4GMVA 4RMAA 2GI9A 1FXAA 2WGSA 1H8CA 1RAXA 3AE3B 1WIAA 4PK1A 2D3BA 4YY3M 3BBZA 4YT0B 2FOIC 1C79A 1TZ1A 2C0YA 2H88B 3QYEA 4YTMB 2OQ4A 2BB5A 2QEJC 3CTWB 3PRZA 3EHVA 4DBGB 1V2YA 4YTNB 3WXGA 1P9DU 4BZAA 4KV2A 2V4LA 5D94A 2PNSA 2DZOB 2GRIA 1GPXA 1GNUA 3R7RA 3HKPA 2RGHA 2GFOA 1K51A 4F7ZA 3ZTCA 3B89A 2F5SA 1YK7A 2I7PA 2IGDA 4ZRKA 3BBAA 2D7GA 2QSDA 4FADA 4A9AA 1HUCB 1Q5WB 3VDPA 3RN9C 2FS1A 4IBIA 1XLOA 2YVCA 2IZVB 4DXGA 3VVWB 4CDFB 5AUIA 4D8IA 2I7NA 1Y4HA 3P63A 3R2TA 3MJ5A 3BOSA 1WE6A 4E3CA 1CS8A 2F5NA 4DV0M 4NJ7A 3Q8BA 4DHJD 2JYTA 5J17A 3C19A 2IGGA 1TU6A 3NS8A 2P86A 1Y8RC 2JX5A 4QNRA 2LHGA 3B0AA 1TS4A 2WXIA 3KP1E 3W67A 4J6IA 4EZKA 5LNK1 1WJ7A 1RU3A 4L6V6 4II7A 4G4QA 1XQQA 4LZJA 4MJSB 3NG0A 2LUMA 1XO3A 3PS6A 2CR5A 3WAPA 3U8ZA 4IJEA 1N33M 5MPOA 4KZ0A 1X9YA 2KKCA 4AS1A 2R46A 2JWZA 3P42A 3RNFC 4LJPB 4IBGA 2YJ9A 4JI5M 4K3CA 4WAFA 3TMPB 3M0EA 1AYFA 1Q1OA 3CGWA 4MZSA 2LGDA 1PYWD 1QAQA 3UMMA 4GN1A 9PAPA 2LVPA 2LVOC 3V61A 4ZDVA 4B7GA 2KTRB 5FLXS 4PDIA 4FCTA 3VH4B 1UZXB 4LJ6A 2JRIA 1D5MC 4X6IA 3I3TB 1L1ZA 3KLSX 1XMOM 3EFUA 4QAYA 2J42A 1W5TA 1UBIA 3DBRI 2CP8A 2D7HA 4LF7M 2G4SA 1VEGA 3KOXE 3J80S 4G0NB 3VH3B 3HU1A 4EUTA 4D81A 1VDVA 2CU1A 1P3QU 3MMPA 2K0PA 4C00A 2R6FA 4BBNF 1HNZM 3VQIA 3RMKC 4I5SA 2L4EA 1L6UA 5IA7A 4LJ5A 3DZDA 1WFYA 1N5XA 2VH2A 3UJNA 1KRHA
chains in the Genus database with same CATH topology
4LCBA 1GVNA 5KO3A 3PZ8A 3UI3A 2M19A 1MHXA 1N60A 2WXFA 4B7FA 2LHDA 2UUBM 4LGMA 5EXSA 4IIWA 4MGHA 3AN1A 2JZPA 3PRMA 1UWXA 3SAVA 3U6OA 2X38A 1XXHB 2G9HD 2OPFA 1J7KA 1N77A 2CHVA 2MEKA 4JI8M 3I51A 1C4PA 1WYGA 1HQCA 3I4VA 1N32M 1IY1A 2V6ZM 3AMZA 3TEXA 3QAUA 1ESFA 3NWLA 4MGKE 2V1UA 2XSZD 4LJ9A 1N34M 1Z5CA 4PT5A 2TSSA 2M5ZA 1P7EA 1VJKA 4MT5A 1SXJB 3C58A 1D5XC 2F5PA 4JI7M 1GAQB 4HXDB 3DWMA 3AEFB 2Y20A 5BYQA 3U6DA 4X64M 3Q8CA 2JQRB 5EE0A 3TEYA 5FTKA 3IT6B 1FIQA 4G4OA 3J7AS 3ZJVA 3B9PA 2LXEA 2ERCA 3TE6A 2C9OA 1ROEA 3KS4A 2YNMD 2D7EA 4FWDA 3HHXA 3SR6A 2BJWA 3FD9A 4CHTB 4AW4A 1FFVA 1FFUA 4DR6M 1YJIA 1V8CA 2RKOA 3M6AA 1NHGC 3ZC7B 4NRWA 2PVOD 3BWUD 3FYDA 1L4DB 4GUAA 3GLFB 4LJ7A 4JI6M 2R18A 1D4BA 2C98A 1ZXHA 3LVVA 1XEEA 1YN5A 3R9XB 5EE3A 4WH4A 4HL4A 2L7HA 1T6BX 2J7QA 3I4YA 1ET6A 4YXDB 4EE2A 3AEAB 5FK9C 2MH7A 4IUMA 3T3OA 4GMQA 1IY0A 1E6EB 3V05A 1DGBA 1L8QA 1XXHA 5JZEA 1C9FA 3RFWA 1NSFA 2UXDM 1QZMA 1MX0A 4TSSA 1YE9A 2W3SA 4IOIE 4DV3M 3LYYA 1XXGA 4GC9A 1FD6A 4I8OA 2Z84A 4C7YA 2QP9X 3A45A 2MJDA 1YNTE 1YQ4B 4JE3B 4BOUA 5FTNA 3NZ3A 1UM8A 3K1JA 1TS5A 1T3QA 1SXJA 4Q2JA 4LJ4A 3J7BA 2Z8LA 4OHJA 5KQ8A 1ACCA 5H92C 2LNHC 1VZ6A 5BMHA 4AKHA 1YSYA 1K53A 2XNAC 4X66M 3KOZE 1SXJD 5FTMA 2DBYA 4OX9M 3VRAB 1BUIC 1ZXIA 4YSXB 2C96A 3H4MA 4HLQA 3L2AA 1C4AA 2R4JA 2ACZB 2Y21A 4OVZB 4D80A 3GLIA 1YJJA 2K3UA 4NOOB 2LHEA 1KFVA 3AE5B 4ZOHC 3T15A 4DR7M 4K0KM 2DVWB 2PKOA 1IBXB 3DOAA 4YTPB 2AQ2B 1MVKA 2W54A 3ILKA 4FWHA 2N7JA 2DXIA 3RPFC 2V4IB 5LMNM 5ITYA 4KO8A 5G5HA 1CJEA 1FCLA 3RE8A 1VZ7A 1MPEA 4WIPA 3TQSA 1UNSA 4RCOA 1T5XD 1YUBA 2ZAOA 3FAHA 1EU4A 1F2RI 3GLFA 1SF0A 2GB1A 1HR0M 1I4PA 1WRIA 5E26A 2WNMA 1SXJE 2OHFA 3IAM1 1DO2A 3ZGZA 4DXFA 4A3VB 4L78A 5KQDA 1XLPA 1V97A 3P4QB 5C1BA 4XZXA 2C99A 1VZ8A 4OZBA 1YMHE 3V3XA 2WXKA 3TRKA 4LF6M 1UKFA 3BVMA 3AE6B 2O5RA 4BB9A 5DYIA 3TL4X 1RFKA 4LY6A 3PXGA 1DOXA 3VFDA 3C0RA 1JWMD 1IBMM 1YQ3B 1EE8A 5D3IB 2E5LM 4KLNA 1C4CA 4WW0A 1R6BX 3AH7A 1Z6TA 3WHKA 1TS2A 4KGRA 4DR1M 1NEKB 3AB5A 3U6CA 4MH0E 4LF8M 2BS2B 2KWDA 1KYIA 3IAS1 3IXSA 1R2ZA 4ZYSA 3SFZA 1JALA 4P16A 2WU5B 2WXJA 3LB8C 1ZDVA 4B0MA 4IJFA 1XLNA 2EUCA 2CJNA 2RDHA 1PM5A 3GRRA 4XDDA 1EWYC 4DUYM 2L6OA 3Q69A 2WXRA 1K52A 1I4XA 3THGA 5EE1A 1IGCA 5ITUA 1MHHE 3Q8XA 2K9XA 3LMMA 1F0ZA 4OVZA 2K5PA 1TZOA 3W5VB 4I4LA 2WP9B 4IBJA 1I7HA 1IQPA 1WGKA 4IKGA 3PSEA 4QHTA 2Y5PA 2XFSA 4R7GA 2UU9M 2V3NA 3KSJA 2LEKA 4LRTA 3RGPA 2XZUA 3AEDB 3KOWE 1N61A 1J5EM 3SYLA 1OQQA 2F5OA 1J7CA 4L4UA 2JYEA 4LFAM 2FFJA 2W82A 2CEAA 1GB1A 1HNXM 1XNQM 3IG5A 4LFBM 1Q39A 1T3TA 2XLJA 3NBIA 4KODA 2Y3AA 3AL0C 3TWLA 4M0WA 5HI1A 1TYGB 1DOYA 3T3NA 5ITXA 3SAUA 4DV6M 4GDKB 4ARCA 1XWIA 3CF6E 1DOIA 3GPPA 3OTOM 1ZOYB 3MFGA 2XZFA 5HG2A 4D8EA 1SE4A 2JWUA 3OWEB 2XH9A 4JWUC 2X8AA 3AE1B 3I57A 3AOEA 3W0FA 2R4EA 2WXHA 4B3TM 2NQ8C 4M9XA 4OU7A 3FYCA 2SEBD 2HCBA 3EUB2 4GHLA 4J3OD 4RGOS 2Q2EB 3VDUA 1NY6A 4QOSA 4D82A 4FD2A 5EXTA 1TKGA 1LO5D 3U6EA 4REZA 4N59A 1QILA 3AOGA 1DYQA 2WLBA 1FM0D 3L25A 1OJLA 1FRRA 3SMSA 4MB7A 1ZP0B 1FJGM 1HZ5A 3HHYA 2BTWB 2IJ0A 1TGUA 1KLUD 3ZNHA 3J2PB 5ITXE 4X65M 1JCKB 1Z5AA 1JWBD 3K92A 1TKYA 1PDXA 1DO0A 3GLHB 1DGJA 3KWLA 3IT4B 4TUWA 3L26A 3HJSA 2D5GA 1SJHD 3H8HA 1Y56A 3FC4A 4I81A 3AE7B 2PMVA 4YSZB 3BYYB 1JWSD 2ZW1A 4XWWA 2ZBKB 3VRBB 2WXQA 1IM2A 3GQ4A 2XN9C 4QOZC 4DQOC 2JSVX 4HKZE 4GHAA 2ICIA 4ARIA 4RF0A 4B0EA 1HXYD 4IBCA 1MI0A 4A6QA 5IT9S 1ZE3D 3GRUA 1FO4A 3GB1A 1GOZA 2J53A 3VKGA 2RMMA 4A8XC 4MGZE 4ZTBA 2YEPF 3N9YC 1ZPSA 2LFIA 4US9A 3GRYA 2DHRA 1HQRD 5BPVA 1SJED 3SEBA 4NRVA 2WDRB 2ONQA 1S3SA 3SAWA 4DV4M 3RNVA 3W1SA 3VLFB 1Q3CA 3UK6A 1D6EC 3AEGB 2NTTA 3PT2A 4ZRQA 3ZJTA 4YSYB 3AE2B 3TEZA 2RDGA 2EA0A 3TMPA 4LK0M 2KW0A 3T38A 4HEA1 1DGFA 3GP7A 1GL6A 1N63A 1QF6A 1XCTL 1PGXA 1IGDA 2V1CA 3CF2A 5I4DA 4LF9M 4C56C 2WXGA 3L28A 4L2YA 2DOSA 4AQ7A 4AQYM 5BMGA 5C2TB 2BTWA 2QCUA 1ET9A 1XMQM 2N9LA 1E9RA 2J7NA 5H37D 3IFUA 1FEHA 1XLQA 2HDEA 2KRUA 2N9KA 1QOGA 4D8BA 4RFBA 3SFDB 1G41A 2AHMA 3A98B 2ON8A 3FILB 5C18A 1WWTA 2DWQA 3U52E 4RH6A 3GLHA 3R2IA 4AZFA 2DYOA 3TWMA 3A42A 4Z6YA 5BMIA 4PD2A 4CISA 3AEBB 3NVYA 3P4SB 2LH0A 1V1PB 4HROA 1NENB 4TQ1A 1QOFA 4L8RC 3K8ZA 3MTVA 2SAKA 1R2YA 4MI7A 1P7FA 2Y0TA 4BLCA 4B3MM 4NAMA 1IN8A 3U6MA 2J7OA 2DYMA 4JX1C 1JQJC 3U2SC 5KPZA 1EWCA 2M0AA 3NRZA 2DWLA 4RGNA 3HHZA 3ZH9B 1DGHB 4KX6B 4JI1M 3K2LA 7CATA 1W5SA 1F2RC 4JI3M 2QIEB 4YHHM 5EE9A 3U60B 1CQVA 1L5PA 4AG6A 4LTUA 1J7AA 2WXNA 3BB7A 4JPSA 4AG5A 4LZZA 4MACA 4M9ZA 3TWKA 1SE3A 3BYTB 2KRKA 1I4QA 4L15A 1NJFA 2L09A 2J4XA 1QOBA 4A90A 3SYKA 1Z5BA 2Q5WD 4FCVA 2J7QC 4ZHPA 2DLBA 1E0ZA 3AEEB 3GS2A 4WQMA 2AQ1B 4S12A 2R45A 3KVWA 5HFYA 4BBAA 2K47A 1KFYB 5FR3A 2FNAA 3SC3A 4NL4H 3CWIA 1F77A 1G8PA 1TJEA 2BU3A 1VRAB 3GPYA 4FVMA 1RWSA 2J52A 3SMPA 2VZKB 4DR2M 3A46A 2KQ4X 3T1HM 1ORYB 3BK2A 4MM3B 1HZ6A 1IBKM 1FNUA 4LRSA 1N78A 4JN6A 1K3XA 3R8BA 4PCZA 3SBJA 4DV1M 1KTKA 1N5WA 4C7ZA 5EP1A 3BVZA 3PRPA 2E6XA 2IGHA 1OFIA 3ZJUA 4B08A 2R61A 1Z59A 4N6EB 1SXJC 3LVWA 1RYJA 1IXZA 3CF0A 3HU2A 3T1YM 1OFFA 2HL7A 2LJIA 4LGYA 1E32A 1K3WA 3RFZB 5BYSA 1JWAD 1FNVA 4LF5M 1XNRM 2CHGA 4DV7M 1IN6A 1QAOA 2JA2A 2OEDA 4ZRPA 2YR0A 1GB4A 8CATA 2QBYB 1TKEA 5EXPA 3KWVA 4B7HA 4AI6A 1A70A 3L27A 1JROA 1DGHA 2CUZA 2JTCA 1I4GA 2UUCM 2RGOA 3HRDD 3DA1A 3GPXA 1I4WA 2KDMA 3U60A 3GPUA 1C1KA 1KF6B 5ITQA 2B76B 2L7IA 3MP2A 1JR3A 3FTCA 3JAMS 3UZUA 4LF4M 3AJIB 4G4RA 1TY2A 4O1NA 1IUEA 3KXEC 4CGYB 1JR3D 3KSXA 1J09A 1QVRA 2WXPA 1ZAEA 4BOZA 3AV8A 1FNNA 4TMAB 4BOPA 3E4RA 4NSOB 4PDGA 1TY0A 2Y5CA 2W3RA 4KKIA 3AE8B 1TDZA 3TPZA 2MJEA 4GRIA 4A5UA 4IBKA 2QMTA 3OQCA 1KSFX 2HTME 2F5QA 3AE9B 4P6VF 3FTDA 1IBXA 1BMLC 5GXGB 1HA5A 3HUIA 5JI3E 4AKGA 1MU5A 5FTLA 1SEBD 2F4VM 4RGMA 2M60A 3U6LA 2K22A 2H89B 1QQWA 5LMUM 4JI4M 2VIIA 3W2DA 2DWMA 1B9RA 2CFOA 3D8LA 3U7ZA 5JXVA 3HJ8A 3EIEA 4GKKM 2CV2A 1TH2A 4MH8A 1FNWA 2QENA 1NNUC 4FW9A 4LG2A 2KZUA 1R7SA 5BYRA 1JMLA 4B3RM 2ZM6M 1VR9A 2BT6A 3GP1A 1E9SA 2BB6A 3AV0A 4JYAM 2EO2A 3FUWA 1TS3A 2YQZA 2RPVA 3QWLA 2KMMA 1CZPA 3EA6A 1L2BA 2QBYA 5E6JA 1L6VA 1PFDA 1IN7A 5JI2E 3Q8FA 2Y0QA 1UGJA 3TSSA 2QPAA 2UUAM 2WU2B 4GDLB 5TSSA 4LFCM 4KGSA 1PGBA 1LV7A 3NVZA 3O65A 1N75A 3PZ7A 2EKIA 5A2QS 3VK7A 1RM6C 2KZSA 4FWGA 4UDUC 2XEPA 1XCQL 2G8LA 1FMAD 2A5YB 3PNYA 3CIRB 3BK1A 2E3TA 4LLGM 2L83A 2LWXA 1SE2A 4ZPXA 2JXTA 2YFQA 2FE8A 2HKJA 3SHGB 4LJ8A 4FCWA 4QHSA 2KXEA 2Z3XA 3VR8B 5KPTA 5FTJA 4Z8XA 3P1MA 4RNAA 2PW9A 4FXCA 3J9CA 1JWUD 1IBLM 1D5ZC 3ETRA 4NXMM 1STEA 1ZDXA 2EELA 4L1BA 3PHXA 1ENFA 1PGAA 3AKZA 1GLNA 1L0XB 2BW2A 5FKAC 2JU6X 1UUPA 1NI3A 3ZYYX 2UXBM 2WXMA 1AN8A 4YWGG 3GRVA 2BBCA 4DR5M 3AOEC 4GITA 5EP3A 2ZW0A 4GLSC 3SARA 4NAWB 5F3WA 3GQ5A 1VLBA 1WXQA 3R8FA 2V0GA 3PNVA 1HEZE 5G5GA 5DYGA 2MJ3A 3GLGB 2WDVB 3KS8A 3NVVA 3TEWA 4X62M 3L4PA 3BY4A 4TQ0A 3U6QA 1V1OA 3EIHA 2QILA 2AX5A 5IWAM 4JI0M 1IN4A 3U4EG 3BZDB 1UWMA 4H2AA 2XSZA 3B2FA 3WHLA 2H1RA 4QNMA 1Q10A 4KHPM 4LJAA 1IY2A 3VKHA 2QJLA 1TDHA 5AUKA 1QANA 1TH4A 4IBBA 3PHUA 3GQ3A 1SSNA 1FCCC 2HWKA 1AWDA 3PFIA 1JW9D 4DR3M 1ZQ9A 2P5TA 3RGSA 2L32A 4JWSC 4USAA 4DR4M 2XFTA 3FUTA 4W5WA 3MP9A 1YN3A 4HKQA 1E9MA 3GLIB 1L4ZB 2KAJA 3SFEB 4XE0A 5H8YE 1NJGA 3KFUG 2LGIA 4L23A 5EJCA 2LMCA 2ZANA 4JXJA 3E9SA 4M0DA 4HJGE 4KKJA 4OZAA 5EP4A 1DGGA 1HT2E 3MHZA 2XF3A 5T8IA 2DWZB 3E56A 1VDDA 1QOAA 2VQFM 3MC0B 3U5ZB 2PLPA 2BS3B 2G5GX 4JI2M 1K50A 1IN5A 2CU3A 4ITQA 4XGIA 1FRDA 2WXOA 2G1EA 5EQTA 1DKIA 4BOSA 3DWGC 3LXFA 1NVMA 3PO0A 5D7GA 4NJCA 3B21A 2UXCM 2AQ3B 1JRPA 1E10A 4C80A 1QKZA 1X37A 1IXRC 3HGIA 1EM7A 4ZHOA 3GLGA 2X4AA 3UGJA 3HU3A 4KGTA 4JV5M 3JR5A 3B2GA 2R65A 3HJQA 3IG8A 4AKIA 3U61B 2UZJA 2Z7JA 1JQ4A 1HQYE 3C8YA 2R62A 2KACA 3KW6A 4IDIA 3HWSA 2YEPB 5IREB 1YZBA 2L52A 4G6ZA 1NYRA 4G4NA 3FTFA 1B1ZA 3GO8A 1QQRA 2N0SB 2CJOA 5IZ7D 5ITTA 3B9JA 3KP0E 1R7RA 4MGIE 4NZLB 3P4RB 2KEBA 2I2YA 2M56B 3AM9A 3VK8A 1GKIA 5KPRA 2V3PA 4DV5M 1NHWC 3TUOA 2KA6B 1IXSB 2X49A 1QAMA 1G3IA 1G59A 3SASA 1XF5L 3AFHA 4RKXA 1M4VA 2WS3B 2INNE 3URYA 3HVDA 2ZAMA 3KDSE 2NMQA 3HVZA 2FUG1 3L29A 1XHBA 3Q8EA 4L16A 1PJIA 2BJVA 2C9CA 3FUUA 1L2DA 1GL7A 2PVGC 4RGTA 1L0VB 1N36M 2PIAA 4CQNA 1PJJA 3LQQA 4D2KA 4GH9A 3BVGA 1E94E 5EZSA 1ZUD2 3DFZA 2AGAA 3JR4A 5DNYA 2IPKD 3AE4B 1FXIA 1QYRA 4RF1A 2CE7A 3Q8AA 4GKJM 5ITRA 1QLBB 2VQEM 1Q3BA 2WQYB 4XDCA 1D2NA 1TH3A 4US8A 2BNKA 2I38A 3FILA 3M7GA 3U5ZA 2HHHM 3SATA 4GIPA 4WWMA 2XGNA 2QZ4A 3O13A 3KQ4A 4IBEA 1V1PA 2Z4SA 4N58A 1SXTA 1OQRA 3NVWA 1G4AE 3ZCBB 1SBBB 2WXLA 5HHDG 3SHFA 5GKNA 2DWNA 4MGYE 1SIJA 3EGRA 2CV0A 5EXXA 1C76A 3HHWA 2BYTA 3KOYE 3I9V1 3J27B 2FBWB 4M9SA 1HT1E 2BTEA 2Z4RA 5FSWA 3U61A 1PUTA 4ITKA 3ZQ4A 4BOQA 4GC5A 3U6PA 4EIWA 3PVSA 3FKEA 5C3JB 3W9CB 3MK6A 1E7PB 1H6UA 4NSRA 1YN4A 3W5UB 2WDQB 3U6SA 2CV1A 3WCQA 5D3DA 4OZCA 1AW7A 2BS4B 3W31A 3LQRA 4IP3A 1EU3A 2IDYA 3FTEA 2INPE 5EZQA 1SB3C 1I4HA 3BIID 1KLGD 2DZNB 3D8BA 4R3DA 4XBOA 2PTLA 1L0YB 3J81S 1K82A 4DUZM 1N62A 2W55A 3VR9B 1OFHA 3W0LB 1C78A 3NUHB 3MHVC 1C77A 1CK1A 2NTSA 4XWTA 3PHWA 2CHQA 1PVJA 4IBDA 1L2CA 1L1TA 4B3SM 1J7BA 1NNJA 1I94M 1WSPA 2L1AA 3W30A 2KN4A 3AECB 1NY5A 1HNWM 4NXNM 1BXTA 3FUXA 2VZKD 4OW0A 4IBFA 4HRSA 5BR8M 4WURA 4A55A 1NYQA 5EP2A 3FUVA 3P4PB 1I4RA 1NVID 4DV2M 1XC8A 3NS1A 1KH0A 2C5RA 1QT9A 3ABVB 2GI9A 1FXAA 3AE3B 4YY3M 4YT0B 2FOIC 1C79A 2H88B 4YTMB 2OQ4A 2BB5A 2QEJC 3CTWB 4YTNB 2DZOB 2GRIA 1GPXA 3HKPA 2RGHA 1K51A 2F5SA 2I7PA 2IGDA 3BBAA 2D7GA 2QSDA 4A9AA 3VDPA 4IBIA 1XLOA 4DXGA 5AUIA 4D8IA 2I7NA 3P63A 3R2TA 3MJ5A 3BOSA 2F5NA 4DV0M 3Q8BA 2JYTA 2IGGA 2JX5A 4QNRA 1TS4A 2WXIA 3KP1E 5LNK1 4II7A 4G4QA 4LZJA 2LUMA 1XO3A 4IJEA 1N33M 5MPOA 4AS1A 2R46A 3P42A 4IBGA 4JI5M 4WAFA 3M0EA 1AYFA 1PYWD 1QAQA 3UMMA 4B7GA 5FLXS 4PDIA 4FCTA 4LJ6A 2JRIA 1D5MC 1L1ZA 3KLSX 1XMOM 2J42A 1W5TA 2D7HA 4LF7M 3KOXE 3J80S 3HU1A 4D81A 1VDVA 2K0PA 1HNZM 3VQIA 4I5SA 1L6UA 4LJ5A 3DZDA 1N5XA 3UJNA 1KRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WUR A;  2FE8 A;  3MP2 A;  5KO3 A;  4P16 A;  3MJ5 A;  4R3D A;  4OVZ A;  3E9S A;  4M0W A;  4PT5 A;  4RF1 A;  4OVZ B;  5E6J A;  4MM3 B;  4OW0 A;  4REZ A;  4RNA A;  4RF0 A; 
#chains in the Genus database with same CATH topology
 4LCB A;  1GVN A;  5KO3 A;  3PZ8 A;  3UI3 A;  2OOB B;  1KXR A;  1CV8 A;  2LI5 A;  2M19 A;  1MHX A;  3ZW3 A;  1N60 A;  2WXF A;  4B7F A;  2LHD A;  2J7Q B;  1PJS A;  3RT3 B;  2UUB M;  2N4F A;  4LGM A;  3WAL A;  5EXS A;  1KOT A;  4IIW A;  4MGH A;  4LDT D;  3RNE C;  2D3C A;  2ATO A;  8PCH A;  1PBH A;  2FO5 A;  2KLC A;  3AN1 A;  2JZP A;  3BOW A;  4IUM B;  3PRM A;  1UWX A;  5J2R A;  3R3M A;  3SAV A;  3U7D A;  4K7W A;  2A4Z A;  3U6O A;  2X38 A;  1XXH B;  2G9H D;  2OPF A;  1J7K A;  1YK8 A;  5JZE B;  2KNA A;  1K8R B;  4NC6 A;  1N77 A;  2CHV A;  2MEK A;  4JI8 M;  4HCN B;  3I51 A;  2YJ8 A;  1C4P A;  1WYG A;  1HQC A;  3I4V A;  1N32 M;  3ZIM A;  2WBF X;  1IY1 A;  2V6Z M;  3AMZ A;  3TEX A;  1UF0 A;  4G54 A;  4W5C A;  3QAU A;  3DBS A;  1MDW A;  2K6Q A;  1PPP A;  1ESF A;  4MEM A;  4Q7J A;  3NWL A;  4MGK E;  3CMM B;  1CQD A;  3BC3 A;  4YV8 A;  2BWE A;  2V1U A;  1WZ3 A;  2XSZ D;  5CHT A;  4LJ9 A;  1N34 M;  1Z5C A;  4PT5 A;  2TSS A;  1V92 A;  2M5Z A;  1P7E A;  1VJK A;  4MT5 A;  1SXJ B;  3C58 A;  2JZ0 A;  2L0F A;  3JYU A;  1D5X C;  2F5P A;  4JI7 M;  3F92 A;  1GAQ B;  4EFO A;  2K6D B;  4HXD B;  3DWM A;  4GDL A;  3R66 C;  3AEF B;  2Y20 A;  1WXA A;  4ANX A;  3RYT A;  1IPG A;  1FXT B;  5BYQ A;  3U6D A;  1UGM A;  5JHA A;  3FKY A;  3I06 A;  3CBJ A;  4X64 M;  3Q8C A;  2JQR B;  1P3Q Q;  2DYB A;  3LJ3 A;  3NY5 A;  2FCN A;  5EE0 A;  2KAN A;  3TEY A;  2ZVN A;  5FTK A;  3B79 A;  1NV9 A;  3IT6 B;  1WXV A;  1FIQ A;  4G4O A;  3DHH C;  3J7A S;  5TR5 A;  1QOL A;  1X1M A;  4MJS A;  3ZJV A;  1WJN A;  3B9P A;  2LXE A;  3PV1 A;  2JXN A;  2BYF A;  1ZGU B;  2ERC A;  3TE6 A;  1U9Q X;  4EOY A;  2C9O A;  1ROE A;  3IOQ A;  3KS4 A;  3HM6 X;  2YNM D;  1BQI A;  2D7E A;  2IO2 B;  2RPQ A;  4FWD A;  3QCA A;  3HHX A;  4K7S A;  1PQS A;  2DC9 A;  3SR6 A;  3IUT A;  2BJW A;  5DCN A;  2KTR A;  1THE A;  2GQF A;  3FD9 A;  4HPL B;  4CHT B;  3I3T A;  4AW4 A;  2CHX A;  2PEA A;  2FRQ A;  1FFV A;  2PJH A;  1FFU A;  3QA8 A;  4DR6 M;  1YJI A;  1V8C A;  2RKO A;  2LWP A;  3M6A A;  2BF8 B;  4KSL C;  5AZH A;  1NHG C;  1OAO C;  4XZ4 A;  3ZC7 B;  4NRW A;  3H7D A;  2PVO D;  3DPD A;  4DK5 A;  3BWU D;  2MP2 A;  2I1J A;  3N1Y C;  3FYD A;  1L4D B;  1F9J A;  2BWB A;  4GUA A;  3GLF B;  3V60 A;  3Q3O C;  4LJ7 A;  4JI6 M;  2R18 A;  1D4B A;  2Y6E A;  2C98 A;  1ZXH A;  2M4N A;  3LVV A;  1NBF C;  1XEE A;  1YN5 A;  4X57 B;  3R9X B;  3E1Z B;  3U8E A;  2OOB A;  5EE3 A;  4WH4 A;  4HL4 A;  2DC6 A;  2OJW A;  2OO9 A;  2L7H A;  1T6B X;  4YYV A;  2J7Q A;  3JVZ X;  2JT4 B;  1PPO A;  1NPZ A;  3HHA A;  3I4Y A;  3LCU A;  1ET6 A;  1MS6 A;  4YXD B;  4EE2 A;  1WGH A;  3AEA B;  2D10 A;  5FK9 C;  2MH7 A;  2LVQ A;  1WGD A;  4G50 A;  2Z59 B;  2ZJD A;  2O25 A;  2OOA A;  5IN7 A;  3LDZ E;  4W9D A;  2JY7 A;  4IUM A;  3T3O A;  1V5O A;  4GMQ A;  2L2D A;  2PE9 A;  2QCZ A;  2LVQ D;  3QAR A;  1IY0 A;  1E6E B;  4FJV B;  3V05 A;  1DGB A;  3C0R B;  1L8Q A;  1XXH A;  3ZVV A;  3M3J A;  1WGL A;  5JZE A;  1C9F A;  1F29 A;  2FCQ A;  3RFW A;  1NSF A;  2UXD M;  1QZM A;  1MX0 A;  4PAD A;  4TSS A;  4IM0 A;  1YE9 A;  2JRH A;  2W3S A;  2JQG R;  4IOI E;  4DV3 M;  5F02 A;  2XBB C;  3HY5 A;  3LYY A;  1XXG A;  2C7N B;  4QRX A;  1UBQ A;  5LXI B;  4GC9 A;  2INC C;  3HD3 A;  4KSK C;  1FD6 A;  2VF7 A;  4I8O A;  2E01 A;  4YYQ A;  2YJB A;  2MH8 A;  2QP9 X;  2ZNV C;  4C7Y A;  2Z84 A;  3MOR A;  3A45 A;  2MJD A;  1YNT E;  1YQ4 B;  4JE3 B;  4WAA A;  4BOU A;  2KC1 A;  3GZN I;  5FTN A;  4ZYN A;  1M94 A;  1GAB A;  3NZ3 A;  1UM8 A;  4QH6 A;  4ZRJ A;  3VDZ A;  5KHQ A;  2NPT B;  4DDG D;  3K1J A;  1TS5 A;  2BPS A;  2KDF B;  1T3Q A;  1SXJ A;  3PTF C;  4Q2J A;  1WXS A;  4LJ4 A;  3J7B A;  3KH0 A;  1OIZ A;  2Z8L A;  5KQ8 A;  1ACC A;  1VEK A;  4OHJ A;  3A9K B;  5H92 C;  2LNH C;  1VZ6 A;  5BMH A;  4HXD A;  4AKH A;  1ZMW A;  1YSY A;  3Q3M C;  4MSX A;  2MBO A;  1K53 A;  2XNA C;  4X66 M;  1QUT A;  2VF8 A;  4JL9 A;  4B6W A;  3KOZ E;  1SXJ D;  5FTM A;  2K9D A;  2DBY A;  4OX9 M;  1T0Q C;  4DDI D;  3VRA B;  4BOZ B;  1BUI C;  1ZXI A;  4WJO A;  3ONS A;  5CX3 A;  4BOS C;  4YSX B;  4I07 A;  2DZJ A;  2NBW B;  2C96 A;  3AU4 A;  2DAM A;  2J0J A;  3H4M A;  4HLQ A;  3I5J C;  3L2A A;  1C4A A;  2R4J A;  2ACZ B;  2Y21 A;  4OVZ B;  2R9C A;  4D80 A;  2GBM A;  3GLI A;  1S1Q B;  1YJJ A;  1F1H A;  4NOO B;  2K3U A;  4GIV A;  2LHE A;  1KFV A;  1CVZ A;  3KW5 B;  3AE5 B;  4ZOH C;  3T15 A;  3TIX A;  4DR7 M;  1SGH A;  4TV3 A;  4A3P A;  2RSU A;  4K0K M;  2V1Y A;  2DVW B;  2PKO A;  2CRU A;  3PSE B;  3QC8 B;  3DOA A;  1IBX B;  1YVB A;  3VTW A;  1IFY A;  4YTP B;  2AQ2 B;  2R2O A;  1MVK A;  2OZ2 A;  2W54 A;  2FT2 A;  3ILK A;  1V5T A;  4FWH A;  2N7J A;  1XXH E;  2DXI A;  3H8C A;  2PPH A;  3MC8 A;  2V4I B;  3PPA A;  3RPF C;  3BPF A;  5LMN M;  2JVC A;  1WJU A;  1AYW A;  4TUU A;  5ITY A;  4KO8 A;  2CHW A;  4HWY A;  5G5H A;  1CJE A;  1SIF A;  1FCL A;  3RE8 A;  1HJP A;  1VZ7 A;  4F1I A;  1MPE A;  3UIN B;  4WIP A;  4EZL A;  3TQS A;  2JNH A;  3ZNG C;  3TNX A;  1UNS A;  1GC7 A;  4RCO A;  1T5X D;  4W9C A;  3ZTD A;  1YUB A;  3K8U A;  2L7R A;  2DZL A;  2HJ8 A;  1D0K A;  2HTH A;  4JLC A;  4M8N A;  5C1Z A;  2ZAO A;  1EU4 A;  3FAH A;  1F2R I;  3GLF A;  2DZI A;  1SF0 A;  2GB1 A;  1R4M B;  1HR0 M;  1I4P A;  1WRI A;  2NVU I;  4M0W B;  5E26 A;  2WNM A;  1EFU B;  1SXJ E;  2GMI C;  2OHF A;  3IAM 1;  3L08 A;  1DO2 A;  3ZGZ A;  3OAW A;  4DXF A;  4A3V B;  1WX9 A;  2R44 A;  4L78 A;  2EKE C;  5KQD A;  1XLP A;  1V97 A;  4AOF A;  3P4Q B;  4JIO U;  4AXM A;  5C1B A;  3KUD B;  4XZX A;  5D6J B;  3Q3N C;  2C99 A;  1VZ8 A;  3JSV B;  4OZB A;  1YMH E;  3DDC B;  2L05 A;  3V3X A;  1NB3 A;  4JGH B;  2WXK A;  3TRK A;  1ZMV A;  4LF6 M;  1UKF A;  3BVM A;  2HD5 A;  3AE6 B;  4OEL A;  2O5R A;  4BB9 A;  3AU5 A;  5DYI A;  3TL4 X;  1WRD B;  2FYE A;  2CHZ A;  1RFK A;  2DZY A;  2IPP B;  4LY6 A;  3PXG A;  1DOX A;  3GLI E;  1LXD A;  4FN2 A;  2ZTC A;  3VFD A;  2EMT A;  3C0R A;  1JWM D;  1IBM M;  2N9X A;  4IG7 B;  3UIO B;  1YQ3 B;  5C23 A;  4ASW C;  1EE8 A;  4AWJ A;  2XEW A;  2H5X A;  1V33 A;  5D3I B;  2E5L M;  2WHI A;  4KLN A;  3L0W B;  1C4C A;  4WW0 A;  1R6B X;  2B3T A;  3AH7 A;  3OJ4 B;  5K16 A;  1Z6T A;  3WHK A;  1XKG A;  4Q8G A;  3VUW A;  1OEY J;  1TS2 A;  4KGR A;  4DR1 M;  1NEK B;  3KUZ A;  3AB5 A;  3U6C A;  1EWM A;  1ICF A;  4MH0 E;  4LF8 M;  2BS2 B;  2KWD A;  1KYI A;  4MSQ B;  2MGW A;  4BFR A;  3IAS 1;  2LD9 A;  2ZTD A;  3DVN U;  3IXS A;  4W9G A;  2APL A;  1R2Z A;  2CKH B;  2NPT A;  2YLM A;  1A5T A;  4ZYS A;  4PP2 E;  3SFZ A;  4PP1 A;  1JAL A;  4P16 A;  2WU5 B;  4XGA B;  2WXJ A;  3RZF A;  1R5L A;  1E90 A;  3LB8 C;  1ZDV A;  3A9K A;  4HPM B;  1I42 A;  3AUL A;  3PBH A;  4B0M A;  4LNN A;  3KSE A;  4IJF A;  1XLN A;  3BCN A;  2EUC A;  2CJN A;  2RDH A;  4UN2 B;  4IW0 A;  1PM5 A;  3GRR A;  4XDD A;  1EWY C;  4DUY M;  3GLF E;  2KC2 A;  2L6O A;  3Q69 A;  2WXR A;  1V81 A;  1U4A A;  4FIP A;  2PAD A;  1K52 A;  5CTR C;  4S0R A;  2KYW A;  3ZNH B;  1I4X A;  3THG A;  5EE1 A;  1ZW7 A;  1EWL A;  4LNF A;  4BPV A;  1IGC A;  3KVF B;  5ITU A;  1MHH E;  3Q8X A;  2C5L C;  3LMM A;  2K9X A;  1V34 A;  1F0Z A;  2MBQ A;  3MHH A;  4ACF A;  4OVZ A;  2K5P A;  4KT0 F;  4GGQ A;  1TZO A;  3N4C A;  1F52 A;  3W5V B;  3IVF A;  4I4L A;  1PJQ A;  3FRH A;  2WP9 B;  1U5I A;  4IBJ A;  1I7H A;  2J0K A;  1IQP A;  2JY5 A;  1WGK A;  4FUL A;  1TT5 B;  2C9W B;  4IKG A;  3PSE A;  3UQB A;  4QHT A;  5L8R F;  2Y5P A;  3OF8 A;  2XFS A;  4R7G A;  2UU9 M;  4N8W A;  2V3N A;  3KSJ A;  1WGY A;  2LEK A;  4LRT A;  3RGP A;  2XZU A;  2KD0 A;  3AED B;  4GOC A;  3ZRF A;  3KOW E;  1N61 A;  1J5E M;  2HWJ A;  2JZ1 A;  3SYL A;  1OQQ A;  2F5O A;  2IY1 B;  2UWQ A;  1J7C A;  4L4U A;  2JYE A;  4LFA M;  2KWU B;  2FFJ A;  1BGO A;  3BIN A;  2W82 A;  2CEA A;  3L54 A;  2DX5 B;  3N3G A;  1GB1 A;  2QC8 A;  5FPW A;  2WYQ A;  1HNX M;  2R2Q A;  3PGE A;  1XNQ M;  3USV A;  3H9D A;  3IG5 A;  4LFB M;  3DBH B;  1Q39 A;  1T3T A;  2XLJ A;  1RLF A;  3K9M A;  3RUI B;  2VHF A;  3NBI A;  4RY2 A;  4KOD A;  2Y3A A;  1Q0W B;  3AL0 C;  3C9P A;  2ZEQ A;  3TWL A;  4M0W A;  5HI1 A;  1KLV A;  2JQF R;  3ZNI D;  1TYG B;  3RZW C;  1Z5S B;  1DOY A;  4FJY A;  3T3N A;  1UEL A;  5ITX A;  3SAU A;  2DEN B;  4RM9 A;  3HM3 A;  3GE8 C;  3L13 A;  1C3T A;  4TKN A;  4JQW C;  2GBK A;  4P17 A;  4DV6 M;  2MCN B;  4S17 A;  4GDK B;  4ARC A;  1ZCM A;  1XWI A;  3CF6 E;  3JSV A;  1DOI A;  3GPP A;  2W9N A;  2KNB A;  3OTO M;  1ZOY B;  3MFG A;  1LQB A;  1SNK A;  2XZF A;  2KXJ A;  5HG2 A;  4D8E A;  1SE4 A;  3IHP A;  2JWU A;  4I6P A;  2OJR A;  1GC6 A;  2AYN A;  4YYW A;  3IEJ A;  3OWE B;  4K7U A;  3ZDM C;  2XH9 A;  2M8S A;  3ZXV A;  4JWU C;  3I04 M;  2X8A A;  3AE1 B;  3I57 A;  3AOE A;  4NNJ B;  1L2N A;  1GLO A;  2KJR A;  2N1W A;  2QDF A;  2V3S A;  3W0F A;  2NQD B;  1QDT A;  4YL8 A;  2R4E A;  2WXH A;  4B3T M;  2C7H A;  2NQ8 C;  3H7S A;  3PT2 B;  2K0B X;  3PW3 A;  2N35 A;  4M9X A;  4OU7 A;  3FYC A;  1TL9 A;  2QQ8 A;  2SEB D;  2HCB A;  4C4V B;  3Q6B A;  3EUB 2;  4GHL A;  4J3O D;  4RGO S;  2Q2E B;  3VDU A;  1NY6 A;  4QOS A;  4AJY B;  2FIF A;  4D82 A;  4FD2 A;  5EXT A;  1TKG A;  1LO5 D;  1WE7 A;  2Y5B A;  3U6E A;  4REZ A;  4YYR A;  1BT0 A;  4N59 A;  3L10 B;  1QIL A;  2DCC A;  3AXC A;  1WZ0 A;  3AOG A;  1DYQ A;  2WLB A;  1FM0 D;  3ZNZ B;  3L25 A;  1OJL A;  1FRR A;  3SMS A;  4MB7 A;  1ZP0 B;  2YJ2 A;  1FJG M;  2DNA A;  2MA9 B;  5CHF A;  1HZ5 A;  3HHY A;  2K8B A;  2KO3 A;  2BTW B;  2IJ0 A;  1TGU A;  1KLU D;  3PZD A;  3ZNH A;  4BSQ A;  3WA0 A;  3HIZ A;  3N32 A;  3X0W A;  3J2P B;  5ITX E;  4I04 A;  4X65 M;  1JCK B;  1MEM A;  7PCK A;  1Z5A A;  2K6B A;  1JWB D;  3I63 C;  2K39 A;  4ZRI A;  3DVN V;  1HTO A;  2DJF B;  1EIJ A;  4ANV A;  3K92 A;  1TKY A;  2BQQ A;  2LGY A;  1PDX A;  2R6N A;  1UH6 A;  1YQB A;  4DHZ B;  1DO0 A;  4WJQ A;  3S3Q A;  2G6D A;  3KX1 A;  3GLH B;  5CHV A;  1DGJ A;  3Q3F A;  3KWL A;  3K9P B;  3KYD D;  3B08 A;  3IT4 B;  2XK5 B;  4TUW A;  3A4R A;  2PRE A;  3L26 A;  4W5B A;  2PE6 B;  3HJS A;  2D5G A;  1SJH D;  2C7M B;  3H8H A;  3B7Q A;  1PIP A;  2G7Y A;  4Q8H A;  1Y56 A;  1TF0 B;  3DHG C;  3H8B A;  1GJS A;  3H7P B;  3FC4 A;  4I81 A;  3AE7 B;  2PMV A;  4GXB A;  4YSZ B;  3D6S A;  3BYY B;  1JWS D;  2ZW1 A;  4XWW A;  3M99 A;  3RNB C;  2ZBK B;  3OLM D;  3VRB B;  2WXQ A;  4XUI A;  1IM2 A;  3GQ4 A;  2XN9 C;  3KKU A;  5J94 A;  4QOZ C;  2K25 A;  3IG3 A;  4DQO C;  2KFJ A;  2JSV X;  4HKZ E;  3MHS A;  4GHA A;  2ICI A;  4ARI A;  1BY8 A;  4N79 A;  3B1L X;  2LVP C;  4W9F A;  4RF0 A;  3Q2A C;  2MRO B;  2DCD A;  4DBG A;  4B0E A;  1HXY D;  4IBC A;  1MI0 A;  3MHS D;  4A6Q A;  5IT9 S;  2O01 F;  3UF8 A;  4QBB A;  1ZE3 D;  5JHB A;  2DEN A;  3GRU A;  2L8J A;  2FID A;  2VHS A;  2RDB C;  1FO4 A;  4GDK A;  1AIM A;  1VEJ A;  1GOZ A;  3GB1 A;  2IO1 B;  1NLJ A;  4DXA B;  4IWQ A;  3V6C B;  2J53 A;  3VKG A;  4CZW A;  4CJ6 A;  2RMM A;  4A8X C;  3IV2 A;  4WJP A;  1IWD A;  4MGZ E;  4ZTB A;  5A24 A;  2YEP F;  3HHM A;  3N9Y C;  1ZPS A;  3V62 A;  1MG4 A;  2GLS A;  2LFI A;  3NOB A;  4US9 A;  2MBE A;  3GRY A;  2DHR A;  1HQR D;  2DHZ A;  5BPV A;  1H4R A;  1SJE D;  3SEB A;  4NRV A;  2WDR B;  3QAQ A;  2O6X A;  2ONQ A;  1GJT A;  2JY6 B;  1S3S A;  3I01 M;  4WJN A;  5PAD A;  3SAW A;  4DV4 M;  3EEC A;  1A6R A;  3W1S A;  4FHJ A;  3RNV A;  4ZUX U;  3VLF B;  2LRU A;  4NQL B;  2MR9 A;  4IM3 A;  1Q3C A;  2N7E A;  4MSM B;  1V6E A;  1PGY A;  3UK6 A;  1D6E C;  3AEG B;  4AXL A;  2NTT A;  3PT2 A;  1EUV B;  2O6V B;  4NY0 A;  4ZRQ A;  2X8X X;  3ZJT A;  1MIR A;  3DF0 A;  4YSY B;  3AE2 B;  3QSD A;  4C4V A;  3TEZ A;  2RDG A;  2EA0 A;  3TMP A;  4LK0 M;  4CDC B;  2KW0 A;  3H4J A;  3T38 A;  3ALB A;  1DGF A;  4HEA 1;  3GP7 A;  1GL6 A;  2EMS A;  1N63 A;  4ANU A;  3RNA C;  1QF6 A;  2XU1 A;  3LFY A;  1XCT L;  1MN3 A;  1YAL A;  2FRA A;  1PGX A;  3O0U A;  2LBC A;  1UD7 A;  1R4N B;  1IGD A;  3CBK A;  2V1C A;  3CF2 A;  5I4D A;  4LF9 M;  4C56 C;  1WJ4 A;  2WXG A;  3L28 A;  3ZUA A;  2KX3 A;  4L2Y A;  2DOS A;  2LVA A;  3OJ3 A;  4AQ7 A;  4AQY M;  3OIS A;  5BMG A;  1OAI A;  5C2T B;  4FJZ A;  2BTW A;  3PRP B;  2QCU A;  1XT9 B;  1ET9 A;  1XMQ M;  2LXA A;  2NR2 A;  2N9L A;  1E9R A;  1T0R C;  2J7N A;  1AYU A;  4M8M A;  5H37 D;  3IFU A;  1FEH A;  1XLQ A;  4KDL B;  3N1X C;  2HDE A;  3ZXR A;  3U30 A;  3DHI C;  3P5X A;  2KRU A;  1E8W A;  2N9K A;  2EKF A;  2JUJ A;  1QOG A;  3ZDT A;  2KJH B;  4D8B A;  4RFB A;  3DOW A;  3SFD B;  1G41 A;  2AHM A;  4WQO B;  2DZM A;  2KMA A;  3ML8 A;  3S2A A;  3A98 B;  2ON8 A;  1KFU L;  3FIL B;  5C18 A;  1WWT A;  2HXZ A;  3K9O B;  2DWQ A;  3U52 E;  4RH6 A;  3VUY A;  3GLH A;  3R2I A;  1CB5 A;  4AZF A;  2DYO A;  3TWM A;  3A42 A;  4Z6Y A;  5BMI A;  2P0R A;  3DQV A;  4W9E A;  4PD2 A;  4CIS A;  2XK5 A;  4KDI C;  3AEB B;  3NVY A;  2DI0 A;  3P4S B;  2LH0 A;  1O0E A;  3VUX A;  1V1P B;  1WR6 E;  1NEN B;  4HRO A;  1T0S C;  1F2A A;  2L00 B;  4TQ1 A;  4HWI B;  1QOF A;  1VQ1 A;  4L8R C;  3K8Z A;  3MTV A;  1E8X A;  2SAK A;  2FUD A;  1R2Y A;  3H7P A;  4IM2 A;  4MI7 A;  1P7F A;  2Y0T A;  2MHJ A;  3KW9 A;  4BLC A;  4B3M M;  4NAM A;  1GEC E;  1IN8 A;  3U6M A;  2J7O A;  2DYM A;  4JX1 C;  1JQJ C;  2HJ1 A;  5KPZ A;  3U2S C;  1EWC A;  2M0A A;  2JZZ A;  1KHQ A;  3NRZ A;  2DWL A;  4RGN A;  3HHZ A;  3ZH9 B;  1SE9 A;  1DGH B;  1E7U A;  2L0T A;  3DBL I;  4JI1 M;  4KX6 B;  3K2L A;  1ZV1 A;  7CAT A;  1W5S A;  1F2R C;  1MJG M;  4JI3 M;  3QWZ B;  4Y28 F;  2QIE B;  4YHH M;  2ARY A;  5EE9 A;  1P1A A;  4K81 A;  1UFZ A;  3U60 B;  2DC8 A;  1CQV A;  1L5P A;  2KDE B;  4AG6 A;  5IAA C;  4LTU A;  1J7A A;  2JZ3 B;  2WXN A;  3B74 A;  3BB7 A;  4JPS A;  2B1M A;  5G2N A;  3GCB A;  4AG5 A;  2ASQ A;  4LZZ A;  4MAC A;  4M9Z A;  3UQA A;  2LHC A;  4IWO A;  2HHN A;  3QIJ A;  3A9J B;  1PXV A;  1VJV A;  3TWK A;  1SE3 A;  2QNJ A;  1T0Y A;  5D2M B;  3BYT B;  3DBH I;  1OTR B;  3K24 A;  2KRK A;  2JXX A;  1ISN A;  2R9O A;  1I4Q A;  4L15 A;  2IO3 B;  1NJF A;  2L09 A;  3P5W A;  2J4X A;  1EF1 A;  1VSN A;  2AIM A;  2RRU A;  1QOB A;  4NJ6 A;  4F2L A;  2FH0 A;  3OF9 A;  4A90 A;  3SYK A;  1Z5B A;  2YJC A;  2JY6 A;  3VTU A;  2KQ7 A;  2Q5W D;  4FCV A;  2J7Q C;  4DHZ E;  2NQA A;  4ZHP A;  3HX3 A;  4FJC A;  2DLB A;  1E0Z A;  3AEE B;  3GS2 A;  4WQM A;  5G55 A;  2AQ1 B;  4S12 A;  2Z8Y M;  1C7Y A;  3GLH E;  2R45 A;  3KVW A;  5HFY A;  4BBA A;  2K47 A;  1GO5 A;  1KFY B;  2O2V B;  5FR3 A;  2FNA A;  3SC3 A;  3V6E B;  4NL4 H;  2KFK B;  2O6V A;  3CWI A;  1F77 A;  1G8P A;  1OIP A;  2UU7 A;  1TJE A;  4GU2 A;  5CHW A;  4LNO A;  1WF9 A;  3DCG A;  4ICU A;  2BU3 A;  1VRA B;  4QRV A;  3NBX X;  3GPY A;  4FVM A;  1RWS A;  2J52 A;  4MZO A;  2KDB A;  4PYZ A;  3RVV A;  4EKU A;  1YJ1 A;  3SMP A;  2VZK B;  1BVS A;  3UIP B;  4DR2 M;  3A46 A;  1K3B B;  3ENE A;  2KQ4 X;  3T1H M;  1ORY B;  2D2Q A;  3BK2 A;  4MM3 B;  1HZ6 A;  1IBK M;  1FNU A;  2BGF A;  4LRS A;  1Q6K A;  1N78 A;  2IYD B;  4JN6 A;  1K3X A;  2ZCB A;  3R8B A;  4PCZ A;  3SBJ A;  4DV1 M;  1KTK A;  1N5W A;  1D0M A;  4C7Z A;  5EP1 A;  3BVZ A;  4CO7 A;  3PRP A;  2E6X A;  2IGH A;  1WGG A;  1OFI A;  3ZJU A;  4B08 A;  2R61 A;  1Z59 A;  4N6E B;  5IKC M;  3RNG C;  3ERV A;  1SXJ C;  4HDO A;  5DPW A;  3LVW A;  2RD0 A;  1F2C A;  1RYJ A;  5CVO B;  1IXZ A;  1RRB A;  1Q02 A;  3CF0 A;  3HHI A;  2E02 A;  3HU2 A;  3T1Y M;  1OFF A;  3B7Z A;  3ZUN A;  4KIK B;  2HL7 A;  2LJI A;  4LGY A;  1E32 A;  2LVN C;  1K3W A;  3RFZ B;  2KNV A;  3N30 A;  2FTD A;  5BYS A;  4I6N B;  3P5V A;  1JWA D;  1FNV A;  3K9O A;  1AAR A;  1ITO A;  4LF5 M;  5DFL A;  1XNR M;  1IYF A;  3RUL A;  3QJZ A;  2DAJ A;  3ZLZ A;  1LFD A;  3PRE A;  1Z2M A;  3VTV A;  2CHG A;  4HPP A;  5AZF A;  4DV7 M;  1CPJ A;  4FA6 A;  3OVX A;  1IN6 A;  1QAO A;  2JA2 A;  1WMH B;  2OED A;  4ZRP A;  3VHT C;  3FRI A;  2YR0 A;  2KN5 A;  3MC9 A;  1GB4 A;  3E46 A;  8CAT A;  2QBY B;  4I6L B;  1EWO A;  2AUZ A;  4NPN A;  1TKE A;  5EXP A;  2KNZ A;  3FE3 A;  2IBI B;  2H7J A;  4BVU C;  2DCA A;  3KWV A;  4B7H A;  4AI6 A;  1A70 A;  3L27 A;  2FNJ B;  3NJT A;  1JRO A;  1F2B A;  1DGH A;  4G3O A;  3O65 B;  2KHW B;  2CUZ A;  3HWN A;  2C60 A;  2JTC A;  1I4G A;  3PLU A;  2UUC M;  2RGO A;  3HRD D;  4W9L A;  3DA1 A;  2RR9 A;  3GPX A;  2AYO B;  1I4W A;  5EGW A;  2KDM A;  3U60 A;  3AI5 A;  4K7C A;  1DF0 A;  1WHC A;  2RGF A;  3ZKJ C;  4R71 A;  2IY0 B;  5E6P A;  3GPU A;  1C1K A;  2N1V A;  1KF6 B;  5ITQ A;  3GE3 C;  2B76 B;  2L7I A;  2CWB A;  1JR3 A;  3MP2 A;  3FTC A;  1VDL A;  2PBH A;  3JAM S;  3A9J A;  3UZU A;  4FHK A;  4LF4 M;  3AJI B;  4G4R A;  1TY2 A;  4O1N A;  1IUE A;  4EZJ A;  3KXE C;  1AUA A;  2Z0D B;  4ANW A;  4CGY B;  1OTR A;  1JR3 D;  2JP7 A;  3KSX A;  1J09 A;  2D11 A;  1QVR A;  2NS5 A;  2WXP A;  1ZAE A;  3ZO5 B;  1ATK A;  4BOZ A;  1FH0 A;  3AV8 A;  1FNN A;  4TMA B;  4BOP A;  3E4R A;  4OEM A;  4NSO B;  2JRI B;  4PDG A;  1TY0 A;  2Y5C A;  3SU8 X;  4K3B A;  2G3Q B;  2W3R A;  4KKI A;  1BP4 A;  3S3R A;  3AE8 B;  1TDZ A;  3TPZ A;  2BKR B;  2MJE A;  4IC7 B;  3PHX B;  4GRI A;  2O2V A;  1VCB A;  2DHY A;  4A5U A;  4IBK A;  2NBU A;  2QMT A;  2KFK A;  3OQC A;  1KSF X;  3APF A;  4PI3 A;  2HTM E;  2VRR B;  2F5Q A;  4WWP A;  3AE9 B;  4B95 A;  4P6V F;  3FTD A;  1OGW A;  1BML C;  1IBX A;  5GXG B;  1HA5 A;  3HUI A;  2LZ6 A;  2GNO A;  1CSB B;  2B3A A;  5JI3 E;  4AKG A;  1EWP A;  1MU5 A;  1AYV A;  3RNC C;  1V80 A;  1I35 A;  5FTL A;  1SEB D;  3W1Y A;  2G8E A;  3JW0 X;  1HE8 A;  2J0M A;  2F4V M;  2AVW A;  2Z0E B;  1JB0 F;  5IO9 A;  1EF5 A;  3KFQ A;  4RGM A;  4MM3 A;  2M60 A;  3U6L A;  2K22 A;  2H89 B;  4I05 A;  1QQW A;  5LMU M;  4JI4 M;  2VII A;  2UYZ B;  3W2D A;  2DWM A;  1B9R A;  2CFO A;  1SP4 B;  3D8L A;  5FR6 A;  1AU0 A;  3U7Z A;  1D3Z A;  5JXV A;  3HJ8 A;  3EIE A;  4GKK M;  2CV2 A;  3CH2 X;  3BY4 B;  3GZN B;  1TH2 A;  1QMY A;  3KUC B;  2AUX A;  4MH8 A;  1L7Y A;  1FNW A;  2QEN A;  1JR3 E;  4FK5 A;  4QRG A;  3Q8G A;  2DJG B;  3P5U A;  3H1U A;  1PCI A;  1NNU C;  4KIK A;  2LVO A;  4FW9 A;  4LG2 A;  3T8M A;  1AU4 A;  2KZU A;  1R7S A;  5BYR A;  1JML A;  4B3R M;  4NQK E;  2ZM6 M;  1VR9 A;  4A3O A;  3OG5 A;  4MEL A;  2BT6 A;  2D3A A;  3GP1 A;  3APC A;  2K1F A;  2JPH A;  1E9S A;  3ML9 A;  4LCD E;  4M01 A;  5DPT A;  2BB6 A;  3AV0 A;  2K8H A;  4BS6 A;  4JYA M;  1LM8 B;  2EO2 A;  3FUW A;  1TS3 A;  2YQZ A;  2RPV A;  3X23 A;  4BKT A;  3NZS A;  3QWL A;  2KMM A;  1WMH A;  1CZP A;  3C3E A;  3EA6 A;  4LNK A;  2BWE S;  1L2B A;  4HJK A;  2MW5 A;  2QBY A;  5E6J A;  2KX0 A;  1L6V A;  1E7V A;  1PFD A;  3RD2 A;  1IN7 A;  5JI2 E;  4XR7 A;  3Q8F A;  2DAK A;  2IBI A;  2Y0Q A;  1Y08 A;  2XU5 A;  3KWB X;  1UGJ A;  3TSS A;  2QPA A;  2NCN A;  1NDD A;  4A20 A;  2UUA M;  2WU2 B;  2DAE A;  4GDL B;  1M6D A;  5TSS A;  4LFC M;  4KGS A;  1E8Z A;  1LV7 A;  1PGB A;  3NVZ A;  3O65 A;  1N75 A;  1V49 A;  3PZ7 A;  2EKI A;  4CDE B;  5A2Q S;  4RKU F;  3VK7 A;  1S3S G;  3QX1 A;  2DKL A;  3H6S A;  1RM6 C;  1KJT A;  2KZS A;  4FWG A;  4UDU C;  2AYO A;  2GBR A;  5CVM A;  4HCP B;  2XEP A;  1KHP A;  3VFK A;  2MWS B;  3ZQJ A;  1XCQ L;  1XB2 B;  4HVB A;  2G8L A;  3PLV A;  5HKH A;  1FMA D;  2A5Y B;  3PNY A;  5KHO A;  3RI7 C;  4G3X B;  3CIR B;  3BK1 A;  2E3T A;  4XC2 A;  4LLG M;  2L83 A;  1GMY A;  2CIO A;  2LWX A;  1SE2 A;  4ZPX A;  4W9I A;  2JXT A;  2YFQ A;  1N6Z A;  2FE8 A;  2HKJ A;  2LXC A;  2AU1 A;  4XYC A;  2FCM A;  3SHG B;  1J0G A;  4URK A;  4LJ8 A;  4FCW A;  2J5Y A;  1VD2 A;  3MTN B;  4P6G A;  1QUS A;  2ZPY A;  3TL5 A;  4KZC A;  4QHS A;  2KXE A;  2Z3X A;  3N20 C;  3VR8 B;  1AEC A;  3O1G A;  5KPT A;  5E6O A;  3IEC A;  4BAX A;  4YVA A;  5FTJ A;  4Z8X A;  3P1M A;  2FCS A;  4KLB A;  2ZNV B;  5LXH A;  2AWT A;  4RNA A;  1MHW A;  4ICV A;  2G3Q A;  2KHH A;  1CMX B;  2PW9 A;  3J9C A;  1JWU D;  4FXC A;  4BS5 A;  1IBL M;  1D5Z C;  2KT7 A;  2G45 B;  3ETR A;  4NXM M;  1J8C A;  1STE A;  1ZDX A;  4W9J A;  2EEL A;  3H6N A;  4L1B A;  3PHX A;  3PNR A;  1ENF A;  1PGA A;  1MEG A;  3AKZ A;  1GLN A;  1L0X B;  2BW2 A;  5FKA C;  2MP2 B;  2DAI A;  4EEW A;  3IHP C;  2JU6 X;  1UUP A;  1NI3 A;  3ZYY X;  1GJZ A;  2UXB M;  2WXM A;  1AN8 A;  3C9E A;  4CYE A;  5CVN B;  1P0R A;  2AL6 A;  4YWG G;  1G6J A;  3GRV A;  1LTM A;  2BBC A;  2ZCC A;  4DR5 M;  1KM7 A;  2KJ6 A;  3AOE C;  4GIT A;  5EP3 A;  2ZPN A;  2WZJ A;  2ZW0 A;  4GLS C;  4PYU A;  3VXW A;  3WAO A;  3PDF A;  3SAR A;  4II2 B;  4NAW B;  5F3W A;  3Q14 C;  3GQ5 A;  1VLB A;  1WXQ A;  3R8F A;  4LJO B;  2V0G A;  1MFW A;  2DCB A;  1YLA A;  5E6N A;  4DMX A;  2EJS A;  3PNV A;  2M0X A;  1HEZ E;  2IND C;  1NV8 A;  2KWC A;  1PAD A;  5G5G A;  1YD8 U;  5DYG A;  2V9H A;  5JH5 C;  2MJ3 A;  1TGZ B;  3GLG B;  2OUL A;  3BPM A;  1ZKH A;  3TBL D;  2WDV B;  1WX7 A;  2BYV E;  3KS8 A;  3NVV A;  3TEW A;  4X62 M;  3L4P A;  3BY4 A;  2R9N A;  4TQ0 A;  3U6Q A;  3PVL A;  4HEO A;  1V1O A;  2GBN A;  3EIH A;  2QIL A;  2AX5 A;  5IWA M;  1ZMU A;  2QSF X;  4JI0 M;  1IN4 A;  1E8Y A;  3U4E G;  2K8C A;  3BZD B;  1UWM A;  3CSF A;  2A5U A;  3UGB B;  4H2A A;  2XSZ A;  4WA6 A;  3GOE A;  3TJP A;  3LW5 F;  2CS4 A;  3B2F A;  3WHL A;  2H1R A;  4QNM A;  1Q10 A;  4KHP M;  4DWF A;  4LJA A;  1IY2 A;  1WR1 B;  3VKH A;  2QJL A;  1TDH A;  2VH1 A;  3EC8 A;  3RCZ A;  3IBE A;  5AUK A;  2KDL A;  1QAN A;  1YIW A;  1TH4 A;  1AU2 A;  3TCA A;  1R4M I;  4IBB A;  2G4D B;  3PHU A;  2KVZ A;  2VDB B;  1T6O A;  5DPS A;  3GQ3 A;  4E74 A;  1SSN A;  1FCC C;  1WJ6 A;  1ZIV A;  3HK0 A;  2EKK A;  2HWK A;  1AWD A;  3PFI A;  2DZK A;  5CHV C;  1JW9 D;  4DR3 M;  1ZQ9 A;  2P5T A;  3RGS A;  1TTE A;  4PS3 A;  3B7N A;  3DVG X;  2DNF A;  2L32 A;  4JWS C;  4XK8 F;  2GOW A;  1C1Y B;  3P2B A;  1S4V A;  4USA A;  4DR4 M;  2E03 A;  1OEY A;  2XFT A;  2REX A;  3FUT A;  2WSC F;  4G11 A;  3VAW A;  4M00 A;  4W5W A;  3MP9 A;  5GMV A;  1YN3 A;  3A1Q B;  1FPY A;  4HKQ A;  4M02 A;  2NQI A;  1E9M A;  3GLI B;  3NHE B;  1L4Z B;  1GCB A;  2KAJ A;  3SFE B;  3D32 A;  3KYC D;  5LLI A;  2FAZ A;  2MBB B;  4HLE A;  4XE0 A;  5H8Y E;  1ME3 A;  1A5R A;  1NJG A;  3KFU G;  1STF E;  2DC7 A;  3MTN A;  2LGI A;  4AJW A;  4L23 A;  1MJD A;  5EJC A;  4W4U A;  2LMC A;  2ZAN A;  4JXJ A;  3E9S A;  4M0D A;  1JQP A;  2M17 A;  4HJG E;  2KOX A;  2LGS A;  4KKJ A;  2BKF A;  4OZA A;  2NBV B;  4P1C C;  3CH3 X;  1JRU A;  5EP4 A;  4CDD B;  1DGG A;  1HT2 E;  3EFC A;  1KFX L;  3MHZ A;  3WIM A;  1MG8 A;  2XF3 A;  5T8I A;  2DWZ B;  1PPN A;  1NO1 A;  3E56 A;  1VDD A;  1QOA A;  2VQF M;  2QHO B;  2MX2 A;  4PS8 A;  4GB9 A;  2WDT B;  3MC0 B;  2NQG A;  1LGR A;  4CIZ A;  2JUO A;  3U5Z B;  2PLP A;  4YYU A;  2BS3 B;  2G5G X;  4JI2 M;  1K50 A;  3K9P A;  1IN5 A;  2CU3 A;  4ITQ A;  4XGI A;  3AI8 A;  1WY8 A;  1FRD A;  4F1S A;  1SG9 A;  3W1S C;  2WXO A;  4OVU A;  2G1E A;  5EQT A;  1DKI A;  3OVZ A;  2WX0 A;  4BOS A;  3DWG C;  3LXF A;  3C3D A;  1NVM A;  1WGR A;  2MLB A;  3PO0 A;  4FLH A;  4NAW A;  5D7G A;  4NJC A;  1QXP A;  2KTF A;  4BQV A;  1QDR A;  2LRW A;  3B21 A;  2HH5 A;  2UXC M;  2AQ3 B;  2CB5 A;  1JRP A;  1WIV A;  3NZU A;  1E10 A;  1GG3 A;  4C80 A;  1QDQ A;  1QKZ A;  4BKG A;  1X37 A;  1IXR C;  1U9W A;  3HGI A;  1DEU A;  1EM7 A;  3M63 B;  2BDZ A;  3WAN A;  1WYW B;  3GLG A;  4ZHO A;  2X4A A;  3UGJ A;  3HU3 A;  3V76 A;  4KGT A;  4JV5 M;  5JA7 A;  2HD5 B;  2GBJ A;  3JR5 A;  1WGN A;  1PE6 A;  3B2G A;  2R65 A;  3HJQ A;  1WI0 A;  3IG8 A;  4AKI A;  3HZJ A;  3U61 B;  2UZJ A;  2Z7J A;  2MJ5 B;  1HQY E;  1JQ4 A;  3QYB A;  3C8Y A;  4FBJ B;  2R62 A;  2KAC A;  3KW6 A;  4IDI A;  3HWS A;  3WXE A;  1PJT A;  1VG5 A;  5IRE B;  2YEP B;  4RM8 A;  1T43 A;  2L52 A;  1YZB A;  1EF7 A;  4G6Z A;  2D07 B;  1NB5 A;  1NYR A;  4G4N A;  3DBR B;  3FTF A;  5DPR A;  3V6C A;  1Y8G A;  1B1Z A;  3GO8 A;  1QZE A;  3IMA A;  1QQR A;  2N0S B;  2XU3 A;  2CJO A;  5IZ7 D;  1P98 A;  1WR1 A;  5ITT A;  3B9J A;  3KP0 E;  1R7R A;  4MGI E;  1EO6 A;  4NZL B;  3P4R B;  2KEB A;  2I2Y A;  1PRB A;  2M56 B;  3AM9 A;  3VK8 A;  1GKI A;  1DV0 A;  5KPR A;  2V3P A;  5AEK B;  2F7D A;  4DV5 M;  1NHW C;  3TUO A;  2BYE A;  2KA6 B;  2WSE F;  1IXS B;  4WP2 A;  2X49 A;  1QAM A;  1NL6 A;  1G3I A;  1G59 A;  3WAM A;  5J18 A;  2G8J A;  3SAS A;  1XF5 L;  3ECI A;  1WXM A;  3AFH A;  4RKX A;  1M4V A;  3W68 A;  2WS3 B;  2R9F A;  2KWV B;  3BXW A;  2FUH B;  2INN E;  3URY A;  4YYS A;  3CST A;  3WXF A;  3HVD A;  2D3G A;  2ZAM A;  1TR8 A;  2BVC A;  3KDS E;  3PHW B;  2NMQ A;  3APD A;  3HVZ A;  2FUG 1;  3L29 A;  2BWF A;  1XHB A;  5EDS A;  3Q8E A;  4L16 A;  1PJI A;  2BJV A;  2L3Z A;  2LJ5 A;  2C9C A;  5L83 A;  2JY8 A;  2P7U A;  1OKS A;  3A1Q A;  3FUU A;  2O6V D;  1L2D A;  2HE7 A;  1GL7 A;  2PVG C;  4RGT A;  2MSE D;  1L0V B;  1N36 M;  3NHE A;  2N9E B;  5IP4 D;  2JF5 A;  2PIA A;  2DAF A;  3A4S C;  4CQN A;  1PJJ A;  3LQQ A;  4D2K A;  4PS7 A;  2L4F A;  4GH9 A;  3BVG A;  3GLG E;  3RVX A;  1E94 E;  2AEH A;  2R9M A;  2LGX A;  5EZS A;  2N7D A;  1CTE A;  1ZUD 2;  1AIP C;  3DFZ A;  2AGA A;  4CHK A;  2ZZP B;  3JR4 A;  3N3K B;  3SD5 A;  5DNY A;  2IPK D;  2OP3 A;  3AE4 B;  1FXI A;  1QYR A;  5IOI A;  4RF1 A;  2CE7 A;  2LTU A;  3F75 A;  3Q8A A;  4GKJ M;  3ZRC A;  5ITR A;  2R0I A;  1QLB B;  2MBH A;  4AP4 C;  2VQE M;  1Q3B A;  3IFW B;  2B1N A;  2WQY B;  3LCV B;  1NI2 A;  2QHO A;  4XDC A;  1D2N A;  1TH3 A;  4US8 A;  4XX5 A;  2BNK A;  4MDK E;  1E5W A;  2I38 A;  4P7I A;  3FIL A;  3M7G A;  3U5Z A;  5BO4 B;  2HHH M;  3SAT A;  3M95 A;  4GIP A;  1G71 A;  4WWM A;  4BKS A;  4HK2 A;  2XGN A;  1CJL A;  4GSW A;  2QZ4 A;  3O13 A;  4X6H A;  3RVW A;  1J19 A;  3L16 A;  3KQ4 A;  4IBE A;  1V1P A;  3QT4 A;  5L95 C;  2Z4S A;  2KK8 A;  4BKS D;  2L76 A;  3BWK A;  4N58 A;  1NQC A;  3E21 A;  3SHQ A;  1SXT A;  3DVG Y;  2M1M A;  4E71 A;  1IP9 A;  1HTQ A;  1OQR A;  2IO0 B;  3NVW A;  5JH3 A;  1G4A E;  3ZCB B;  1D0L A;  1SBB B;  2WXL A;  4DHJ B;  5HHD G;  1WM3 A;  3SHF A;  2DZZ A;  5GKN A;  2DWN A;  4MGY E;  2MRP A;  1SIJ A;  3EGR A;  3Q3J A;  2CV0 A;  5EXX A;  1C76 A;  3HHW A;  2BYT A;  4WWO A;  2LAS A;  5EF4 A;  3KOY E;  3A33 B;  3I9V 1;  4N4Z A;  3J27 B;  3T6P A;  4P6E A;  1WM2 A;  2FBW B;  1TBE A;  2F1G A;  4M9S A;  1HT1 E;  2BTE A;  2Z4R A;  5FSW A;  3U61 A;  1PUT A;  3QHT A;  4HDQ A;  1AU3 A;  4ITK A;  3ZQ4 A;  1U9X A;  4BOQ A;  4BBN C;  4GC5 A;  3U6P A;  4KVG B;  4EIW A;  1TTN A;  1PPD A;  3PVS A;  3FKE A;  5C3J B;  3W9C B;  1V86 A;  2HAK A;  2WSF F;  3MK6 A;  1E7P B;  1H6U A;  1V9J A;  3QK0 A;  4NSR A;  2KQS A;  4X6J A;  1YN4 A;  3M62 B;  3W5U B;  2WDQ B;  2KVR A;  2ACT A;  3U6S A;  3MJW A;  2CV1 A;  3WCQ A;  1XD3 B;  5D3D A;  2DAG A;  4OZC A;  1AW7 A;  2BS4 B;  3W31 A;  1YX6 B;  2MQJ A;  3LQR A;  4IP3 A;  1WX8 A;  2AL3 A;  1EU3 A;  2IDY A;  2Y5B B;  3FTE A;  2INP E;  4P1B C;  3T9L A;  5EZQ A;  1OQY A;  1IXS A;  1SB3 C;  1I4H A;  3F5V A;  1YOV B;  3BII D;  1KLG D;  2DZN B;  3D8B A;  4R3D A;  4XBO A;  2PTL A;  1TLO A;  2XU4 A;  2BDL A;  1L0Y B;  2KLG A;  3J81 S;  2WWZ A;  1K82 A;  1YT7 A;  4DUZ M;  1YX5 B;  1N62 A;  1U9V A;  2W55 A;  3VR9 B;  1OFH A;  3W0L B;  1C78 A;  2I1K A;  3NUH B;  3MHV C;  1GUA B;  1C77 A;  2N9P C;  3V6E A;  1CK1 A;  2NTS A;  4XWT A;  3PHW A;  4W9H A;  4DMY A;  2KMC A;  2CHQ A;  4WWN A;  1PVJ A;  4IBD A;  1L2C A;  2JWS A;  1L1T A;  4B3S M;  4B9K A;  1J7B A;  1NNJ A;  4GEW A;  1I94 M;  1R4G A;  2ZVO A;  5AZG A;  4II3 B;  2WX1 A;  1WSP A;  4K1R B;  2L1A A;  4ANR A;  3W30 A;  2KN4 A;  2KZR A;  4LDT B;  1TIF A;  3SDL C;  3LXS A;  4AUQ C;  1NY5 A;  3AEC B;  1HNW M;  4OVV A;  4W9K A;  2GHU A;  4NXN M;  1POP A;  4IWP A;  1BXT A;  3FUX A;  2VZK D;  4OW0 A;  3DBL B;  1ME4 A;  4IBF A;  3R7Q A;  4HRS A;  2FQ9 A;  3N3K A;  2KDI A;  3N1Z C;  4LNI A;  1CUK A;  5BR8 M;  4WUR A;  4A55 A;  4N9F 4;  3L17 A;  1NYQ A;  5EP2 A;  2LUE A;  3FUV A;  3P4P B;  3KWZ A;  1I4R A;  4F8C B;  1NVI D;  1RFA A;  3PRM B;  2E00 A;  3QQ8 B;  3H89 A;  6PAD A;  4DV2 M;  1WH3 A;  1XC8 A;  1F4I A;  3NS1 A;  1KH0 A;  2AS8 A;  1R4N I;  3QJ3 A;  2C5R A;  1QT9 A;  3ABV B;  4GMV A;  4RMA A;  2GI9 A;  1FXA A;  2WGS A;  1H8C A;  1RAX A;  3AE3 B;  1WIA A;  4PK1 A;  2D3B A;  4YY3 M;  3BBZ A;  4YT0 B;  2FOI C;  1C79 A;  1TZ1 A;  2C0Y A;  2H88 B;  3QYE A;  4YTM B;  2OQ4 A;  2BB5 A;  2QEJ C;  3CTW B;  3PRZ A;  3EHV A;  4DBG B;  1V2Y A;  4YTN B;  3WXG A;  1P9D U;  4BZA A;  4KV2 A;  2V4L A;  5D94 A;  2PNS A;  2DZO B;  2GRI A;  1GPX A;  1GNU A;  3R7R A;  3HKP A;  2RGH A;  2GFO A;  1K51 A;  4F7Z A;  3ZTC A;  3B89 A;  2F5S A;  1YK7 A;  2I7P A;  2IGD A;  4ZRK A;  3BBA A;  2D7G A;  2QSD A;  4FAD A;  4A9A A;  1HUC B;  1Q5W B;  3VDP A;  3RN9 C;  2FS1 A;  4IBI A;  1XLO A;  2YVC A;  2IZV B;  4DXG A;  3VVW B;  4CDF B;  5AUI A;  4D8I A;  2I7N A;  1Y4H A;  3P63 A;  3R2T A;  3MJ5 A;  3BOS A;  1WE6 A;  4E3C A;  1CS8 A;  2F5N A;  4DV0 M;  4NJ7 A;  3Q8B A;  4DHJ D;  2JYT A;  5J17 A;  3C19 A;  2IGG A;  1TU6 A;  3NS8 A;  2P86 A;  1Y8R C;  2JX5 A;  4QNR A;  2LHG A;  3B0A A;  1TS4 A;  2WXI A;  3KP1 E;  3W67 A;  4J6I A;  4EZK A;  5LNK 1;  1WJ7 A;  1RU3 A;  4L6V 6;  4II7 A;  4G4Q A;  1XQQ A;  4LZJ A;  4MJS B;  3NG0 A;  2LUM A;  1XO3 A;  3PS6 A;  2CR5 A;  3WAP A;  3U8Z A;  4IJE A;  1N33 M;  5MPO A;  4KZ0 A;  1X9Y A;  2KKC A;  4AS1 A;  2R46 A;  2JWZ A;  3P42 A;  3RNF C;  4LJP B;  4IBG A;  2YJ9 A;  4JI5 M;  4K3C A;  4WAF A;  3TMP B;  3M0E A;  1AYF A;  1Q1O A;  3CGW A;  4MZS A;  2LGD A;  1PYW D;  1QAQ A;  3UMM A;  4GN1 A;  9PAP A;  2LVP A;  2LVO C;  3V61 A;  4ZDV A;  4B7G A;  2KTR B;  5FLX S;  4PDI A;  4FCT A;  3VH4 B;  1UZX B;  4LJ6 A;  2JRI A;  1D5M C;  4X6I A;  3I3T B;  1L1Z A;  3KLS X;  1XMO M;  3EFU A;  4QAY A;  2J42 A;  1W5T A;  1UBI A;  3DBR I;  2CP8 A;  2D7H A;  4LF7 M;  2G4S A;  1VEG A;  3KOX E;  3J80 S;  4G0N B;  3VH3 B;  3HU1 A;  4EUT A;  4D81 A;  1VDV A;  2CU1 A;  1P3Q U;  3MMP A;  2K0P A;  4C00 A;  2R6F A;  4BBN F;  1HNZ M;  3VQI A;  3RMK C;  4I5S A;  2L4E A;  1L6U A;  5IA7 A;  4LJ5 A;  3DZD A;  1WFY A;  1N5X A;  2VH2 A;  3UJN A;  1KRH A; 
#chains in the Genus database with same CATH homology
 4LCB A;  1GVN A;  5KO3 A;  3PZ8 A;  3UI3 A;  2M19 A;  1MHX A;  1N60 A;  2WXF A;  4B7F A;  2LHD A;  2UUB M;  4LGM A;  5EXS A;  4IIW A;  4MGH A;  3AN1 A;  2JZP A;  3PRM A;  1UWX A;  3SAV A;  3U6O A;  2X38 A;  1XXH B;  2G9H D;  2OPF A;  1J7K A;  1N77 A;  2CHV A;  2MEK A;  4JI8 M;  3I51 A;  1C4P A;  1WYG A;  1HQC A;  3I4V A;  1N32 M;  1IY1 A;  2V6Z M;  3AMZ A;  3TEX A;  3QAU A;  1ESF A;  3NWL A;  4MGK E;  2V1U A;  2XSZ D;  4LJ9 A;  1N34 M;  1Z5C A;  4PT5 A;  2TSS A;  2M5Z A;  1P7E A;  1VJK A;  4MT5 A;  1SXJ B;  3C58 A;  1D5X C;  2F5P A;  4JI7 M;  1GAQ B;  4HXD B;  3DWM A;  3AEF B;  2Y20 A;  5BYQ A;  3U6D A;  4X64 M;  3Q8C A;  2JQR B;  5EE0 A;  3TEY A;  5FTK A;  3IT6 B;  1FIQ A;  4G4O A;  3J7A S;  3ZJV A;  3B9P A;  2LXE A;  2ERC A;  3TE6 A;  2C9O A;  1ROE A;  3KS4 A;  2YNM D;  2D7E A;  4FWD A;  3HHX A;  3SR6 A;  2BJW A;  3FD9 A;  4CHT B;  4AW4 A;  1FFV A;  1FFU A;  4DR6 M;  1YJI A;  1V8C A;  2RKO A;  3M6A A;  1NHG C;  3ZC7 B;  4NRW A;  2PVO D;  3BWU D;  3FYD A;  1L4D B;  4GUA A;  3GLF B;  4LJ7 A;  4JI6 M;  2R18 A;  1D4B A;  2C98 A;  1ZXH A;  3LVV A;  1XEE A;  1YN5 A;  3R9X B;  5EE3 A;  4WH4 A;  4HL4 A;  2L7H A;  1T6B X;  2J7Q A;  3I4Y A;  1ET6 A;  4YXD B;  4EE2 A;  3AEA B;  5FK9 C;  2MH7 A;  4IUM A;  3T3O A;  4GMQ A;  1IY0 A;  1E6E B;  3V05 A;  1DGB A;  1L8Q A;  1XXH A;  5JZE A;  1C9F A;  3RFW A;  1NSF A;  2UXD M;  1QZM A;  1MX0 A;  4TSS A;  1YE9 A;  2W3S A;  4IOI E;  4DV3 M;  3LYY A;  1XXG A;  4GC9 A;  1FD6 A;  4I8O A;  2Z84 A;  4C7Y A;  2QP9 X;  3A45 A;  2MJD A;  1YNT E;  1YQ4 B;  4JE3 B;  4BOU A;  5FTN A;  3NZ3 A;  1UM8 A;  3K1J A;  1TS5 A;  1T3Q A;  1SXJ A;  4Q2J A;  4LJ4 A;  3J7B A;  2Z8L A;  4OHJ A;  5KQ8 A;  1ACC A;  5H92 C;  2LNH C;  1VZ6 A;  5BMH A;  4AKH A;  1YSY A;  1K53 A;  2XNA C;  4X66 M;  3KOZ E;  1SXJ D;  5FTM A;  2DBY A;  4OX9 M;  3VRA B;  1BUI C;  1ZXI A;  4YSX B;  2C96 A;  3H4M A;  4HLQ A;  3L2A A;  1C4A A;  2R4J A;  2ACZ B;  2Y21 A;  4OVZ B;  4D80 A;  3GLI A;  1YJJ A;  2K3U A;  4NOO B;  2LHE A;  1KFV A;  3AE5 B;  4ZOH C;  3T15 A;  4DR7 M;  4K0K M;  2DVW B;  2PKO A;  1IBX B;  3DOA A;  4YTP B;  2AQ2 B;  1MVK A;  2W54 A;  3ILK A;  4FWH A;  2N7J A;  2DXI A;  3RPF C;  2V4I B;  5LMN M;  5ITY A;  4KO8 A;  5G5H A;  1CJE A;  1FCL A;  3RE8 A;  1VZ7 A;  1MPE A;  4WIP A;  3TQS A;  1UNS A;  4RCO A;  1T5X D;  1YUB A;  2ZAO A;  3FAH A;  1EU4 A;  1F2R I;  3GLF A;  1SF0 A;  2GB1 A;  1HR0 M;  1I4P A;  1WRI A;  5E26 A;  2WNM A;  1SXJ E;  2OHF A;  3IAM 1;  1DO2 A;  3ZGZ A;  4DXF A;  4A3V B;  4L78 A;  5KQD A;  1XLP A;  1V97 A;  3P4Q B;  5C1B A;  4XZX A;  2C99 A;  1VZ8 A;  4OZB A;  1YMH E;  3V3X A;  2WXK A;  3TRK A;  4LF6 M;  1UKF A;  3BVM A;  3AE6 B;  2O5R A;  4BB9 A;  5DYI A;  3TL4 X;  1RFK A;  4LY6 A;  3PXG A;  1DOX A;  3VFD A;  3C0R A;  1JWM D;  1IBM M;  1YQ3 B;  1EE8 A;  5D3I B;  2E5L M;  4KLN A;  1C4C A;  4WW0 A;  1R6B X;  3AH7 A;  1Z6T A;  3WHK A;  1TS2 A;  4KGR A;  4DR1 M;  1NEK B;  3AB5 A;  3U6C A;  4MH0 E;  4LF8 M;  2BS2 B;  2KWD A;  1KYI A;  3IAS 1;  3IXS A;  1R2Z A;  4ZYS A;  3SFZ A;  1JAL A;  4P16 A;  2WU5 B;  2WXJ A;  3LB8 C;  1ZDV A;  4B0M A;  4IJF A;  1XLN A;  2EUC A;  2CJN A;  2RDH A;  1PM5 A;  3GRR A;  4XDD A;  1EWY C;  4DUY M;  2L6O A;  3Q69 A;  2WXR A;  1K52 A;  1I4X A;  3THG A;  5EE1 A;  1IGC A;  5ITU A;  1MHH E;  3Q8X A;  2K9X A;  3LMM A;  1F0Z A;  4OVZ A;  2K5P A;  1TZO A;  3W5V B;  4I4L A;  2WP9 B;  4IBJ A;  1I7H A;  1IQP A;  1WGK A;  4IKG A;  3PSE A;  4QHT A;  2Y5P A;  2XFS A;  4R7G A;  2UU9 M;  2V3N A;  3KSJ A;  2LEK A;  4LRT A;  3RGP A;  2XZU A;  3AED B;  3KOW E;  1N61 A;  1J5E M;  3SYL A;  1OQQ A;  2F5O A;  1J7C A;  4L4U A;  2JYE A;  4LFA M;  2FFJ A;  2W82 A;  2CEA A;  1GB1 A;  1HNX M;  1XNQ M;  3IG5 A;  4LFB M;  1Q39 A;  1T3T A;  2XLJ A;  3NBI A;  4KOD A;  2Y3A A;  3AL0 C;  3TWL A;  4M0W A;  5HI1 A;  1TYG B;  1DOY A;  3T3N A;  5ITX A;  3SAU A;  4DV6 M;  4GDK B;  4ARC A;  1XWI A;  3CF6 E;  1DOI A;  3GPP A;  3OTO M;  1ZOY B;  3MFG A;  2XZF A;  5HG2 A;  4D8E A;  1SE4 A;  2JWU A;  3OWE B;  2XH9 A;  4JWU C;  2X8A A;  3AE1 B;  3I57 A;  3AOE A;  3W0F A;  2R4E A;  2WXH A;  4B3T M;  2NQ8 C;  4M9X A;  4OU7 A;  3FYC A;  2SEB D;  2HCB A;  3EUB 2;  4GHL A;  4J3O D;  4RGO S;  2Q2E B;  3VDU A;  1NY6 A;  4QOS A;  4D82 A;  4FD2 A;  5EXT A;  1TKG A;  1LO5 D;  3U6E A;  4REZ A;  4N59 A;  1QIL A;  3AOG A;  1DYQ A;  2WLB A;  1FM0 D;  3L25 A;  1OJL A;  1FRR A;  3SMS A;  4MB7 A;  1ZP0 B;  1FJG M;  1HZ5 A;  3HHY A;  2BTW B;  2IJ0 A;  1TGU A;  1KLU D;  3ZNH A;  3J2P B;  5ITX E;  4X65 M;  1JCK B;  1Z5A A;  1JWB D;  3K92 A;  1TKY A;  1PDX A;  1DO0 A;  3GLH B;  1DGJ A;  3KWL A;  3IT4 B;  4TUW A;  3L26 A;  3HJS A;  2D5G A;  1SJH D;  3H8H A;  1Y56 A;  3FC4 A;  4I81 A;  3AE7 B;  2PMV A;  4YSZ B;  3BYY B;  1JWS D;  2ZW1 A;  4XWW A;  2ZBK B;  3VRB B;  2WXQ A;  1IM2 A;  3GQ4 A;  2XN9 C;  4QOZ C;  4DQO C;  2JSV X;  4HKZ E;  4GHA A;  2ICI A;  4ARI A;  4RF0 A;  4B0E A;  1HXY D;  4IBC A;  1MI0 A;  4A6Q A;  5IT9 S;  1ZE3 D;  3GRU A;  1FO4 A;  3GB1 A;  1GOZ A;  2J53 A;  3VKG A;  2RMM A;  4A8X C;  4MGZ E;  4ZTB A;  2YEP F;  3N9Y C;  1ZPS A;  2LFI A;  4US9 A;  3GRY A;  2DHR A;  1HQR D;  5BPV A;  1SJE D;  3SEB A;  4NRV A;  2WDR B;  2ONQ A;  1S3S A;  3SAW A;  4DV4 M;  3RNV A;  3W1S A;  3VLF B;  1Q3C A;  3UK6 A;  1D6E C;  3AEG B;  2NTT A;  3PT2 A;  4ZRQ A;  3ZJT A;  4YSY B;  3AE2 B;  3TEZ A;  2RDG A;  2EA0 A;  3TMP A;  4LK0 M;  2KW0 A;  3T38 A;  4HEA 1;  1DGF A;  3GP7 A;  1GL6 A;  1N63 A;  1QF6 A;  1XCT L;  1PGX A;  1IGD A;  2V1C A;  3CF2 A;  5I4D A;  4LF9 M;  4C56 C;  2WXG A;  3L28 A;  4L2Y A;  2DOS A;  4AQ7 A;  4AQY M;  5BMG A;  5C2T B;  2BTW A;  2QCU A;  1ET9 A;  1XMQ M;  2N9L A;  1E9R A;  2J7N A;  5H37 D;  3IFU A;  1FEH A;  1XLQ A;  2HDE A;  2KRU A;  2N9K A;  1QOG A;  4D8B A;  4RFB A;  3SFD B;  1G41 A;  2AHM A;  3A98 B;  2ON8 A;  3FIL B;  5C18 A;  1WWT A;  2DWQ A;  3U52 E;  4RH6 A;  3GLH A;  3R2I A;  4AZF A;  2DYO A;  3TWM A;  3A42 A;  4Z6Y A;  5BMI A;  4PD2 A;  4CIS A;  3AEB B;  3NVY A;  3P4S B;  2LH0 A;  1V1P B;  4HRO A;  1NEN B;  4TQ1 A;  1QOF A;  4L8R C;  3K8Z A;  3MTV A;  2SAK A;  1R2Y A;  4MI7 A;  1P7F A;  2Y0T A;  4BLC A;  4B3M M;  4NAM A;  1IN8 A;  3U6M A;  2J7O A;  2DYM A;  4JX1 C;  1JQJ C;  3U2S C;  5KPZ A;  1EWC A;  2M0A A;  3NRZ A;  2DWL A;  4RGN A;  3HHZ A;  3ZH9 B;  1DGH B;  4KX6 B;  4JI1 M;  3K2L A;  7CAT A;  1W5S A;  1F2R C;  4JI3 M;  2QIE B;  4YHH M;  5EE9 A;  3U60 B;  1CQV A;  1L5P A;  4AG6 A;  4LTU A;  1J7A A;  2WXN A;  3BB7 A;  4JPS A;  4AG5 A;  4LZZ A;  4MAC A;  4M9Z A;  3TWK A;  1SE3 A;  3BYT B;  2KRK A;  1I4Q A;  4L15 A;  1NJF A;  2L09 A;  2J4X A;  1QOB A;  4A90 A;  3SYK A;  1Z5B A;  2Q5W D;  4FCV A;  2J7Q C;  4ZHP A;  2DLB A;  1E0Z A;  3AEE B;  3GS2 A;  4WQM A;  2AQ1 B;  4S12 A;  2R45 A;  3KVW A;  5HFY A;  4BBA A;  2K47 A;  1KFY B;  5FR3 A;  2FNA A;  3SC3 A;  4NL4 H;  3CWI A;  1F77 A;  1G8P A;  1TJE A;  2BU3 A;  1VRA B;  3GPY A;  4FVM A;  1RWS A;  2J52 A;  3SMP A;  2VZK B;  4DR2 M;  3A46 A;  2KQ4 X;  3T1H M;  1ORY B;  3BK2 A;  4MM3 B;  1HZ6 A;  1IBK M;  1FNU A;  4LRS A;  1N78 A;  4JN6 A;  1K3X A;  3R8B A;  4PCZ A;  3SBJ A;  4DV1 M;  1KTK A;  1N5W A;  4C7Z A;  5EP1 A;  3BVZ A;  3PRP A;  2E6X A;  2IGH A;  1OFI A;  3ZJU A;  4B08 A;  2R61 A;  1Z59 A;  4N6E B;  1SXJ C;  3LVW A;  1RYJ A;  1IXZ A;  3CF0 A;  3HU2 A;  3T1Y M;  1OFF A;  2HL7 A;  2LJI A;  4LGY A;  1E32 A;  1K3W A;  3RFZ B;  5BYS A;  1JWA D;  1FNV A;  4LF5 M;  1XNR M;  2CHG A;  4DV7 M;  1IN6 A;  1QAO A;  2JA2 A;  2OED A;  4ZRP A;  2YR0 A;  1GB4 A;  8CAT A;  2QBY B;  1TKE A;  5EXP A;  3KWV A;  4B7H A;  4AI6 A;  1A70 A;  3L27 A;  1JRO A;  1DGH A;  2CUZ A;  2JTC A;  1I4G A;  2UUC M;  2RGO A;  3HRD D;  3DA1 A;  3GPX A;  1I4W A;  2KDM A;  3U60 A;  3GPU A;  1C1K A;  1KF6 B;  5ITQ A;  2B76 B;  2L7I A;  3MP2 A;  1JR3 A;  3FTC A;  3JAM S;  3UZU A;  4LF4 M;  3AJI B;  4G4R A;  1TY2 A;  4O1N A;  1IUE A;  3KXE C;  4CGY B;  1JR3 D;  3KSX A;  1J09 A;  1QVR A;  2WXP A;  1ZAE A;  4BOZ A;  3AV8 A;  1FNN A;  4TMA B;  4BOP A;  3E4R A;  4NSO B;  4PDG A;  1TY0 A;  2Y5C A;  2W3R A;  4KKI A;  3AE8 B;  1TDZ A;  3TPZ A;  2MJE A;  4GRI A;  4A5U A;  4IBK A;  2QMT A;  3OQC A;  1KSF X;  2HTM E;  2F5Q A;  3AE9 B;  4P6V F;  3FTD A;  1IBX A;  1BML C;  5GXG B;  1HA5 A;  3HUI A;  5JI3 E;  4AKG A;  1MU5 A;  5FTL A;  1SEB D;  2F4V M;  4RGM A;  2M60 A;  3U6L A;  2K22 A;  2H89 B;  1QQW A;  5LMU M;  4JI4 M;  2VII A;  3W2D A;  2DWM A;  1B9R A;  2CFO A;  3D8L A;  3U7Z A;  5JXV A;  3HJ8 A;  3EIE A;  4GKK M;  2CV2 A;  1TH2 A;  4MH8 A;  1FNW A;  2QEN A;  1NNU C;  4FW9 A;  4LG2 A;  2KZU A;  1R7S A;  5BYR A;  1JML A;  4B3R M;  2ZM6 M;  1VR9 A;  2BT6 A;  3GP1 A;  1E9S A;  2BB6 A;  3AV0 A;  4JYA M;  2EO2 A;  3FUW A;  1TS3 A;  2YQZ A;  2RPV A;  3QWL A;  2KMM A;  1CZP A;  3EA6 A;  1L2B A;  2QBY A;  5E6J A;  1L6V A;  1PFD A;  1IN7 A;  5JI2 E;  3Q8F A;  2Y0Q A;  1UGJ A;  3TSS A;  2QPA A;  2UUA M;  2WU2 B;  4GDL B;  5TSS A;  4LFC M;  4KGS A;  1PGB A;  1LV7 A;  3NVZ A;  3O65 A;  1N75 A;  3PZ7 A;  2EKI A;  5A2Q S;  3VK7 A;  1RM6 C;  2KZS A;  4FWG A;  4UDU C;  2XEP A;  1XCQ L;  2G8L A;  1FMA D;  2A5Y B;  3PNY A;  3CIR B;  3BK1 A;  2E3T A;  4LLG M;  2L83 A;  2LWX A;  1SE2 A;  4ZPX A;  2JXT A;  2YFQ A;  2FE8 A;  2HKJ A;  3SHG B;  4LJ8 A;  4FCW A;  4QHS A;  2KXE A;  2Z3X A;  3VR8 B;  5KPT A;  5FTJ A;  4Z8X A;  3P1M A;  4RNA A;  2PW9 A;  4FXC A;  3J9C A;  1JWU D;  1IBL M;  1D5Z C;  3ETR A;  4NXM M;  1STE A;  1ZDX A;  2EEL A;  4L1B A;  3PHX A;  1ENF A;  1PGA A;  3AKZ A;  1GLN A;  1L0X B;  2BW2 A;  5FKA C;  2JU6 X;  1UUP A;  1NI3 A;  3ZYY X;  2UXB M;  2WXM A;  1AN8 A;  4YWG G;  3GRV A;  2BBC A;  4DR5 M;  3AOE C;  4GIT A;  5EP3 A;  2ZW0 A;  4GLS C;  3SAR A;  4NAW B;  5F3W A;  3GQ5 A;  1VLB A;  1WXQ A;  3R8F A;  2V0G A;  3PNV A;  1HEZ E;  5G5G A;  5DYG A;  2MJ3 A;  3GLG B;  2WDV B;  3KS8 A;  3NVV A;  3TEW A;  4X62 M;  3L4P A;  3BY4 A;  4TQ0 A;  3U6Q A;  1V1O A;  3EIH A;  2QIL A;  2AX5 A;  5IWA M;  4JI0 M;  1IN4 A;  3U4E G;  3BZD B;  1UWM A;  4H2A A;  2XSZ A;  3B2F A;  3WHL A;  2H1R A;  4QNM A;  1Q10 A;  4KHP M;  4LJA A;  1IY2 A;  3VKH A;  2QJL A;  1TDH A;  5AUK A;  1QAN A;  1TH4 A;  4IBB A;  3PHU A;  3GQ3 A;  1SSN A;  1FCC C;  2HWK A;  1AWD A;  3PFI A;  1JW9 D;  4DR3 M;  1ZQ9 A;  2P5T A;  3RGS A;  2L32 A;  4JWS C;  4USA A;  4DR4 M;  2XFT A;  3FUT A;  4W5W A;  3MP9 A;  1YN3 A;  4HKQ A;  1E9M A;  3GLI B;  1L4Z B;  2KAJ A;  3SFE B;  4XE0 A;  5H8Y E;  1NJG A;  3KFU G;  2LGI A;  4L23 A;  5EJC A;  2LMC A;  2ZAN A;  4JXJ A;  3E9S A;  4M0D A;  4HJG E;  4KKJ A;  4OZA A;  5EP4 A;  1DGG A;  1HT2 E;  3MHZ A;  2XF3 A;  5T8I A;  2DWZ B;  3E56 A;  1VDD A;  1QOA A;  2VQF M;  3MC0 B;  3U5Z B;  2PLP A;  2BS3 B;  2G5G X;  4JI2 M;  1K50 A;  1IN5 A;  2CU3 A;  4ITQ A;  4XGI A;  1FRD A;  2WXO A;  2G1E A;  5EQT A;  1DKI A;  4BOS A;  3DWG C;  3LXF A;  1NVM A;  3PO0 A;  5D7G A;  4NJC A;  3B21 A;  2UXC M;  2AQ3 B;  1JRP A;  1E10 A;  4C80 A;  1QKZ A;  1X37 A;  1IXR C;  3HGI A;  1EM7 A;  4ZHO A;  3GLG A;  2X4A A;  3UGJ A;  3HU3 A;  4KGT A;  4JV5 M;  3JR5 A;  3B2G A;  2R65 A;  3HJQ A;  3IG8 A;  4AKI A;  3U61 B;  2UZJ A;  2Z7J A;  1JQ4 A;  1HQY E;  3C8Y A;  2R62 A;  2KAC A;  3KW6 A;  4IDI A;  3HWS A;  2YEP B;  5IRE B;  1YZB A;  2L52 A;  4G6Z A;  1NYR A;  4G4N A;  3FTF A;  1B1Z A;  3GO8 A;  1QQR A;  2N0S B;  2CJO A;  5IZ7 D;  5ITT A;  3B9J A;  3KP0 E;  1R7R A;  4MGI E;  4NZL B;  3P4R B;  2KEB A;  2I2Y A;  2M56 B;  3AM9 A;  3VK8 A;  1GKI A;  5KPR A;  2V3P A;  4DV5 M;  1NHW C;  3TUO A;  2KA6 B;  1IXS B;  2X49 A;  1QAM A;  1G3I A;  1G59 A;  3SAS A;  1XF5 L;  3AFH A;  4RKX A;  1M4V A;  2WS3 B;  2INN E;  3URY A;  3HVD A;  2ZAM A;  3KDS E;  2NMQ A;  3HVZ A;  2FUG 1;  3L29 A;  1XHB A;  3Q8E A;  4L16 A;  1PJI A;  2BJV A;  2C9C A;  3FUU A;  1L2D A;  1GL7 A;  2PVG C;  4RGT A;  1L0V B;  1N36 M;  2PIA A;  4CQN A;  1PJJ A;  3LQQ A;  4D2K A;  4GH9 A;  3BVG A;  1E94 E;  5EZS A;  1ZUD 2;  3DFZ A;  2AGA A;  3JR4 A;  5DNY A;  2IPK D;  3AE4 B;  1FXI A;  1QYR A;  4RF1 A;  2CE7 A;  3Q8A A;  4GKJ M;  5ITR A;  1QLB B;  2VQE M;  1Q3B A;  2WQY B;  4XDC A;  1D2N A;  1TH3 A;  4US8 A;  2BNK A;  2I38 A;  3FIL A;  3M7G A;  3U5Z A;  2HHH M;  3SAT A;  4GIP A;  4WWM A;  2XGN A;  2QZ4 A;  3O13 A;  3KQ4 A;  4IBE A;  1V1P A;  2Z4S A;  4N58 A;  1SXT A;  1OQR A;  3NVW A;  1G4A E;  3ZCB B;  1SBB B;  2WXL A;  5HHD G;  3SHF A;  5GKN A;  2DWN A;  4MGY E;  1SIJ A;  3EGR A;  2CV0 A;  5EXX A;  1C76 A;  3HHW A;  2BYT A;  3KOY E;  3I9V 1;  3J27 B;  2FBW B;  4M9S A;  1HT1 E;  2BTE A;  2Z4R A;  5FSW A;  3U61 A;  1PUT A;  4ITK A;  3ZQ4 A;  4BOQ A;  4GC5 A;  3U6P A;  4EIW A;  3PVS A;  3FKE A;  5C3J B;  3W9C B;  3MK6 A;  1E7P B;  1H6U A;  4NSR A;  1YN4 A;  3W5U B;  2WDQ B;  3U6S A;  2CV1 A;  3WCQ A;  5D3D A;  4OZC A;  1AW7 A;  2BS4 B;  3W31 A;  3LQR A;  4IP3 A;  1EU3 A;  2IDY A;  3FTE A;  2INP E;  5EZQ A;  1SB3 C;  1I4H A;  3BII D;  1KLG D;  2DZN B;  3D8B A;  4R3D A;  4XBO A;  2PTL A;  1L0Y B;  3J81 S;  1K82 A;  4DUZ M;  1N62 A;  2W55 A;  3VR9 B;  1OFH A;  3W0L B;  1C78 A;  3NUH B;  3MHV C;  1C77 A;  1CK1 A;  2NTS A;  4XWT A;  3PHW A;  2CHQ A;  1PVJ A;  4IBD A;  1L2C A;  1L1T A;  4B3S M;  1J7B A;  1NNJ A;  1I94 M;  1WSP A;  2L1A A;  3W30 A;  2KN4 A;  3AEC B;  1NY5 A;  1HNW M;  4NXN M;  1BXT A;  3FUX A;  2VZK D;  4OW0 A;  4IBF A;  4HRS A;  5BR8 M;  4WUR A;  4A55 A;  1NYQ A;  5EP2 A;  3FUV A;  3P4P B;  1I4R A;  1NVI D;  4DV2 M;  1XC8 A;  3NS1 A;  1KH0 A;  2C5R A;  1QT9 A;  3ABV B;  2GI9 A;  1FXA A;  3AE3 B;  4YY3 M;  4YT0 B;  2FOI C;  1C79 A;  2H88 B;  4YTM B;  2OQ4 A;  2BB5 A;  2QEJ C;  3CTW B;  4YTN B;  2DZO B;  2GRI A;  1GPX A;  3HKP A;  2RGH A;  1K51 A;  2F5S A;  2I7P A;  2IGD A;  3BBA A;  2D7G A;  2QSD A;  4A9A A;  3VDP A;  4IBI A;  1XLO A;  4DXG A;  5AUI A;  4D8I A;  2I7N A;  3P63 A;  3R2T A;  3MJ5 A;  3BOS A;  2F5N A;  4DV0 M;  3Q8B A;  2JYT A;  2IGG A;  2JX5 A;  4QNR A;  1TS4 A;  2WXI A;  3KP1 E;  5LNK 1;  4II7 A;  4G4Q A;  4LZJ A;  2LUM A;  1XO3 A;  4IJE A;  1N33 M;  5MPO A;  4AS1 A;  2R46 A;  3P42 A;  4IBG A;  4JI5 M;  4WAF A;  3M0E A;  1AYF A;  1PYW D;  1QAQ A;  3UMM A;  4B7G A;  5FLX S;  4PDI A;  4FCT A;  4LJ6 A;  2JRI A;  1D5M C;  1L1Z A;  3KLS X;  1XMO M;  2J42 A;  1W5T A;  2D7H A;  4LF7 M;  3KOX E;  3J80 S;  3HU1 A;  4D81 A;  1VDV A;  2K0P A;  1HNZ M;  3VQI A;  4I5S A;  1L6U A;  4LJ5 A;  3DZD A;  1N5X A;  3UJN A;  1KRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...