4REZA

Crystal structure of the middle-east respiratory syndrome coronavirus papain-like protease
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
320
structure length
311
Chain Sequence
TIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTAPDFVAFNVFQGGHYVHARLKLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSDCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Middle East Respiratory Syndrome Coronavirus (MERS-CoV) Papain-like Protease Bound to Ubiquitin Facilitates Targeted Disruption of Deubiquitinating Activity to Demonstrate Its Role in Innate Immune Suppression.
pubmed doi rcsb
source organism Human betacoronavirus 2c jordan-n3/2012
molecule tags Viral protein
molecule keywords ORF1ab protein
total genus 79
structure length 311
sequence length 320
ec nomenclature
pdb deposition date 2014-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4rezA02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rezA01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4rezA03
4REZA 4RF0A 3MP2A 4OVZA 4RNAA 3E9SA 4WURA 5KO3A 4PT5A 4R3DA 4OW0A 4MM3B 5E6JA 2FE8A 4OVZB 4RF1A 4M0WA 4P16A 3MJ5A
chains in the Genus database with same CATH superfamily
2FUDA 2WXJA 4PYUA 3BWKA 4KKIA 1G4AE 2J5YA 2L83A 3I5JC 2KNZA 2Z4RA 1ISNA 2PPHA 4KGRA 2MA9B 3B89A 2NPTA 3M62B 1MEGA 3F5VA 3KP1E 2D11A 4IWQA 1GAQB 3E46A 2ZW1A 2EKEC 1FXTB 3LVWA 2LXEA 2K1FA 5E26A 2WX1A 4M9SA 3LXFA 4OVUA 3I3TA 4M9XA 4L6V6 1VR9A 4N58A 4LFBM 2HWJA 3KW5B 3DA1A 1BQIA 4LJ5A 1NV8A 4LJ7A 1XMQM 4L78A 3AMZA 2EMTA 3KUZA 1V34A 1MPEA 1D0LA 1BXTA 1D5ZC 2XK5B 4QNMA 3A4RA 1PJIA 1UGJA 4PS8A 1J0GA 2MP2A 4EUTA 3UF8A 2KWUB 1PJSA 1AN8A 4IC7B 2HAKA 1FM0D 1Q0WB 3PDFA 4G6ZA 1KLVA 4IJEA 3A45A 3FTDA 5ITXA 4X64M 2HTHA 3U6PA 4X62M 3JVZX 1KHPA 1CSBB 1IBXB 1NY6A 3H4MA 2QHOA 1VEGA 2JSVX 3H7DA 1TL9A 5KPRA 2NMQA 4MGZE 3AN1A 2INNE 3CSFA 3ZGZA 1PPOA 3RULA 2UXCM 1DV0A 5JH3A 1FCCC 1J7BA 4HPLB 2MEKA 1PDXA 3HHYA 3ERVA 2NR2A 3T3OA 2UWQA 1QZMA 3BCNA 3TBLD 5BYSA 3ABVB 2DBYA 3PW3A 2KC1A 2BW2A 2NBUA 2NVUI 1H8CA 3O1GA 3ZNHA 4NXNM 1JWSD 1T6BX 4ANRA 2XBBC 4A55A 4CHTB 3TCAA 1P3QU 1WE7A 3U7DA 3U52E 1CJEA 3O65A 1IM2A 3HZJA 3DVGX 1ZV1A 3ZQJA 1GLNA 2CIOA 2JRIA 4XBOA 2WBFX 1AYFA 1HQRD 1BGOA 1EF5A 4W5BA 1PQSA 4JX1C 2DZNB 2B76B 2HXZA 5CHVC 1VD2A 4MGYE 4GLSC 4C4VA 2EELA 3RT3B 4PDIA 4OVZB 2RPVA 4O1NA 2L7IA 1TU6A 2NQGA 1V81A 2NQIA 1NJGA 2DHZA 2GBMA 4XDDA 2FBWB 5BYRA 2CRUA 1UELA 2J7OA 4M8MA 3MP2A 6PADA 4WQMA 2DOSA 1AUAA 3MK6A 2LVNC 4WJQA 5D6JB 2BT6A 4ZYNA 3KH0A 1ZE3D 4JI8M 3VAWA 4K7UA 3FTEA 3H7SA 3KUDB 3OF8A 4QHSA 2KLGA 3VTUA 2X49A 3A9JA 3R3MA 3H6SA 4H2AA 2CJOA 3BVGA 4CIZA 3HRDD 1CTEA 5DPRA 3OWEB 5GMVA 2FT2A 1IN4A 4LF9M 4Q2JA 4W5WA 1CPJA 2GFOA 2ASQA 3PSEA 1AYUA 3P4QB 2DWMA 3BB7A 2Z8YM 2AQ3B 1T43A 1VZ7A 1Q3BA 2IZVB 2INCC 3NVZA 5KQ8A 3VFKA 2L05A 2UU9M 4GHLA 3VKHA 3DBSA 3PHXB 5FR6A 4GDLA 2JXNA 1XT9B 2ZW0A 3KWBX 2K6DB 2UZJA 4BSQA 2L2DA 1ZMWA 2KLCA 1SF0A 4KODA 1KTKA 1M6DA 4DXFA 4WAAA 2BTEA 5KHQA 1N6ZA 2MGWA 1N77A 2L0FA 1NDDA 2P86A 5LMNM 2H5XA 1QT9A 2W82A 4X65M 1UFZA 3L16A 5AZFA 3U6MA 2FCMA 1NO1A 2DVWB 2G8LA 3Q8CA 2K0PA 3SHGB 2KDBA 1T3TA 1KXRA 4KSKC 2ZVNA 4QOZC 3HM6X 4G0NB 1HJPA 2ZNVC 3PVLA 5KO3A 2GQFA 1FD6A 1WGGA 2G4DB 1I4HA 1XD3B 1EF7A 1IXSA 2OO9A 4DV0M 3E1ZB 2UXDM 4G4NA 2Y0QA 2Y20A 3HJSA 4CO7A 3NY5A 4IBEA 5I4DA 2BJWA 3MORA 2E5LM 3KWZA 1RFKA 1IFYA 3QC8B 1UWXA 2R18A 4HEOA 3NZUA 2AU1A 3TWMA 4Z6YA 1VLBA 2WDTB 1VQ1A 3TMPB 4FCVA 4B0EA 4ARIA 4R3DA 2RGOA 3OLMD 2ATOA 4RF1A 2BTWB 1R4GA 3FUWA 1PFDA 2LFIA 1MG4A 3VDZA 3W5UB 3KW9A 2M56B 1GKIA 2MSED 1F2AA 2NTTA 1NENB 1ZDXA 2AQ2B 4BQVA 3C3DA 2CV1A 3H6NA 3NOBA 3IUTA 1HZ5A 3N20C 4JV5M 5HFYA 3TEWA 2KRKA 4D81A 5G5HA 1GUAB 2KQSA 4DV6M 3SAVA 3NZ3A 1UKFA 4OX9M 2Z0DB 4L1BA 4MDKE 3KOXE 3U5ZB 3AFHA 1Z5AA 1R4NI 4M0WA 3TL4X 3HWSA 1C4AA 4Q8GA 1FNUA 4C7ZA 5TR5A 2W54A 4JQWC 2BWBA 4BLCA 2GBKA 3GLGB 2KWCA 4HEA1 1H4RA 4W9KA 4FJZA 1WJNA 3U6CA 1GNUA 1EU4A 1QZEA 3V76A 3HKPA 2GOWA 3I3TB 2E6XA 5BYQA 2PEAA 2FNJB 3P5UA 3FUTA 1GG3A 2R9OA 1BY8A 2JZ3B 5D3IB 2AWTA 1DO2A 1EU3A 3ETRA 2N0SB 4LF7M 2E00A 2Z7JA 2G1EA 4JPSA 2BU3A 4BOQA 2LUMA 4X6HA 5F3WA 1JROA 4P6VF 2DZKA 2L7RA 4JWUC 3AE8B 2IY0B 5CHFA 5BMGA 2LD9A 3JW0X 2O01F 1I7HA 4DMXA 2DAEA 4Q7JA 3FKEA 2ARYA 2KVZA 1PUTA 1OFIA 2I7NA 2QCZA 2JZ0A 1IN5A 4G3XB 1QOAA 3CGWA 3DWMA 8PCHA 1L4ZB 1TF0B 3TPZA 3Q2AC 2M5ZA 4LF5M 4NQLB 4DR7M 4MJSA 1EO6A 2ZTCA 2BWFA 4YTMB 3JAMS 2XU4A 1NEKB 1E32A 3T6PA 2KXJA 2OQ4A 1ME3A 5IZ7D 1K8RB 2OJRA 1QOLA 3AKZA 1WGHA 2XSZA 1NY5A 2JWSA 2JF5A 2DAKA 3ZXRA 3KLSX 2L0TA 4HKQA 2UU7A 3C8YA 4G11A 4ITQA 1YD8U 2L52A 5L83A 3AEAB 1PGXA 4PD2A 3U6EA 1R6BX 5C18A 2RDHA 4ANWA 3M6AA 3R7RA 5KHOA 1PBHA 3K24A 2EO2A 3VKGA 3RMKC 2BYTA 3E21A 3GQ4A 1SXJB 2C9CA 3V6CB 2Z0EB 4W9EA 3AL0C 1OTRA 1BP4A 3R2IA 2DAGA 3M3JA 3I04M 4PDGA 4URKA 4E74A 2LNHC 2KKCA 3UJNA 3DVNV 4KZCA 4IJFA 4P1BC 2ZPYA 1HQCA 2JY6A 1RAXA 2X8XX 2NBVB 2HDEA 2MH7A 2R2QA 4IBDA 3AEDB 2OEDA 1POPA 2V1UA 3DCGA 3ZTCA 2P0RA 2BYVE 1RLFA 2JQGR 4JN6A 1SSNA 4US8A 2OZ2A 2DZJA 2GLSA 3P5XA 3CMMB 5H8YE 2FTDA 5HKHA 3AU5A 4I8OA 2WS3B 3WALA 4AWJA 1DGFA 1FJGM 2RSUA 2DNAA 1WF9A 1U9QX 1D0MA 3V6EB 3TEXA 1OGWA 2L76A 3MJWA 1T0RC 2C7MB 1XCTL 4PI3A 4RKUF 4ICVA 1JR3E 1Z5SB 2DAFA 1AECA 1SG9A 2DZLA 3AE9B 1IBKM 3B08A 4HCNB 1F2BA 2Y5BB 4LFCM 4NJ7A 3FUUA 2R6FA 1TJEA 2QNJA 3H1UA 1C78A 2M4NA 3VHTC 1IN8A 1F9JA 1V2YA 1XXHE 2K3UA 4NAMA 4DR6M 1SE4A 1WGKA 3P63A 3V3XA 4YYRA 1E90A 1L0VB 2Z84A 3CH3X 3IVFA 4GMVA 4RGNA 2YVCA 2JPHA 2KNBA 3DBLI 3RE8A 4S0RA 1IXZA 5E6PA 2V0GA 2WXPA 5IN7A 1AU2A 4GXBA 1OIPA 3N32A 1YIWA 2OOBB 4DHZE 4NOOB 5CVNB 1K50A 3AV0A 1VJVA 2R65A 1ESFA 2J53A 2VZKD 2B1MA 3J7BA 2L4EA 4ARCA 2PE9A 2Y5PA 5IREB 2D3BA 4AOFA 3VDPA 3AI5A 3I57A 3V61A 1XEEA 3I06A 2MBBB 2IBIB 3W68A 3GLHB 3H9DA 2KA6B 1UBQA 1V97A 2N4FA 2XGNA 1L2BA 2REXA 1F2CA 3QA8A 4A3PA 3W0LB 1SE3A 1YNTE 2R6NA 5FTKA 3I4VA 3VRAB 1SXJD 4NJCA 3ZCBB 1CVZA 1E8XA 5EXPA 1QOGA 2WLBA 3J2PB 3ZW3A 3SATA 1HTOA 4E71A 2KRUA 2C99A 1K3XA 2K8HA 1KSFX 4FCTA 2KX3A 4DDGD 2ACZB 4RF0A 3KS8A 4B3MM 1WX9A 2MJ5B 2LGIA 4NNJB 5FLXS 3FILA 1I4GA 2G8EA 1IXRC 4X66M 3BOWA 4W5CA 3PZDA 4BOSA 4ZYSA 3A98B 2CEAA 4GIVA 1WXSA 1OFHA 2G3QB 4I6PA 4NSRA 2WSFF 1OQRA 1YVBA 1KYIA 1I4RA 1TS5A 2DAJA 1WXQA 3GRVA 3UINB 4LJ4A 4LG2A 2DZMA 1P0RA 1QUTA 2VZKB 4IBCA 1CMXB 4BZAA 2PMVA 2AL6A 4DV4M 2HHNA 4BS6A 2LMCA 1JR3A 2MJDA 1YLAA 3DOAA 4EIWA 1V8CA 1IGDA 2L3ZA 4N4ZA 2G5GX 5J17A 3VDUA 3GPYA 2IJ0A 3L28A 4HL4A 2K22A 2N9PC 5LLIA 2KJ6A 3AM9A 2FCSA 4A6QA 4N9F4 5DCNA 1SXJE 3A42A 4D2KA 1GJZA 3Q69A 4CGYB 1JALA 1TH3A 3SC3A 2YEPB 1FNVA 3PT2B 3QK0A 2CFOA 3GQ3A 4WW0A 3MTNA 1OTRB 3NRZA 3K1JA 3APCA 4XC2A 1R4MI 4LJ6A 1JW9D 3N30A 5EDSA 2RMMA 4GU2A 3ZJTA 3LW5F 3TNXA 3MTVA 3QSDA 4B9KA 3ZO5B 1PJQA 3AH7A 3T9LA 4G54A 2LJ5A 3VLFB 3WCQA 3EA6A 1AYWA 4D82A 1WR1A 3NZSA 3QYBA 4KT0F 1FH0A 2ZANA 1OFFA 1PGYA 1YX6B 4IM2A 1JQJC 2D07B 3HUIA 2APLA 2ZM6M 5C1ZA 2C0YA 2UUCM 2J7QB 1C79A 3QAUA 1G59A 1XMOM 5EZQA 4YT0B 2WWZA 2LVQA 5CTRC 3V60A 5IA7A 3BBZA 4G4OA 5JXVA 3ZUNA 3GPXA 4W9IA 1YT7A 3AE1B 4XK8F 3PZ7A 2RDBC 3NS8A 2WXHA 3HHWA 4GRIA 4CYEA 4CDFB 1QAOA 3A1QA 4US9A 4DV1M 3OF9A 4YL8A 3IECA 7PCKA 2GNOA 1XLPA 3J9CA 3W5VB 3TWLA 1V5TA 4LFAM 3H4JA 4Y28F 1GCBA 1I94M 4LJPB 2PBHA 4FJCA 1XC8A 3GE8C 4ZRJA 4NSOB 3S3RA 1XO3A 1T5XD 2KK8A 1YK7A 4FHJA 3AE5B 4XWTA 4B3TM 2OP3A 3UGBB 2HWKA 4GC9A 1WH3A 3LVVA 3SMPA 2F5OA 4LNKA 3RNAC 3MJ5A 3BY4B 1G3IA 5FTLA 3E9SA 2DCAA 3DBRB 1VCBA 4DDID 3USVA 3U60A 3BPMA 2W3RA 4TQ0A 3K9OA 1WM3A 1WYGA 2D3CA 3IHPC 1XXGA 1F29A 4ZUXU 2YNMD 1C77A 1PPNA 1PE6A 1M4VA 4IP3A 1TZ1A 1WJ6A 1WWTA 3MHVC 5KQDA 1LTMA 3QQ8B 3O13A 5AZHA 3EECA 4P16A 5DPSA 1GB4A 3CF0A 3EC8A 2BKFA 4W9HA 2G6DA 4QAYA 3U6SA 3K92A 1D2NA 1SXTA 5C23A 1XLQA 1MJDA 2KQ7A 2KWDA 3B7QA 3ZVVA 2HL7A 3EFUA 3ZH9B 4PYZA 4A5UA 2E3TA 3B9JA 2NBWB 1VDLA 2LGXA 4OZAA 2W55A 1L2CA 4DHJB 1WI0A 1ZP0B 3CH2X 1SJED 4P6EA 3T1HM 1IQPA 1IBMM 4NQKE 1ME4A 5IP4D 2MW5A 2JWZA 2L6OA 3DDCB 2KDMA 1YJJA 4GIPA 2BYEA 3KWLA 3GLFA 1EWCA 3GE3C 1ZIVA 4LF6M 2C96A 1KFYB 3OJ3A 2F5PA 2HJ1A 1VJKA 5EP4A 3A9KA 3U7ZA 2INPE 4F1IA 3ECIA 3QCAA 2SAKA 9PAPA 3O65B 1QMYA 5LMUM 3SHQA 2JNHA 1YN5A 4A3VB 2KJHB 3ZRFA 4AUQC 3BXWA 1IBLM 5JA7A 2FCQA 1XLOA 1P3QQ 1RU3A 4J6IA 1HNWM 2M17A 4NRWA 1TS2A 1HXYD 2P7UA 3IAM1 1DO0A 1B9RA 2KFKA 1EWLA 1Y4HA 1R2YA 4K7WA 1G6JA 4TSSA 1L6UA 3CBJA 3RNGC 4DV5M 2RKOA 2R9FA 4YSXB 2Y0TA 4C00A 1T0YA 2LGDA 3MHHA 3T3NA 2LVPA 2PLPA 4YXDB 1XCQL 4ASWC 4XYCA 4MB7A 4GC5A 3RUIB 3GCBA 2V4LA 2KHWB 2YEPF 1WJ7A 1DGHB 3FTFA 3VUXA 2X8AA 3AB5A 1BT0A 3AEBB 1ZOYB 3MFGA 1EF1A 4RFBA 3N1YC 2WGSA 2YJ2A 3N1XC 2WDQB 3TEYA 1TIFA 3L26A 2Y5CA 2H89B 4XDCA 4DBGA 3SD5A 2N7DA 2R45A 2F5QA 3NBXX 4FWDA 7CATA 1TTNA 3B74A 2KWVB 2PNSA 2I7PA 5HG2A 1N5WA 5T8IA 5FTJA 4KIKA 2RRUA 5EQTA 1Y56A 3V6CA 2E03A 1PRBA 2LVOA 3F75A 1F2RI 2CR5A 2PVOD 4C4VB 3PREA 1OAOC 5CHWA 2YJ9A 4PP2E 3IAS1 1L5PA 3KQ4A 5G55A 3L29A 4JI2M 3LFYA 3ZDTA 3ZQ4A 3M0EA 3MC8A 2X4AA 2ZNVB 5IO9A 3ML8A 2B1NA 1TBEA 2AS8A 3UQAA 2GBRA 2JY7A 4CDEB 3U8ZA 3UZUA 2J42A 1HQYE 4LF4M 4XGAB 5AUKA 2CU3A 1ZCMA 2V3SA 4MH0E 4E3CA 1PJTA 4USAA 1MFWA 4ZTBA 1PXVA 3QHTA 2D2QA 3AE4B 4RY2A 1CUKA 2W3SA 4N6EB 3ZNID 1LGRA 3A46A 5AZGA 3AOEC 4OEMA 3VR9B 3P42A 1NHWC 1JQ4A 2XSZD 2IO3B 3ZC7B 3LCVB 5CHTA 2CWBA 1F1HA 4I4LA 2N7EA 4MSXA 4LRSA 1V6EA 3PRZA 2CHVA 3TQSA 5MPOA 4M0WB 1A5TA 2IYDB 4MM3A 2HTME 4MGHA 1QDRA 3DF0A 5L95C 2M0XA 1IPGA 2DHYA 3KYDD 1WE6A 3NBIA 1E9MA 2FO5A 3GLGA 4N8WA 2CJNA 3RNFC 5AUIA 1A6RA 3PHWB 3V05A 3KXEC 3PHWA 4EZJA 4RMAA 3RYTA 3HU3A 2MBQA 5EP2A 3GLIB 4JI0M 1FXIA 2JTCA 3RI7C 1YALA 1JCKB 4W9FA 1BUIC 3U2SC 2KANA 1XXHA 2GI9A 4EZLA 2OPFA 4AKIA 4MM3B 2ERCA 1IY1A 2EA0A 1SJHD 2O25A 5EXSA 5D94A 2GHUA 4YV8A 2N7JA 2WXGA 3W1SC 1TY2A 1IP9A 3KVWA 3ZKJC 5JHBA 5BPVA 1TH2A 1VEKA 3C0RA 1IY0A 4LJAA 4B3SM 2DWLA 2DWQA 3HVZA 2DZZA 2XLJA 2NPTB 3K9OB 4FA6A 4XE0A 1SE9A 2KDFB 2LVQD 3K9PB 4CDCB 3RVXA 3OISA 2BF8B 2O6VB 3I9V1 1U9VA 3IG5A 1RFAA 1J8CA 3A9KB 2Z8LA 1Y8RC 1OQYA 4LZJA 1UM8A 2K5PA 1ITOA 2NS5A 4IWPA 5ITRA 2FFJA 4TKNA 4JE3B 2JRIB 4GUAA 3WAPA 5AEKB 2G7YA 2KDLA 1UGMA 2FRQA 2IDYA 4KSLC 4WJNA 4I04A 4PK1A 3OVZA 1QOFA 3H89A 3UMMA 2QHOB 1R4NB 2PREA 4LJOB 3AEEB 4N59A 4BOPA 2QP9X 2KFKB 4I6NB 4JI3M 1LXDA 1RM6C 3DBHB 2Q5WD 3K8UA 4IBJA 5EP1A 3DHHC 4JI6M 5LXHA 3U6LA 3RVVA 1NL6A 4KIKB 4IW0A 4QNRA 4YYQA 1JRPA 1C1YB 4HROA 5JZEA 1DOIA 2CHWA 3H7PB 2MH8A 4JLCA 3ZLZA 4DXGA 3BOSA 4UN2B 2G8JA 1ATKA 2AHMA 4FHKA 2JUJA 3BK2A 3KWVA 2D7GA 1NSFA 5CVMA 1L0XB 2RR9A 3Q8EA 1L7YA 4HK2A 3PHUA 5ITXE 2E01A 1Z59A 4FN2A 1IN7A 4HDQA 2QZ4A 3W9CB 3NVWA 3IFWB 3RCZA 2BKRB 2VDBB 1FRDA 1L6VA 1ZXIA 2PE6B 4LCBA 2ZVOA 3VR8B 1FFVA 5H92C 3BY4A 3DVGY 2GBNA 2QENA 2M0AA 3VTVA 4RGMA 3WIMA 1LV7A 3R66C 4II3B 2H88B 3SBJA 3BYTB 3FYCA 2BB5A 4GEWA 2K0BX 2PIAA 1Y08A 2Y6EA 2KXEA 2LASA 3BVZA 2LJIA 5GXGB 3VVWB 3R8BA 1WGNA 2UUBM 2BBCA 3JSVA 2AUXA 4Z8XA 4JI7M 3VRBB 3FUXA 3EGRA 4DR4M 3WXEA 2LRWA 3HJQA 2JRHA 4ITKA 1AW7A 3Q3JA 4FJVB 4BBAA 2AX5A 1RWSA 2KAJA 1OKSA 1Z5BA 4S17A 3ZJVA 4KZ0A 4XUIA 1WYWB 1BVSA 5EE0A 3URYA 5HI1A 3J7AS 4JIOU 4YTPB 4AQYM 1CQVA 2JT4B 1L4DB 2PKOA 5PADA 1E0ZA 2R9CA 2O6XA 4R71A 1LFDA 3L25A 3MC0B 2JZZA 5C3JB 5D2MB 3WAOA 5FKAC 5C1BA 2BB6A 3BIID 3LCUA 1D4BA 1YJ1A 2XNAC 1NVID 3ZNZB 4RM8A 4C7YA 2DX5B 1VRAB 5ITQA 2WHIA 3Q3OC 3ALBA 4HXDB 4AW4A 2IY1B 1PCIA 4AKGA 2N9XA 4P17A 2DWNA 2QPAA 3D8BA 3NG0A 2LVAA 3GRRA 2FIDA 1QDTA 1XNQM 2BS2B 4FW9A 3BVMA 1WY8A 4DR5M 3FUVA 2C98A 1ZKHA 1V1OA 1GO5A 3T15A 3T38A 4ZRPA 2JYTA 3ZTDA 1L1ZA 4QHTA 3R7QA 3R2TA 2KHHA 1GPXA 3APFA 2LHCA 3UI3A 1L8QA 2GBJA 3BZDB 5ITYA 4PT5A 2K8CA 4IBIA 3Q8AA 4MSQB 3PT2A 5D7GA 4G4QA 1IUEA 4LJ9A 4W9DA 4DUYM 1QILA 4BOZB 3FKYA 3FRHA 4FD2A 2Y3AA 3DOWA 2JP7A 2XFSA 2LEKA 2ICIA 3NHEA 1KLGD 1WGYA 1YK8A 1DGHA 2GB1A 1GLOA 4WJOA 4AP4C 1WXMA 5DYGA 1TTEA 4NC6A 2QIEB 4J3OD 4NJ6A 2XU5A 1I42A 1MDWA 2ZAMA 2FIFA 2JXTA 1VEJA 2FYEA 1OEYA 4WQOB 2D7EA 1TDZA 1AU3A 2JQRB 1TZOA 1QDQA 3LXSA 5IKCM 3FILB 1L0YB 3W30A 3GPPA 1S4VA 2MX2A 4ANVA 1X37A 2JXXA 4II2B 5IOIA 4LK0M 3L0WB 3UIPB 5ITUA 3VQIA 4DXAB 2H1RA 2V6ZM 1PJJA 3W0FA 3L13A 2R9NA 1R5LA 2BQQA 3PVSA 1F0ZA 4DK5A 2WZJA 3FRIA 2NQ8C 3HU2A 1D5XC 4L4UA 1VDVA 3K9PA 3IT6B 1YMHE 4GSWA 3NHEB 1N61A 4GB9A 1PGAA 2K39A 3B9PA 2LHGA 3DHGC 4MZOA 2MJ3A 1XQQA 4GDKA 2KFJA 1F77A 1DGGA 2MLBA 4M01A 2CKHB 2DYBA 3WHLA 1V80A 2O2VA 2KTRB 2R44A 4LZZA 3CTWB 2KDIA 1EUVB 2DCBA 2G45B 4WWMA 2DZYA 2DENA 4P7IA 2F4VM 2KJRA 2WXIA 4D8IA 4MI7A 1SXJC 5L8RF 3TSSA 1EM7A 2BDLA 2BJVA 2A5UA 2XU3A 3VTWA 3HM3A 4N79A 2J7QC 2L4FA 4DBGB 3IT4B 1JQPA 4DV3M 4B95A 1KH0A 1FIQA 4HXDA 5KPTA 2RGFA 2WDRB 2V4IB 1C4CA 4WJPA 1WXVA 1CV8A 2IGHA 2PVGC 3A9JB 3AE3B 1K82A 2IO2B 3HU1A 1R2ZA 4WH4A 1J7AA 2CHQA 5FPWA 4LTUA 1SBBB 4RGTA 3HVDA 2CHGA 5D3DA 5IT9S 3KSJA 1FCLA 1S3SA 1SEBD 3U6OA 2D3GA 3W67A 1E8ZA 1VZ8A 4YVAA 1ORYB 1NVMA 3KOYE 3GP7A 2YJ8A 2UYZB 2RPQA 4B0MA 3BBAA 4HPMB 4WAFA 4BPVA 4B3RM 4EEWA 3PRPB 3FAHA 2IGGA 2DC9A 4PS7A 1DYQA 1LQBA 5LNK1 3WA0A 1MS6A 3VK7A 4LNIA 4HWYA 1VG5A 1C3TA 2JA2A 1JMLA 1U9WA 4CDDB 3DZDA 3B2GA 1P1AA 1K3WA 4QRVA 1XF5L 3GLFB 1Q3CA 3TL5A 2CU1A 4ZRQA 5LXIB 2G3QA 1ZW7A 3GS2A 3HX3A 1HEZE 4NRVA 2CHZA 3X0WA 2WXRA 4S12A 2FUHB 2LGYA 1WGLA 1XNRM 4FULA 1MVKA 1NYQA 3U8EA 4KKJA 4YSZB 2LHDA 4EFOA 4YTNB 1PADA 2K9DA 2J52A 2AQ1B 2MHJA 4KDIC 1K51A 2V3NA 1NI2A 2F7DA 3KP0E 3H8BA 3PHXA 4GDLB 1N78A 2QBYA 1N60A 4WWNA 3U61A 1WRIA 3KOZE 1A5RA 1GB1A 2YR0A 3ZNGC 3Q14C 4BKTA 1FXAA 1WX8A 3D8LA 2JWUA 1E7UA 1P98A 3IXSA 4OVVA 3DBHI 4OU7A 1WFYA 2OJWA 3RFWA 1YQBA 2KO3A 2OHFA 4P6GA 3UQBA 4A20A 1J5EM 3WHKA 2QSFX 4LF8M 4ZRKA 2KNAA 4DR2M 4QRXA 5EZSA 4EKUA 5BR8M 4GITA 4IM3A 1AYVA 2AGAA 3OTOM 3J81S 3SARA 3KS4A 4HJKA 4I07A 4YYWA 1EWPA 2LGSA 2AUZA 1W5TA 3CF2A 1G8PA 3BPFA 2FS1A 4IBBA 2WDVB 4JL9A 3GO8A 4WIPA 4OZBA 4M9ZA 1IY2A 3N3KA 4ZHPA 1AU4A 4GOCA 3GB1A 4F7ZA 3B0AA 3OQCA 1WHCA 4ZPXA 2AEHA 2NTSA 2L00B 3E4RA 4D80A 2BS4B 4HLQA 5G2NA 3I51A 3AEGB 4XWWA 4A9AA 4RKXA 3RNCC 4HKZE 1S3SG 4L23A 1KM7A 1YX5B 3BINA 4DUZM 4ZDVA 2Q2EB 3RGPA 3WANA 2AYNA 2G4SA 2B3TA 3VXWA 2OOAA 4KO8A 1WMHB 5CHVA 4BOSC 1GJTA 2W9NA 4LDTD 5FK9C 5EE3A 2HJ8A 3AECB 1QANA 2N9EB 2PJHA 4LY6A 1DGBA 2JUOA 1G71A 1QOBA 4D8BA 3RFZB 1U4AA 4MGKE 2WXNA 4IIWA 4ANUA 1KHQA 4A3OA 3ZUAA 3GZNI 2VH2A 3MP9A 2KD0A 2Z59B 3U4EG 4W4UA 3W1YA 2I1JA 4AG6A 1KLUD 4DR3M 1S1QB 1GMYA 2D5GA 4G3OA 2CP8A 3V6EA 2MCNB 1UNSA 4WWOA 1N34M 2D10A 1XWIA 1QUSA 2J0KA 2BWES 5JI3E 3HJ8A 1E7PB 2EMSA 3OG5A 4OHJA 2NQDB 1GECE 2XK5A 1ACCA 1HE8A 4IWOA 4RM9A 1K53A 4TMAB 3SFEB 3SAWA 4DHJD 4K7SA 1XXHB 5FR3A 1ZQ9A 1B1ZA 4KX6B 4B7FA 3NWLA 1XKGA 4YSYB 3VH4B 3P2BA 3B7NA 4HDOA 3FTCA 3E56A 1V5OA 5FTNA 3HHMA 1QAQA 1WIAA 3AOGA 4OELA 4ACFA 4AI6A 1PM5A 3PSEB 3EIEA 3HGIA 2EJSA 3NJTA 3KFUG 2WXQA 4KHPM 1E8YA 1ZMVA 1FO4A 2FQ9A 4JXJA 3K2LA 3RPFC 4IBFA 3SFZA 3GOEA 3GLGE 3GRUA 2MJEA 3PTFC 2FUG1 1WJ4A 3OAWA 1IYFA 3KDSE 2AL3A 4YHHM 1O0EA 1V86A 1ZAEA 2A4ZA 1HNXM 5EP3A 1SNKA 1ZMUA 2BNKA 5EJCA 1E7VA 4ZHOA 8CATA 1V1PB 2V1YA 4L15A 4FJYA 4M0DA 4DR1M 1MG8A 3L08A 4JI4M 2XH9A 5DPTA 1MN3A 1WR1B 4IBGA 3LJ3A 1C9FA 2IPPB 1V9JA 4FLHA 2KDEB 1N36M 3HHZA 5EE9A 2V3PA 3DQVA 2M8SA 2R4EA 3PRPA 1KFXL 1OJLA 1R7SA 2BGFA 1GVNA 3JYUA 4HPPA 3SDLC 3LMMA 2JQFR 2HHHM 1Z6TA 3QYEA 2G9HD 1NBFC 1CQDA 3QWLA 2L7HA 2JU6X 1J7KA 4FVMA 3LB8C 1L2NA 3PO0A 2MBEA 2BTWA 1P9DU 2LXAA 2MWSB 3MHSA 4K1RB 3HHIA 2JY8A 5IWAM 2MP2B 1JWAD 3AJIB 2BS3B 2QEJC 3QT4A 1DOXA 2ZBKB 3PNRA 3C0RB 3IHPA 1TS3A 2KC2A 1Y8GA 1JWUD 2QQ8A 1SIFA 3P5VA 3KUCB 1OAIA 5G5GA 1PIPA 1I4XA 4BKSA 2DHRA 3KW6A 1Q39A 2K6QA 1GL7A 4GKKM 2K6BA 1E6EB 3DPDA 3HWNA 2JZPA 4L8RC 1HZ6A 2IO1B 1FPYA 3AE2B 3SHFA 1PPDA 4GN1A 3Q8GA 1IGCA 3GLIE 1G41A 3KOWE 4IM0A 5H37D 1THEA 1XB2B 3CF6E 4BOZA 3U60B 4LDTB 4F8CB 3A33B 3PBHA 3H7PA 1QVRA 2MBOA 3W31A 2JX5A 1NNUC 1YZBA 2J0MA 3GLFE 3AE7B 2P5TA 4CJ6A 4ZOHC 3U30A 3ZNHB 2R2OA 3LDZE 2KZSA 2F5SA 2L32A 3IFUA 2ZTDA 3TE6A 3PNYA 3Q3FA 3KSEA 3Q8BA 4I81A 3BWUD 2KTRA 4II7A 2WSCF 2KMMA 3B21A 1QKZA 2CHXA 2GRIA 2Y21A 3PLUA 2C5LC 1T0QC 2DJFB 4YY3M 2KN5A 3THGA 3Q8FA 4BKGA 1C76A 1WZ3A 2DKLA 3PNVA 1TDHA 3ZYYX 3P5WA 2EKFA 1JWBD 1QYRA 2D7HA 1YN4A 1A70A 1X9YA 3GLHA 3L54A 1E5WA 2J4XA 3M95A 1N5XA 3QARA 2O5RA 2RGHA 4BKSD 2DAIA 1ZDVA 1DEUA 4B08A 4FK5A 4BBNC 3D6SA 2LRUA 4IUMA 3B79A 2CV2A 1WSPA 5C2TB 4AJWA 2FH0A 4F2LA 4RNAA 4DV2M 3RZFA 2VHSA 2DENB 1HNZM 2F1GA 2NCNA 4DMYA 1CS8A 3R8FA 3H8HA 4TUUA 4CZWA 2N9LA 2CB5A 1QQWA 2LVPC 3OVXA 1JWMD 4BFRA 1J19A 1GABA 2V9HA 5E6NA 5E6JA 4GH9A 4GMQA 1N75A 3QJZA 1D0KA 4DWFA 1MIRA 1KFUL 2LXCA 2DLBA 4RH6A 1W5SA 4K3CA 3K8ZA 2F5NA 2YFQA 2OULA 2DAMA 4OZCA 2R4JA 3LYYA 1D3ZA 3PZ8A 3PFIA 2FE8A 2VH1A 4FWGA 2SEBD 1JB0F 3MHSD 4Q8HA 4AXMA 4PP1A 3TEZA 1UUPA 4WP2A 1ZPSA 3WAMA 1T0SC 2YJCA 4P1CC 2YQZA 4HRSA 4GGQA 2TSSA 3O0UA 3SYKA 1N33M 2RDGA 2N9KA 2R62A 3TIXA 1JR3D 3QAQA 4TUWA 3H8CA 2EKIA 4KV2A 3PPAA 2WSEF 4REZA 2INDC 2VRRB 2FAZA 2FNAA 4LLGM 2WX0A 1TKEA 3DVNU 2OOBA 2XEWA 4AJYB 1NYRA 4AXLA 1AWDA 3DFZA 2BYFA 2PADA 4MSMB 1NQCA 1NJFA 1SE2A 4CHKA 2M1MA 3JR4A 4CISA 3ZDMC 4A90A 1QF6A 1LM8B 2JVCA 4LGYA 4UDUC 1Q10A 3VUYA 1NPZA 3QWZB 3C9EA 3V62A 1R4MB 2ZPNA 2C9WB 3PRMA 3PRMB 2EUCA 1UBIA 3M99A 4A8XC 2ZZPB 4QRGA 3AOEA 1C7YA 3ONSA 2DNFA 4KGSA 4X57B 3CBKA 3GRYA 2K47A 3T1YM 3X23A 3UK6A 2DC7A 2EKKA 5J2RA 2K25A 3PGEA 4IBKA 1HA5A 2O6VA 3U6QA 1MU5A 1J7CA 4BBNF 3RZWC 4CQNA 2XZUA 2BVCA 4YYUA 1C1KA 1XHBA 1YOVB 3I4YA 2JYEA 5BO4B 1Q5WB 3K9MA 3ML9A 2KMAA 1TS4A 2KNVA 2X38A 3D32A 1TLOA 4KLNA 4AG5A 5HHDG 4I6LB 1FEHA 3FYDA 3RNVA 2XF3A 3U5ZA 2HD5A 3BK1A 2QDFA 2VQEM 1CK1A 3IOQA 1OEYJ 3VFDA 5BMIA 2ZAOA 4FBJB 4AS1A 3TJPA 4BOUA 1ZUD2 2HE7A 3PV1A 3ZRCA 2VQFM 2WU2B 1E9SA 1TKYA 3VK8A 1MX0A 2I2YA 2NQAA 4MZSA 2BDZA 3SMSA 1DKIA 1STEA 5EXTA 1FMAD 1EFUB 2KZUA 1LO5D 3NVVA 4L16A 4PS3A 3FC4A 4LRTA 2VF7A 4C56C 3W1SA 1WGRA 2N1WA 3U6DA 2XEPA 4EZKA 4I5SA 1MHHE 2Z3XA 2IPKD 1SIJA 4FXCA 2M19A 3I01M 2LBCA 1I4PA 4HJGE 4L2YA 3AI8A 2DXIA 3N3GA 1SGHA 4X6IA 3J27B 4C80A 3N1ZC 1NV9A 2C7HA 2ON8A 3CIRB 1TGUA 2LWXA 1NI3A 2CS4A 3IBEA 1QQRA 1MEMA 4OW0A 1NB3A 3C19A 2J0JA 1OQQA 3APDA 3L2AA 3M63B 4MACA 1PVJA 1SP4B 2WXOA 2PW9A 4FCWA 3HIZA 2ONQA 4KVGB 1STFE 2KTFA 1Q1OA 2KT7A 4DQOC 2B3AA 1NB5A 4LGMA 2K9XA 1DGJA 1PYWD 1V49A 1E9RA 3AXCA 3N3KB 3AE6B 4NXMM 3T8MA 2E02A 2XFTA 3SU8X 2QC8A 1CZPA 1TY0A 2D3AA 2WQYB 1KOTA 4B7GA 3UGJA 4QBBA 1WRDB 3P4RB 4K3BA 4TV3A 3RNBC 3N9YC 3B1LX 3EHVA 2HCBA 4WA6A 1ZXHA 1KFVA 3B2FA 3AEFB 5JHAA 1C4PA 1TGZB 4MEMA 2KN4A 3AV8A 3A1QB 4X6JA 3FD9A 4W9JA 4NL4H 1Q6KA 2LWPA 2WXFA 1WJUA 1D6EC 4NAWA 2AYOB 3DBLB 4FADA 1HR0M 2VIIA 5A24A 3GQ5A 1HT1E 2VHFA 5J18A 2HH5A 4NY0A 2YLMA 3BC3A 2MROB 3MC9A 1VZ6A 2LTUA 1T6OA 2KQ4X 1V33A 1WGDA 3L17A 4MELA 4RGOS 4JI5M 3I63C 3NUHB 3P1MA 2BWEA 3RNEC 1IBXA 3Q3NC 1AU0A 4K0KM 1MI0A 2CUZA 4XZXA 1WM2A 3JSVB 4K81A 2DYOA 1IN6A 2KEBA 4M00A 4MT5A 5IAAC 2I38A 5DNYA 3IG3A 4AKHA 2RD0A 2DC8A 3EUB2 4KDLB 3KFQA 2KMCA 3AU4A 2DCDA 1UWMA 2DC6A 3HHXA 1I4QA 2DJGB 1K52A 1RRBA 4WURA 2DI0A 4LNNA 1ROEA 4ANXA 4LJ8A 1PPPA 3MHZA 3KKUA 1ET6A 2L8JA 1I4WA 1YE9A 1ET9A 1FRRA 2M60A 4R7GA 2LUEA 1K3BB 4XGIA 4GKJM 5EGWA 1MHXA 2R46A 3A4SC 5GKNA 3DWGC 2XZFA 1HUCB 1MHWA 3ZJUA 1E10A 3ZXVA 1IXSB 2JZ1A 1WR6E 4BAXA 5F02A 1NNJA 1P7FA 2UUAM 1UF0A 4MH8A 4AQ7A 4BVUC 4WWPA 1TH4A 1GC7A 2IGDA 1D5MC 3P4PB 3B7ZA 3PS6A 5ITTA 2QMTA 3GP1A 4LNOA 5DPWA 2H7JA 3N4CA 1JRUA 4AZFA 5JH5C 2AVWA 3ZIMA 4JGHB 5CX3A 1HTQA 3KX1A 3TMPA 4JI1M 5BMHA 2MR9A 1DF0A 2C9OA 1QLBB 3IG8A 1OIZA 2VF8A 3P4SB 4DHZB 4MGIE 4JWSC 2DZOB 3NS1A 4IKGA 1AARA 2R0IA 4YYVA 3HHAA 3SYLA 2I1KA 2A5YB 2MRPA 1U5IA 4D8EA 3TWKA 2KACA 2L1AA 2N35A 2DYMA 3C58A 5CVOB 3F92A 2FOIC 1GC6A 2ZCBA 1U9XA 1YUBA 2KX0A 2HKJA 1KRHA 2C7NB 4IG7B 3S3QA 2C60A 2QCUA 1F4IA 3GZNB 3FE3A 1GL6A 2KW0A 3WXGA 4EE2A 3MMPA 1X1MA 4HLEA 5FTMA 3HK0A 3L4PA 4F1SA 2QBYB 3RN9C 2C5RA 1TYGB 4ICUA 4K7CA 4XR7A 2KOXA 4W9CA 1TR8A 4ZRIA 1GJSA 1UH6A 1L1TA 3MTNB 2JY6B 2HD5B 1EE8A 1YSYA 2DZIA 1WX7A 2YJBA 1F52A 2DWZB 2LZ6A 4GHAA 4BB9A 2AIMA 2AYOA 2LHEA 2V1CA 3BYYB 1V92A 1IWDA 3S2AA 1YN3A 3VUWA 3EFCA 1H6UA 1EWOA 2PTLA 5JI2E 1WIVA 2JY5A 2CV0A 3TRKA 2XU1A 4EOYA 3C3EA 1ZGUB 2QILA 3KYCD 1E94E 4G4RA 1P7EA 3L10B 5KPZA 4FIPA 2LH0A 3TUOA 2FCNA 4IDIA 1T3QA 5DFLA 4HVBA 3RGSA 1Q02A 2BPSA 2L09A 4KGTA 3VH3B 4QOSA 1KF6B 2N1VA 4NZLB 1N63A 3JR5A 4DV7M 2UXBM 3SR6A 1PGBA 4NPNA 1DOYA 2WYQA 4RCOA 1Z2MA 2LI5A 4LNFA 3CWIA 1AIMA 4TQ1A 3QJ3A 3LQRA 2WNMA 1FNWA 1HT2E 1UD7A 3SFDB 3PXGA 1L2DA 4M8NA 4QH6A 2XN9C 3WXFA 3DBRI 3Q3MC 1WMHA 1TT5B 1QXPA 4PADA 1SB3C 4G50A 3NVYA 5A2QS 4XZ4A 3AULA 1Z5CA 2GMIC 3C9PA 1UZXB 1CJLA 4YYSA 3GLHE 5J94A 3U61B 4IOIE 3RD2A 3RVWA 2QSDA 3GPUA 4I05A 1N32M 3CSTA 1R7RA 1WXAA 4NAWB 5K16A 2MBHA 4KLBA 1ICFA 2IBIA 1RYJA 4YWGG 2LVOC 2O6VD 4XX5A 2KYWA 1VSNA 4IUMB 1GOZA 1SXJA 2WXKA 4BS5A 2WXMA 2ZJDA 3SEBA 2O2VB 2WP9B 3HY5A 1TKGA 3ENEA 1EWMA 3W2DA 4B6WA 3Q8XA 1I35A 1BMLC 3R9XB 1KJTA 3PLVA 2J7QA 2R9MA 4FWHA 3SAUA 3DHIC 1VDDA 1YQ4B 2ZEQA 3GLIA 2IO0B 4B7HA 3SASA 2K8BA 1FNNA 1J09A 1AIPC 5DYIA 5E6OA 4HCPB 2ACTA 1XLNA 5EE1A 3IEJA 2KZRA 3OJ4B 3ILKA 3QIJA 1EIJA 4HWIB 2WXLA 4W9LA 4LCDE 5JZEB 5EXXA 2J7NA 3Q6BA 4W9GA 2QJLA 3KSXA 2FRAA 2R61A 2MQJA 4OVZA 2Y5BA 3M7GA 4MJSB 3KVFB 1EWYC 4M02A 1E8WA 3UIOB 1NLJA 1WZ0A 3LQQA 4GDKB 5FSWA 4PCZA 1M94A 1V1PA 3EIHA 2WU5B 1NHGC 2ZCCA 5TSSA 1CB5A 2KVRA 1ENFA 3QX1A 1YJIA 1MJGM 3L27A 3IV2A 1FFUA 3HD3A 1N62A 1QAMA 3J80S 4JYAM 2Z4SA 3IMAA 1YQ3B 2DCCA 1F2RC 5EF4A 2CE7A
chains in the Genus database with same CATH topology
2WXJA 4KKIA 1G4AE 2L83A 2Z4RA 4KGRA 3KP1E 1GAQB 2ZW1A 3LVWA 2LXEA 5E26A 4M9SA 3LXFA 4M9XA 1VR9A 4N58A 4LFBM 3DA1A 4LJ5A 4LJ7A 1XMQM 4L78A 3AMZA 1MPEA 1BXTA 1D5ZC 4QNMA 1PJIA 1UGJA 1AN8A 1FM0D 4G6ZA 4IJEA 3A45A 3FTDA 5ITXA 4X64M 3U6PA 4X62M 1IBXB 1NY6A 3H4MA 2JSVX 5KPRA 2NMQA 4MGZE 3AN1A 2INNE 3ZGZA 2UXCM 1FCCC 1J7BA 2MEKA 1PDXA 3HHYA 3T3OA 1QZMA 5BYSA 3ABVB 2DBYA 2BW2A 3ZNHA 4NXNM 1JWSD 1T6BX 4A55A 4CHTB 3U52E 1CJEA 3O65A 1IM2A 1GLNA 2JRIA 4XBOA 1AYFA 1HQRD 4JX1C 2DZNB 2B76B 4MGYE 4GLSC 2EELA 4PDIA 4OVZB 2RPVA 4O1NA 2L7IA 1NJGA 4XDDA 2FBWB 5BYRA 2J7OA 3MP2A 4WQMA 2DOSA 3MK6A 2BT6A 1ZE3D 4JI8M 3FTEA 4QHSA 2X49A 4H2AA 2CJOA 3BVGA 3HRDD 3OWEB 1IN4A 4LF9M 4Q2JA 4W5WA 3PSEA 3P4QB 2DWMA 3BB7A 2AQ3B 1VZ7A 1Q3BA 3NVZA 5KQ8A 2UU9M 4GHLA 3VKHA 2ZW0A 2UZJA 1SF0A 4KODA 1KTKA 4DXFA 2BTEA 1N77A 5LMNM 1QT9A 2W82A 4X65M 3U6MA 2DVWB 2G8LA 3Q8CA 2K0PA 3SHGB 1T3TA 4QOZC 5KO3A 1FD6A 1I4HA 4DV0M 2UXDM 4G4NA 2Y0QA 2Y20A 3HJSA 4IBEA 5I4DA 2BJWA 2E5LM 1RFKA 1UWXA 2R18A 3TWMA 4Z6YA 1VLBA 4FCVA 4B0EA 4ARIA 4R3DA 2RGOA 4RF1A 2BTWB 3FUWA 1PFDA 2LFIA 3W5UB 2M56B 1GKIA 2NTTA 1NENB 1ZDXA 2AQ2B 2CV1A 1HZ5A 4JV5M 5HFYA 3TEWA 2KRKA 4D81A 5G5HA 3NZ3A 4DV6M 3SAVA 1UKFA 4OX9M 4L1BA 3KOXE 3U5ZB 3AFHA 1Z5AA 4M0WA 3TL4X 3HWSA 1C4AA 1FNUA 4C7ZA 2W54A 4BLCA 3GLGB 4HEA1 3U6CA 1EU4A 3HKPA 2E6XA 5BYQA 3FUTA 5D3IB 1DO2A 1EU3A 3ETRA 2N0SB 4LF7M 2Z7JA 2G1EA 4JPSA 2BU3A 4BOQA 2LUMA 5F3WA 1JROA 4P6VF 4JWUC 3AE8B 5BMGA 1I7HA 3FKEA 1PUTA 1OFIA 2I7NA 1IN5A 1QOAA 3DWMA 1L4ZB 3TPZA 2M5ZA 4LF5M 4DR7M 4YTMB 3JAMS 1NEKB 1E32A 2CE7A 2OQ4A 5IZ7D 3AKZA 2XSZA 1NY5A 3KLSX 4HKQA 3C8YA 4ITQA 2L52A 3AEAB 1PGXA 4PD2A 3U6EA 1R6BX 5C18A 2RDHA 3M6AA 2EO2A 3VKGA 2BYTA 3GQ4A 1SXJB 2C9CA 3AL0C 3R2IA 4PDGA 2LNHC 3UJNA 4IJFA 1HQCA 2HDEA 2MH7A 4IBDA 3AEDB 2OEDA 2V1UA 4JN6A 1SSNA 4US8A 5H8YE 4I8OA 2WS3B 1DGFA 1FJGM 3TEXA 1XCTL 3AE9B 1IBKM 4LFCM 3FUUA 1TJEA 1C78A 1IN8A 2K3UA 4NAMA 3V3XA 4DR6M 1SE4A 1WGKA 3P63A 1L0VB 2Z84A 4RGNA 3RE8A 1IXZA 2V0GA 2WXPA 4NOOB 1K50A 3AV0A 2R65A 1ESFA 2J53A 2VZKD 3J7BA 4ARCA 2Y5PA 5IREB 3VDPA 3I57A 1XEEA 3GLHB 2KA6B 1V97A 2XGNA 1L2BA 3W0LB 1SE3A 1YNTE 5FTKA 3I4VA 3VRAB 1SXJD 4NJCA 3ZCBB 5EXPA 1QOGA 2WLBA 3J2PB 3SATA 2KRUA 2C99A 1K3XA 1KSFX 4FCTA 2ACZB 4RF0A 3KS8A 4B3MM 2LGIA 5FLXS 3FILA 1I4GA 1IXRC 4X66M 4BOSA 4ZYSA 3A98B 2CEAA 1OFHA 4NSRA 1OQRA 1KYIA 1I4RA 1TS5A 1WXQA 3GRVA 4LJ4A 4LG2A 2VZKB 4IBCA 2PMVA 4DV4M 2LMCA 1JR3A 2MJDA 3DOAA 4EIWA 1V8CA 1IGDA 2G5GX 3VDUA 3GPYA 2IJ0A 3L28A 4HL4A 2K22A 3AM9A 4A6QA 1SXJE 3A42A 4D2KA 3Q69A 4CGYB 1JALA 1TH3A 3SC3A 2YEPB 1FNVA 2CFOA 3GQ3A 4WW0A 3NRZA 3K1JA 4LJ6A 1JW9D 2RMMA 3ZJTA 3MTVA 3AH7A 3VLFB 3WCQA 3EA6A 4D82A 2ZANA 1OFFA 1JQJC 3HUIA 2ZM6M 2UUCM 1C79A 3QAUA 1G59A 1XMOM 5EZQA 4YT0B 4G4OA 5JXVA 3GPXA 3AE1B 3PZ7A 2WXHA 3HHWA 4GRIA 1QAOA 4US9A 4DV1M 1XLPA 3J9CA 3W5VB 3TWLA 4LFAM 1I94M 1XC8A 4NSOB 1XO3A 1T5XD 3AE5B 4XWTA 4B3TM 2HWKA 4GC9A 3LVVA 3SMPA 2F5OA 3MJ5A 1G3IA 5FTLA 3E9SA 3U60A 2W3RA 4TQ0A 1WYGA 1XXGA 2YNMD 1C77A 1M4VA 4IP3A 1WWTA 3MHVC 5KQDA 3O13A 4P16A 1GB4A 3CF0A 3U6SA 3K92A 1D2NA 1SXTA 1XLQA 2KWDA 2HL7A 3ZH9B 4A5UA 2E3TA 3B9JA 4OZAA 2W55A 1L2CA 1ZP0B 1SJED 3T1HM 1IQPA 1IBMM 2L6OA 2KDMA 1YJJA 4GIPA 3KWLA 3GLFA 1EWCA 4LF6M 2C96A 1KFYB 2F5PA 1VJKA 5EP4A 3U7ZA 2SAKA 5LMUM 1YN5A 4A3VB 1IBLM 1XLOA 1HNWM 4NRWA 1TS2A 1HXYD 3IAM1 1DO0A 1B9RA 1R2YA 4TSSA 1L6UA 4DV5M 2RKOA 4YSXB 2Y0TA 3T3NA 2PLPA 4YXDB 1XCQL 4MB7A 4GC5A 2YEPF 1DGHB 3FTFA 2X8AA 3AB5A 3AEBB 1ZOYB 3MFGA 4RFBA 3TEYA 2WDQB 3L26A 2Y5CA 2H89B 4XDCA 2R45A 2F5QA 7CATA 4FWDA 2I7PA 5HG2A 1N5WA 5T8IA 5FTJA 5EQTA 1Y56A 1F2RI 2PVOD 3IAS1 1L5PA 3KQ4A 3L29A 4JI2M 3ZQ4A 3M0EA 2X4AA 3UZUA 2J42A 1HQYE 4LF4M 5AUKA 2CU3A 4MH0E 4USAA 4ZTBA 3AE4B 2W3SA 4N6EB 3A46A 3AOEC 3VR9B 3P42A 1NHWC 1JQ4A 2XSZD 3ZC7B 4I4LA 4LRSA 2CHVA 3TQSA 5MPOA 2HTME 4MGHA 1E9MA 3NBIA 3GLGA 2CJNA 5AUIA 3V05A 3KXEC 3PHWA 3HU3A 5EP2A 3GLIB 4JI0M 1FXIA 2JTCA 1JCKB 1BUIC 3U2SC 1XXHA 2GI9A 2OPFA 4AKIA 4MM3B 2ERCA 1IY1A 2EA0A 1SJHD 5EXSA 2N7JA 2WXGA 3C0RA 1TY2A 3KVWA 5BPVA 1TH2A 1IY0A 4LJAA 4B3SM 2DWLA 2DWQA 3HVZA 2XLJA 4XE0A 3I9V1 3IG5A 2Z8LA 2K5PA 4LZJA 1UM8A 5ITRA 2FFJA 4JE3B 4GUAA 2IDYA 1QOFA 3UMMA 3AEEB 4N59A 4BOPA 2QP9X 4JI3M 1RM6C 2Q5WD 4IBJA 5EP1A 4JI6M 3U6LA 4QNRA 1JRPA 4HROA 5JZEA 1DOIA 4DXGA 3BOSA 2AHMA 3KWVA 3BK2A 2D7GA 1NSFA 1L0XB 3Q8EA 3PHUA 5ITXE 1Z59A 1IN7A 2QZ4A 3W9CB 3NVWA 1FRDA 1L6VA 1ZXIA 4LCBA 3VR8B 1FFVA 5H92C 3BY4A 2QENA 2M0AA 4RGMA 1LV7A 2H88B 3SBJA 3BYTB 3FYCA 2BB5A 2PIAA 2KXEA 3BVZA 2LJIA 5GXGB 3R8BA 2UUBM 2BBCA 4Z8XA 4JI7M 3VRBB 3FUXA 3EGRA 4DR4M 3HJQA 4ITKA 1AW7A 4BBAA 2AX5A 1RWSA 2KAJA 1Z5BA 3ZJVA 5EE0A 3URYA 5HI1A 3J7AS 4YTPB 4AQYM 1CQVA 1L4DB 2PKOA 1E0ZA 3L25A 3MC0B 5C3JB 5FKAC 5C1BA 2BB6A 3BIID 1D4BA 2XNAC 1NVID 4C7YA 1VRAB 5ITQA 4HXDB 4AW4A 4AKGA 2DWNA 2QPAA 3D8BA 3GRRA 1XNQM 2BS2B 4FW9A 3BVMA 4DR5M 3FUVA 2C98A 1V1OA 3T15A 3T38A 4ZRPA 2JYTA 1L1ZA 4QHTA 3R2TA 1GPXA 3UI3A 1L8QA 3BZDB 5ITYA 4PT5A 4IBIA 3Q8AA 3PT2A 5D7GA 4G4QA 1IUEA 4LJ9A 4DUYM 1QILA 4FD2A 2Y3AA 2XFSA 2LEKA 2ICIA 1KLGD 1DGHA 2GB1A 5DYGA 2QIEB 4J3OD 2ZAMA 2JXTA 2D7EA 1TDZA 2JQRB 1TZOA 3FILB 1L0YB 3W30A 3GPPA 1X37A 4LK0M 5ITUA 3VQIA 2H1RA 2V6ZM 1PJJA 3W0FA 3PVSA 1F0ZA 2NQ8C 3HU2A 1D5XC 4L4UA 1VDVA 3IT6B 1YMHE 1N61A 1PGAA 3B9PA 2MJ3A 1F77A 1DGGA 3WHLA 4LZZA 3CTWB 4WWMA 2F4VM 2WXIA 4D8IA 4MI7A 1SXJC 3TSSA 1EM7A 2BJVA 2J7QC 3IT4B 4DV3M 1KH0A 1FIQA 5KPTA 2WDRB 2V4IB 1C4CA 2IGHA 2PVGC 3AE3B 1K82A 3HU1A 1R2ZA 4WH4A 1J7AA 2CHQA 4LTUA 1SBBB 4RGTA 5D3DA 2CHGA 3HVDA 5IT9S 3KSJA 1FCLA 1S3SA 3U6OA 1SEBD 1VZ8A 1ORYB 1NVMA 3KOYE 3GP7A 4B0MA 3BBAA 4WAFA 4B3RM 3FAHA 2IGGA 1DYQA 5LNK1 3VK7A 2JA2A 1JMLA 3DZDA 3B2GA 1K3WA 1XF5L 3GLFB 1Q3CA 4ZRQA 3GS2A 1HEZE 4NRVA 2WXRA 4S12A 1XNRM 1MVKA 1NYQA 4KKJA 4YSZB 2LHDA 4YTNB 2J52A 2AQ1B 1K51A 2V3NA 3KP0E 3PHXA 4GDLB 1N78A 2QBYA 1N60A 3U61A 1WRIA 3KOZE 1GB1A 2YR0A 1FXAA 3D8LA 2JWUA 3IXSA 4OU7A 3RFWA 2OHFA 1J5EM 3WHKA 4LF8M 4DR2M 5EZSA 5BR8M 4GITA 2AGAA 3OTOM 3J81S 3SARA 3KS4A 1W5TA 3CF2A 1G8PA 4IBBA 2WDVB 3GO8A 4WIPA 4OZBA 4M9ZA 1IY2A 4ZHPA 3GB1A 3OQCA 4ZPXA 2NTSA 3E4RA 4D80A 2BS4B 4HLQA 3I51A 3AEGB 4XWWA 4A9AA 4RKXA 4HKZE 4L23A 4DUZM 2Q2EB 3RGPA 4KO8A 5FK9C 5EE3A 3AECB 1QANA 4LY6A 1DGBA 1QOBA 4D8BA 3RFZB 4MGKE 2WXNA 4IIWA 3MP9A 3U4EG 4AG6A 1KLUD 4DR3M 2D5GA 1UNSA 1N34M 1XWIA 5JI3E 3HJ8A 1E7PB 4OHJA 1ACCA 1K53A 4TMAB 3SFEB 3SAWA 1XXHB 5FR3A 1ZQ9A 1B1ZA 4KX6B 4B7FA 3NWLA 4YSYB 3FTCA 3E56A 5FTNA 1QAQA 3AOGA 4AI6A 1PM5A 3EIEA 3HGIA 3KFUG 2WXQA 4KHPM 1FO4A 4JXJA 3K2LA 3RPFC 4IBFA 3SFZA 3GRUA 2MJEA 2FUG1 3KDSE 4YHHM 1ZAEA 1HNXM 5EP3A 2BNKA 5EJCA 4ZHOA 8CATA 1V1PB 4L15A 4M0DA 4DR1M 4JI4M 2XH9A 4IBGA 1C9FA 1N36M 3HHZA 5EE9A 2V3PA 2R4EA 3PRPA 1OJLA 1R7SA 1GVNA 3LMMA 2HHHM 1Z6TA 2G9HD 3QWLA 2L7HA 2JU6X 1J7KA 4FVMA 3LB8C 2BTWA 3PO0A 5IWAM 1JWAD 3AJIB 2BS3B 2QEJC 1DOXA 2ZBKB 1TS3A 1JWUD 5G5GA 1I4XA 2DHRA 3KW6A 1Q39A 1GL7A 4GKKM 1E6EB 2JZPA 4L8RC 1HZ6A 3AE2B 3SHFA 1IGCA 1G41A 3KOWE 5H37D 3CF6E 4BOZA 3U60B 1QVRA 3W31A 2JX5A 1NNUC 1YZBA 3AE7B 2P5TA 4ZOHC 2KZSA 2F5SA 2L32A 3IFUA 3TE6A 3PNYA 3Q8BA 4I81A 3BWUD 4II7A 2KMMA 3B21A 1QKZA 2GRIA 2Y21A 4YY3M 3Q8FA 3THGA 1C76A 3PNVA 1TDHA 3ZYYX 1JWBD 1QYRA 2D7HA 1YN4A 1A70A 3GLHA 2J4XA 1N5XA 2O5RA 2RGHA 1ZDVA 4B08A 4IUMA 2CV2A 1WSPA 5C2TB 4DV2M 4RNAA 1HNZM 3R8FA 3H8HA 2N9LA 1QQWA 1JWMD 5E6JA 4GH9A 4GMQA 1N75A 2DLBA 4RH6A 1W5SA 3K8ZA 2F5NA 2YFQA 4OZCA 2R4JA 3LYYA 3PZ8A 3PFIA 2FE8A 4FWGA 2SEBD 3TEZA 1UUPA 1ZPSA 2YQZA 4HRSA 2TSSA 3SYKA 1N33M 2RDGA 2N9KA 2R62A 1JR3D 4TUWA 2EKIA 4REZA 2FNAA 4LLGM 1TKEA 1NYRA 1AWDA 3DFZA 1NJFA 1SE2A 3JR4A 4CISA 4A90A 1QF6A 4UDUC 4LGYA 1Q10A 3PRMA 2EUCA 4A8XC 3AOEA 4KGSA 3GRYA 2K47A 3T1YM 3UK6A 4IBKA 1HA5A 3U6QA 1MU5A 1J7CA 4CQNA 2XZUA 1C1KA 1XHBA 3I4YA 2JYEA 1TS4A 2X38A 4KLNA 4AG5A 5HHDG 1FEHA 3FYDA 3RNVA 2XF3A 3U5ZA 3BK1A 2VQEM 1CK1A 3VFDA 5BMIA 2ZAOA 4AS1A 4BOUA 1ZUD2 2VQFM 2WU2B 1E9SA 1TKYA 3VK8A 1MX0A 2I2YA 3SMSA 1DKIA 1STEA 5EXTA 1FMAD 2KZUA 1LO5D 3NVVA 4L16A 3FC4A 4LRTA 4C56C 3W1SA 3U6DA 2XEPA 4I5SA 1MHHE 2Z3XA 2IPKD 4FXCA 1SIJA 2M19A 4HJGE 4L2YA 1I4PA 2DXIA 3J27B 4C80A 2ON8A 3CIRB 1TGUA 2LWXA 1NI3A 1QQRA 4OW0A 1OQQA 3L2AA 4MACA 1PVJA 2WXOA 2PW9A 4FCWA 2ONQA 4DQOC 4LGMA 2K9XA 1DGJA 1PYWD 1E9RA 3AE6B 4NXMM 2XFTA 1CZPA 1TY0A 2WQYB 4B7GA 3UGJA 3P4RB 3N9YC 2HCBA 1ZXHA 1KFVA 3B2FA 3AEFB 1C4PA 2KN4A 3AV8A 3FD9A 4NL4H 2WXFA 1D6EC 1HR0M 2VIIA 3GQ5A 1HT1E 1VZ6A 2KQ4X 4RGOS 4JI5M 3NUHB 3P1MA 1IBXA 4K0KM 1MI0A 2CUZA 4XZXA 2DYOA 1IN6A 2KEBA 4MT5A 2I38A 5DNYA 4AKHA 3EUB2 1UWMA 3HHXA 1I4QA 1K52A 4WURA 1ROEA 4LJ8A 3MHZA 1ET6A 1I4WA 1YE9A 1ET9A 1FRRA 2M60A 4R7GA 4XGIA 4GKJM 1MHXA 2R46A 5GKNA 3DWGC 2XZFA 3ZJUA 1E10A 1IXSB 1NNJA 1P7FA 2UUAM 4MH8A 4AQ7A 1TH4A 2IGDA 1D5MC 3P4PB 5ITTA 2QMTA 3GP1A 4AZFA 3TMPA 4JI1M 5BMHA 2C9OA 1QLBB 3IG8A 3P4SB 4MGIE 4JWSC 2DZOB 3NS1A 4IKGA 3SYLA 2A5YB 4D8EA 3TWKA 2KACA 2L1AA 2DYMA 3C58A 2FOIC 1YUBA 2HKJA 1KRHA 2QCUA 1GL6A 2KW0A 4EE2A 5FTMA 3L4PA 2QBYB 2C5RA 1TYGB 1L1TA 1EE8A 1YSYA 2DWZB 4GHAA 4BB9A 2LHEA 2V1CA 3BYYB 1YN3A 1H6UA 2PTLA 5JI2E 2CV0A 3TRKA 2QILA 1E94E 4G4RA 1P7EA 5KPZA 2LH0A 3TUOA 4IDIA 1T3QA 3RGSA 2L09A 4KGTA 4QOSA 1KF6B 4NZLB 1N63A 3JR5A 4DV7M 2UXBM 3SR6A 1PGBA 1DOYA 4RCOA 3CWIA 4TQ1A 3LQRA 2WNMA 1FNWA 1HT2E 3SFDB 3PXGA 1L2DA 2XN9C 1SB3C 3NVYA 5A2QS 1Z5CA 3U61B 4IOIE 2QSDA 3GPUA 1N32M 1R7RA 4NAWB 1RYJA 4YWGG 1GOZA 1SXJA 2WXKA 2WXMA 3SEBA 2WP9B 1TKGA 3W2DA 3Q8XA 1BMLC 3R9XB 2J7QA 4FWHA 3SAUA 1VDDA 1YQ4B 3GLIA 4B7HA 3SASA 1FNNA 1J09A 5DYIA 1XLNA 5EE1A 3ILKA 2WXLA 5EXXA 2J7NA 2QJLA 3KSXA 2R61A 4OVZA 3M7GA 1EWYC 3LQQA 4GDKB 5FSWA 4PCZA 1V1PA 2WU5B 3EIHA 5TSSA 1NHGC 1ENFA 1YJIA 3L27A 1FFUA 1QAMA 4JYAM 3J80S 1N62A 2Z4SA 1YQ3B 1F2RC 2INPE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4REZ A;  4RF0 A;  3MP2 A;  4OVZ A;  4RNA A;  3E9S A;  4WUR A;  5KO3 A;  4PT5 A;  4R3D A;  4OW0 A;  4MM3 B;  5E6J A;  2FE8 A;  4OVZ B;  4RF1 A;  4M0W A;  4P16 A;  3MJ5 A; 
#chains in the Genus database with same CATH topology
 2FUD A;  2WXJ A;  4PYU A;  3BWK A;  4KKI A;  1G4A E;  2J5Y A;  2L83 A;  3I5J C;  2KNZ A;  2Z4R A;  1ISN A;  2PPH A;  4KGR A;  2MA9 B;  3B89 A;  2NPT A;  3M62 B;  1MEG A;  3F5V A;  3KP1 E;  2D11 A;  4IWQ A;  1GAQ B;  3E46 A;  2ZW1 A;  2EKE C;  1FXT B;  3LVW A;  2LXE A;  2K1F A;  5E26 A;  2WX1 A;  4M9S A;  3LXF A;  4OVU A;  3I3T A;  4M9X A;  4L6V 6;  1VR9 A;  4N58 A;  4LFB M;  2HWJ A;  3KW5 B;  3DA1 A;  1BQI A;  4LJ5 A;  1NV8 A;  4LJ7 A;  1XMQ M;  4L78 A;  3AMZ A;  2EMT A;  3KUZ A;  1V34 A;  1MPE A;  1D0L A;  1BXT A;  1D5Z C;  2XK5 B;  4QNM A;  3A4R A;  1PJI A;  1UGJ A;  4PS8 A;  1J0G A;  2MP2 A;  4EUT A;  3UF8 A;  2KWU B;  1PJS A;  1AN8 A;  4IC7 B;  2HAK A;  1FM0 D;  1Q0W B;  3PDF A;  4G6Z A;  1KLV A;  4IJE A;  3A45 A;  3FTD A;  5ITX A;  4X64 M;  2HTH A;  3U6P A;  4X62 M;  3JVZ X;  1KHP A;  1CSB B;  1IBX B;  1NY6 A;  3H4M A;  2QHO A;  1VEG A;  2JSV X;  3H7D A;  1TL9 A;  5KPR A;  2NMQ A;  4MGZ E;  3AN1 A;  2INN E;  3CSF A;  3ZGZ A;  1PPO A;  3RUL A;  2UXC M;  1DV0 A;  5JH3 A;  1FCC C;  1J7B A;  4HPL B;  2MEK A;  1PDX A;  3HHY A;  3ERV A;  2NR2 A;  3T3O A;  2UWQ A;  1QZM A;  3BCN A;  3TBL D;  5BYS A;  3ABV B;  2DBY A;  3PW3 A;  2KC1 A;  2BW2 A;  2NBU A;  2NVU I;  1H8C A;  3O1G A;  3ZNH A;  4NXN M;  1JWS D;  1T6B X;  4ANR A;  2XBB C;  4A55 A;  4CHT B;  3TCA A;  1P3Q U;  1WE7 A;  3U7D A;  3U52 E;  1CJE A;  3O65 A;  1IM2 A;  3HZJ A;  3DVG X;  1ZV1 A;  3ZQJ A;  1GLN A;  2CIO A;  2JRI A;  4XBO A;  2WBF X;  1AYF A;  1HQR D;  1BGO A;  1EF5 A;  4W5B A;  1PQS A;  4JX1 C;  2DZN B;  2B76 B;  2HXZ A;  5CHV C;  1VD2 A;  4MGY E;  4GLS C;  4C4V A;  2EEL A;  3RT3 B;  4PDI A;  4OVZ B;  2RPV A;  4O1N A;  2L7I A;  1TU6 A;  2NQG A;  1V81 A;  2NQI A;  1NJG A;  2DHZ A;  2GBM A;  4XDD A;  2FBW B;  5BYR A;  2CRU A;  1UEL A;  2J7O A;  4M8M A;  3MP2 A;  6PAD A;  4WQM A;  2DOS A;  1AUA A;  3MK6 A;  2LVN C;  4WJQ A;  5D6J B;  2BT6 A;  4ZYN A;  3KH0 A;  1ZE3 D;  4JI8 M;  3VAW A;  4K7U A;  3FTE A;  3H7S A;  3KUD B;  3OF8 A;  4QHS A;  2KLG A;  3VTU A;  2X49 A;  3A9J A;  3R3M A;  3H6S A;  4H2A A;  2CJO A;  3BVG A;  4CIZ A;  3HRD D;  1CTE A;  5DPR A;  3OWE B;  5GMV A;  2FT2 A;  1IN4 A;  4LF9 M;  4Q2J A;  4W5W A;  1CPJ A;  2GFO A;  2ASQ A;  3PSE A;  1AYU A;  3P4Q B;  2DWM A;  3BB7 A;  2Z8Y M;  2AQ3 B;  1T43 A;  1VZ7 A;  1Q3B A;  2IZV B;  2INC C;  3NVZ A;  5KQ8 A;  3VFK A;  2L05 A;  2UU9 M;  4GHL A;  3VKH A;  3DBS A;  3PHX B;  5FR6 A;  4GDL A;  2JXN A;  1XT9 B;  2ZW0 A;  3KWB X;  2K6D B;  2UZJ A;  4BSQ A;  2L2D A;  1ZMW A;  2KLC A;  1SF0 A;  4KOD A;  1KTK A;  1M6D A;  4DXF A;  4WAA A;  2BTE A;  5KHQ A;  1N6Z A;  2MGW A;  1N77 A;  2L0F A;  1NDD A;  2P86 A;  5LMN M;  2H5X A;  1QT9 A;  2W82 A;  4X65 M;  1UFZ A;  3L16 A;  5AZF A;  3U6M A;  2FCM A;  1NO1 A;  2DVW B;  2G8L A;  3Q8C A;  2K0P A;  3SHG B;  2KDB A;  1T3T A;  1KXR A;  4KSK C;  2ZVN A;  4QOZ C;  3HM6 X;  4G0N B;  1HJP A;  2ZNV C;  3PVL A;  5KO3 A;  2GQF A;  1FD6 A;  1WGG A;  2G4D B;  1I4H A;  1XD3 B;  1EF7 A;  1IXS A;  2OO9 A;  4DV0 M;  3E1Z B;  2UXD M;  4G4N A;  2Y0Q A;  2Y20 A;  3HJS A;  4CO7 A;  3NY5 A;  4IBE A;  5I4D A;  2BJW A;  3MOR A;  2E5L M;  3KWZ A;  1RFK A;  1IFY A;  3QC8 B;  1UWX A;  2R18 A;  4HEO A;  3NZU A;  2AU1 A;  3TWM A;  4Z6Y A;  1VLB A;  2WDT B;  1VQ1 A;  3TMP B;  4FCV A;  4B0E A;  4ARI A;  4R3D A;  2RGO A;  3OLM D;  2ATO A;  4RF1 A;  2BTW B;  1R4G A;  3FUW A;  1PFD A;  2LFI A;  1MG4 A;  3VDZ A;  3W5U B;  3KW9 A;  2M56 B;  1GKI A;  2MSE D;  1F2A A;  2NTT A;  1NEN B;  1ZDX A;  2AQ2 B;  4BQV A;  3C3D A;  2CV1 A;  3H6N A;  3NOB A;  3IUT A;  1HZ5 A;  3N20 C;  4JV5 M;  5HFY A;  3TEW A;  2KRK A;  4D81 A;  5G5H A;  1GUA B;  2KQS A;  4DV6 M;  3SAV A;  3NZ3 A;  1UKF A;  4OX9 M;  2Z0D B;  4L1B A;  4MDK E;  3KOX E;  3U5Z B;  3AFH A;  1Z5A A;  1R4N I;  4M0W A;  3TL4 X;  3HWS A;  1C4A A;  4Q8G A;  1FNU A;  4C7Z A;  5TR5 A;  2W54 A;  4JQW C;  2BWB A;  4BLC A;  2GBK A;  3GLG B;  2KWC A;  4HEA 1;  1H4R A;  4W9K A;  4FJZ A;  1WJN A;  3U6C A;  1GNU A;  1EU4 A;  1QZE A;  3V76 A;  3HKP A;  2GOW A;  3I3T B;  2E6X A;  5BYQ A;  2PEA A;  2FNJ B;  3P5U A;  3FUT A;  1GG3 A;  2R9O A;  1BY8 A;  2JZ3 B;  5D3I B;  2AWT A;  1DO2 A;  1EU3 A;  3ETR A;  2N0S B;  4LF7 M;  2E00 A;  2Z7J A;  2G1E A;  4JPS A;  2BU3 A;  4BOQ A;  2LUM A;  4X6H A;  5F3W A;  1JRO A;  4P6V F;  2DZK A;  2L7R A;  4JWU C;  3AE8 B;  2IY0 B;  5CHF A;  5BMG A;  2LD9 A;  3JW0 X;  2O01 F;  1I7H A;  4DMX A;  2DAE A;  4Q7J A;  3FKE A;  2ARY A;  2KVZ A;  1PUT A;  1OFI A;  2I7N A;  2QCZ A;  2JZ0 A;  1IN5 A;  4G3X B;  1QOA A;  3CGW A;  3DWM A;  8PCH A;  1L4Z B;  1TF0 B;  3TPZ A;  3Q2A C;  2M5Z A;  4LF5 M;  4NQL B;  4DR7 M;  4MJS A;  1EO6 A;  2ZTC A;  2BWF A;  4YTM B;  3JAM S;  2XU4 A;  1NEK B;  1E32 A;  3T6P A;  2KXJ A;  2OQ4 A;  1ME3 A;  5IZ7 D;  1K8R B;  2OJR A;  1QOL A;  3AKZ A;  1WGH A;  2XSZ A;  1NY5 A;  2JWS A;  2JF5 A;  2DAK A;  3ZXR A;  3KLS X;  2L0T A;  4HKQ A;  2UU7 A;  3C8Y A;  4G11 A;  4ITQ A;  1YD8 U;  2L52 A;  5L83 A;  3AEA B;  1PGX A;  4PD2 A;  3U6E A;  1R6B X;  5C18 A;  2RDH A;  4ANW A;  3M6A A;  3R7R A;  5KHO A;  1PBH A;  3K24 A;  2EO2 A;  3VKG A;  3RMK C;  2BYT A;  3E21 A;  3GQ4 A;  1SXJ B;  2C9C A;  3V6C B;  2Z0E B;  4W9E A;  3AL0 C;  1OTR A;  1BP4 A;  3R2I A;  2DAG A;  3M3J A;  3I04 M;  4PDG A;  4URK A;  4E74 A;  2LNH C;  2KKC A;  3UJN A;  3DVN V;  4KZC A;  4IJF A;  4P1B C;  2ZPY A;  1HQC A;  2JY6 A;  1RAX A;  2X8X X;  2NBV B;  2HDE A;  2MH7 A;  2R2Q A;  4IBD A;  3AED B;  2OED A;  1POP A;  2V1U A;  3DCG A;  3ZTC A;  2P0R A;  2BYV E;  1RLF A;  2JQG R;  4JN6 A;  1SSN A;  4US8 A;  2OZ2 A;  2DZJ A;  2GLS A;  3P5X A;  3CMM B;  5H8Y E;  2FTD A;  5HKH A;  3AU5 A;  4I8O A;  2WS3 B;  3WAL A;  4AWJ A;  1DGF A;  1FJG M;  2RSU A;  2DNA A;  1WF9 A;  1U9Q X;  1D0M A;  3V6E B;  3TEX A;  1OGW A;  2L76 A;  3MJW A;  1T0R C;  2C7M B;  1XCT L;  4PI3 A;  4RKU F;  4ICV A;  1JR3 E;  1Z5S B;  2DAF A;  1AEC A;  1SG9 A;  2DZL A;  3AE9 B;  1IBK M;  3B08 A;  4HCN B;  1F2B A;  2Y5B B;  4LFC M;  4NJ7 A;  3FUU A;  2R6F A;  1TJE A;  2QNJ A;  3H1U A;  1C78 A;  2M4N A;  3VHT C;  1IN8 A;  1F9J A;  1V2Y A;  1XXH E;  2K3U A;  4NAM A;  4DR6 M;  1SE4 A;  1WGK A;  3P63 A;  3V3X A;  4YYR A;  1E90 A;  1L0V B;  2Z84 A;  3CH3 X;  3IVF A;  4GMV A;  4RGN A;  2YVC A;  2JPH A;  2KNB A;  3DBL I;  3RE8 A;  4S0R A;  1IXZ A;  5E6P A;  2V0G A;  2WXP A;  5IN7 A;  1AU2 A;  4GXB A;  1OIP A;  3N32 A;  1YIW A;  2OOB B;  4DHZ E;  4NOO B;  5CVN B;  1K50 A;  3AV0 A;  1VJV A;  2R65 A;  1ESF A;  2J53 A;  2VZK D;  2B1M A;  3J7B A;  2L4E A;  4ARC A;  2PE9 A;  2Y5P A;  5IRE B;  2D3B A;  4AOF A;  3VDP A;  3AI5 A;  3I57 A;  3V61 A;  1XEE A;  3I06 A;  2MBB B;  2IBI B;  3W68 A;  3GLH B;  3H9D A;  2KA6 B;  1UBQ A;  1V97 A;  2N4F A;  2XGN A;  1L2B A;  2REX A;  1F2C A;  3QA8 A;  4A3P A;  3W0L B;  1SE3 A;  1YNT E;  2R6N A;  5FTK A;  3I4V A;  3VRA B;  1SXJ D;  4NJC A;  3ZCB B;  1CVZ A;  1E8X A;  5EXP A;  1QOG A;  2WLB A;  3J2P B;  3ZW3 A;  3SAT A;  1HTO A;  4E71 A;  2KRU A;  2C99 A;  1K3X A;  2K8H A;  1KSF X;  4FCT A;  2KX3 A;  4DDG D;  2ACZ B;  4RF0 A;  3KS8 A;  4B3M M;  1WX9 A;  2MJ5 B;  2LGI A;  4NNJ B;  5FLX S;  3FIL A;  1I4G A;  2G8E A;  1IXR C;  4X66 M;  3BOW A;  4W5C A;  3PZD A;  4BOS A;  4ZYS A;  3A98 B;  2CEA A;  4GIV A;  1WXS A;  1OFH A;  2G3Q B;  4I6P A;  4NSR A;  2WSF F;  1OQR A;  1YVB A;  1KYI A;  1I4R A;  1TS5 A;  2DAJ A;  1WXQ A;  3GRV A;  3UIN B;  4LJ4 A;  4LG2 A;  2DZM A;  1P0R A;  1QUT A;  2VZK B;  4IBC A;  1CMX B;  4BZA A;  2PMV A;  2AL6 A;  4DV4 M;  2HHN A;  4BS6 A;  2LMC A;  1JR3 A;  2MJD A;  1YLA A;  3DOA A;  4EIW A;  1V8C A;  1IGD A;  2L3Z A;  4N4Z A;  2G5G X;  5J17 A;  3VDU A;  3GPY A;  2IJ0 A;  3L28 A;  4HL4 A;  2K22 A;  2N9P C;  5LLI A;  2KJ6 A;  3AM9 A;  2FCS A;  4A6Q A;  4N9F 4;  5DCN A;  1SXJ E;  3A42 A;  4D2K A;  1GJZ A;  3Q69 A;  4CGY B;  1JAL A;  1TH3 A;  3SC3 A;  2YEP B;  1FNV A;  3PT2 B;  3QK0 A;  2CFO A;  3GQ3 A;  4WW0 A;  3MTN A;  1OTR B;  3NRZ A;  3K1J A;  3APC A;  4XC2 A;  1R4M I;  4LJ6 A;  1JW9 D;  3N30 A;  5EDS A;  2RMM A;  4GU2 A;  3ZJT A;  3LW5 F;  3TNX A;  3MTV A;  3QSD A;  4B9K A;  3ZO5 B;  1PJQ A;  3AH7 A;  3T9L A;  4G54 A;  2LJ5 A;  3VLF B;  3WCQ A;  3EA6 A;  1AYW A;  4D82 A;  1WR1 A;  3NZS A;  3QYB A;  4KT0 F;  1FH0 A;  2ZAN A;  1OFF A;  1PGY A;  1YX6 B;  4IM2 A;  1JQJ C;  2D07 B;  3HUI A;  2APL A;  2ZM6 M;  5C1Z A;  2C0Y A;  2UUC M;  2J7Q B;  1C79 A;  3QAU A;  1G59 A;  1XMO M;  5EZQ A;  4YT0 B;  2WWZ A;  2LVQ A;  5CTR C;  3V60 A;  5IA7 A;  3BBZ A;  4G4O A;  5JXV A;  3ZUN A;  3GPX A;  4W9I A;  1YT7 A;  3AE1 B;  4XK8 F;  3PZ7 A;  2RDB C;  3NS8 A;  2WXH A;  3HHW A;  4GRI A;  4CYE A;  4CDF B;  1QAO A;  3A1Q A;  4US9 A;  4DV1 M;  3OF9 A;  4YL8 A;  3IEC A;  7PCK A;  2GNO A;  1XLP A;  3J9C A;  3W5V B;  3TWL A;  1V5T A;  4LFA M;  3H4J A;  4Y28 F;  1GCB A;  1I94 M;  4LJP B;  2PBH A;  4FJC A;  1XC8 A;  3GE8 C;  4ZRJ A;  4NSO B;  3S3R A;  1XO3 A;  1T5X D;  2KK8 A;  1YK7 A;  4FHJ A;  3AE5 B;  4XWT A;  4B3T M;  2OP3 A;  3UGB B;  2HWK A;  4GC9 A;  1WH3 A;  3LVV A;  3SMP A;  2F5O A;  4LNK A;  3RNA C;  3MJ5 A;  3BY4 B;  1G3I A;  5FTL A;  3E9S A;  2DCA A;  3DBR B;  1VCB A;  4DDI D;  3USV A;  3U60 A;  3BPM A;  2W3R A;  4TQ0 A;  3K9O A;  1WM3 A;  1WYG A;  2D3C A;  3IHP C;  1XXG A;  1F29 A;  4ZUX U;  2YNM D;  1C77 A;  1PPN A;  1PE6 A;  1M4V A;  4IP3 A;  1TZ1 A;  1WJ6 A;  1WWT A;  3MHV C;  5KQD A;  1LTM A;  3QQ8 B;  3O13 A;  5AZH A;  3EEC A;  4P16 A;  5DPS A;  1GB4 A;  3CF0 A;  3EC8 A;  2BKF A;  4W9H A;  2G6D A;  4QAY A;  3U6S A;  3K92 A;  1D2N A;  1SXT A;  5C23 A;  1XLQ A;  1MJD A;  2KQ7 A;  2KWD A;  3B7Q A;  3ZVV A;  2HL7 A;  3EFU A;  3ZH9 B;  4PYZ A;  4A5U A;  2E3T A;  3B9J A;  2NBW B;  1VDL A;  2LGX A;  4OZA A;  2W55 A;  1L2C A;  4DHJ B;  1WI0 A;  1ZP0 B;  3CH2 X;  1SJE D;  4P6E A;  3T1H M;  1IQP A;  1IBM M;  4NQK E;  1ME4 A;  5IP4 D;  2MW5 A;  2JWZ A;  2L6O A;  3DDC B;  2KDM A;  1YJJ A;  4GIP A;  2BYE A;  3KWL A;  3GLF A;  1EWC A;  3GE3 C;  1ZIV A;  4LF6 M;  2C96 A;  1KFY B;  3OJ3 A;  2F5P A;  2HJ1 A;  1VJK A;  5EP4 A;  3A9K A;  3U7Z A;  2INP E;  4F1I A;  3ECI A;  3QCA A;  2SAK A;  9PAP A;  3O65 B;  1QMY A;  5LMU M;  3SHQ A;  2JNH A;  1YN5 A;  4A3V B;  2KJH B;  3ZRF A;  4AUQ C;  3BXW A;  1IBL M;  5JA7 A;  2FCQ A;  1XLO A;  1P3Q Q;  1RU3 A;  4J6I A;  1HNW M;  2M17 A;  4NRW A;  1TS2 A;  1HXY D;  2P7U A;  3IAM 1;  1DO0 A;  1B9R A;  2KFK A;  1EWL A;  1Y4H A;  1R2Y A;  4K7W A;  1G6J A;  4TSS A;  1L6U A;  3CBJ A;  3RNG C;  4DV5 M;  2RKO A;  2R9F A;  4YSX B;  2Y0T A;  4C00 A;  1T0Y A;  2LGD A;  3MHH A;  3T3N A;  2LVP A;  2PLP A;  4YXD B;  1XCQ L;  4ASW C;  4XYC A;  4MB7 A;  4GC5 A;  3RUI B;  3GCB A;  2V4L A;  2KHW B;  2YEP F;  1WJ7 A;  1DGH B;  3FTF A;  3VUX A;  2X8A A;  3AB5 A;  1BT0 A;  3AEB B;  1ZOY B;  3MFG A;  1EF1 A;  4RFB A;  3N1Y C;  2WGS A;  2YJ2 A;  3N1X C;  2WDQ B;  3TEY A;  1TIF A;  3L26 A;  2Y5C A;  2H89 B;  4XDC A;  4DBG A;  3SD5 A;  2N7D A;  2R45 A;  2F5Q A;  3NBX X;  4FWD A;  7CAT A;  1TTN A;  3B74 A;  2KWV B;  2PNS A;  2I7P A;  5HG2 A;  1N5W A;  5T8I A;  5FTJ A;  4KIK A;  2RRU A;  5EQT A;  1Y56 A;  3V6C A;  2E03 A;  1PRB A;  2LVO A;  3F75 A;  1F2R I;  2CR5 A;  2PVO D;  4C4V B;  3PRE A;  1OAO C;  5CHW A;  2YJ9 A;  4PP2 E;  3IAS 1;  1L5P A;  3KQ4 A;  5G55 A;  3L29 A;  4JI2 M;  3LFY A;  3ZDT A;  3ZQ4 A;  3M0E A;  3MC8 A;  2X4A A;  2ZNV B;  5IO9 A;  3ML8 A;  2B1N A;  1TBE A;  2AS8 A;  3UQA A;  2GBR A;  2JY7 A;  4CDE B;  3U8Z A;  3UZU A;  2J42 A;  1HQY E;  4LF4 M;  4XGA B;  5AUK A;  2CU3 A;  1ZCM A;  2V3S A;  4MH0 E;  4E3C A;  1PJT A;  4USA A;  1MFW A;  4ZTB A;  1PXV A;  3QHT A;  2D2Q A;  3AE4 B;  4RY2 A;  1CUK A;  2W3S A;  4N6E B;  3ZNI D;  1LGR A;  3A46 A;  5AZG A;  3AOE C;  4OEM A;  3VR9 B;  3P42 A;  1NHW C;  1JQ4 A;  2XSZ D;  2IO3 B;  3ZC7 B;  3LCV B;  5CHT A;  2CWB A;  1F1H A;  4I4L A;  2N7E A;  4MSX A;  4LRS A;  1V6E A;  3PRZ A;  2CHV A;  3TQS A;  5MPO A;  4M0W B;  1A5T A;  2IYD B;  4MM3 A;  2HTM E;  4MGH A;  1QDR A;  3DF0 A;  5L95 C;  2M0X A;  1IPG A;  2DHY A;  3KYD D;  1WE6 A;  3NBI A;  1E9M A;  2FO5 A;  3GLG A;  4N8W A;  2CJN A;  3RNF C;  5AUI A;  1A6R A;  3PHW B;  3V05 A;  3KXE C;  3PHW A;  4EZJ A;  4RMA A;  3RYT A;  3HU3 A;  2MBQ A;  5EP2 A;  3GLI B;  4JI0 M;  1FXI A;  2JTC A;  3RI7 C;  1YAL A;  1JCK B;  4W9F A;  1BUI C;  3U2S C;  2KAN A;  1XXH A;  2GI9 A;  4EZL A;  2OPF A;  4AKI A;  4MM3 B;  2ERC A;  1IY1 A;  2EA0 A;  1SJH D;  2O25 A;  5EXS A;  5D94 A;  2GHU A;  4YV8 A;  2N7J A;  2WXG A;  3W1S C;  1TY2 A;  1IP9 A;  3KVW A;  3ZKJ C;  5JHB A;  5BPV A;  1TH2 A;  1VEK A;  3C0R A;  1IY0 A;  4LJA A;  4B3S M;  2DWL A;  2DWQ A;  3HVZ A;  2DZZ A;  2XLJ A;  2NPT B;  3K9O B;  4FA6 A;  4XE0 A;  1SE9 A;  2KDF B;  2LVQ D;  3K9P B;  4CDC B;  3RVX A;  3OIS A;  2BF8 B;  2O6V B;  3I9V 1;  1U9V A;  3IG5 A;  1RFA A;  1J8C A;  3A9K B;  2Z8L A;  1Y8R C;  1OQY A;  4LZJ A;  1UM8 A;  2K5P A;  1ITO A;  2NS5 A;  4IWP A;  5ITR A;  2FFJ A;  4TKN A;  4JE3 B;  2JRI B;  4GUA A;  3WAP A;  5AEK B;  2G7Y A;  2KDL A;  1UGM A;  2FRQ A;  2IDY A;  4KSL C;  4WJN A;  4I04 A;  4PK1 A;  3OVZ A;  1QOF A;  3H89 A;  3UMM A;  2QHO B;  1R4N B;  2PRE A;  4LJO B;  3AEE B;  4N59 A;  4BOP A;  2QP9 X;  2KFK B;  4I6N B;  4JI3 M;  1LXD A;  1RM6 C;  3DBH B;  2Q5W D;  3K8U A;  4IBJ A;  5EP1 A;  3DHH C;  4JI6 M;  5LXH A;  3U6L A;  3RVV A;  1NL6 A;  4KIK B;  4IW0 A;  4QNR A;  4YYQ A;  1JRP A;  1C1Y B;  4HRO A;  5JZE A;  1DOI A;  2CHW A;  3H7P B;  2MH8 A;  4JLC A;  3ZLZ A;  4DXG A;  3BOS A;  4UN2 B;  2G8J A;  1ATK A;  2AHM A;  4FHK A;  2JUJ A;  3BK2 A;  3KWV A;  2D7G A;  1NSF A;  5CVM A;  1L0X B;  2RR9 A;  3Q8E A;  1L7Y A;  4HK2 A;  3PHU A;  5ITX E;  2E01 A;  1Z59 A;  4FN2 A;  1IN7 A;  4HDQ A;  2QZ4 A;  3W9C B;  3NVW A;  3IFW B;  3RCZ A;  2BKR B;  2VDB B;  1FRD A;  1L6V A;  1ZXI A;  2PE6 B;  4LCB A;  2ZVO A;  3VR8 B;  1FFV A;  5H92 C;  3BY4 A;  3DVG Y;  2GBN A;  2QEN A;  2M0A A;  3VTV A;  4RGM A;  3WIM A;  1LV7 A;  3R66 C;  4II3 B;  2H88 B;  3SBJ A;  3BYT B;  3FYC A;  2BB5 A;  4GEW A;  2K0B X;  2PIA A;  1Y08 A;  2Y6E A;  2KXE A;  2LAS A;  3BVZ A;  2LJI A;  5GXG B;  3VVW B;  3R8B A;  1WGN A;  2UUB M;  2BBC A;  3JSV A;  2AUX A;  4Z8X A;  4JI7 M;  3VRB B;  3FUX A;  3EGR A;  4DR4 M;  3WXE A;  2LRW A;  3HJQ A;  2JRH A;  4ITK A;  1AW7 A;  3Q3J A;  4FJV B;  4BBA A;  2AX5 A;  1RWS A;  2KAJ A;  1OKS A;  1Z5B A;  4S17 A;  3ZJV A;  4KZ0 A;  4XUI A;  1WYW B;  1BVS A;  5EE0 A;  3URY A;  5HI1 A;  3J7A S;  4JIO U;  4YTP B;  4AQY M;  1CQV A;  2JT4 B;  1L4D B;  2PKO A;  5PAD A;  1E0Z A;  2R9C A;  2O6X A;  4R71 A;  1LFD A;  3L25 A;  3MC0 B;  2JZZ A;  5C3J B;  5D2M B;  3WAO A;  5FKA C;  5C1B A;  2BB6 A;  3BII D;  3LCU A;  1D4B A;  1YJ1 A;  2XNA C;  1NVI D;  3ZNZ B;  4RM8 A;  4C7Y A;  2DX5 B;  1VRA B;  5ITQ A;  2WHI A;  3Q3O C;  3ALB A;  4HXD B;  4AW4 A;  2IY1 B;  1PCI A;  4AKG A;  2N9X A;  4P17 A;  2DWN A;  2QPA A;  3D8B A;  3NG0 A;  2LVA A;  3GRR A;  2FID A;  1QDT A;  1XNQ M;  2BS2 B;  4FW9 A;  3BVM A;  1WY8 A;  4DR5 M;  3FUV A;  2C98 A;  1ZKH A;  1V1O A;  1GO5 A;  3T15 A;  3T38 A;  4ZRP A;  2JYT A;  3ZTD A;  1L1Z A;  4QHT A;  3R7Q A;  3R2T A;  2KHH A;  1GPX A;  3APF A;  2LHC A;  3UI3 A;  1L8Q A;  2GBJ A;  3BZD B;  5ITY A;  4PT5 A;  2K8C A;  4IBI A;  3Q8A A;  4MSQ B;  3PT2 A;  5D7G A;  4G4Q A;  1IUE A;  4LJ9 A;  4W9D A;  4DUY M;  1QIL A;  4BOZ B;  3FKY A;  3FRH A;  4FD2 A;  2Y3A A;  3DOW A;  2JP7 A;  2XFS A;  2LEK A;  2ICI A;  3NHE A;  1KLG D;  1WGY A;  1YK8 A;  1DGH A;  2GB1 A;  1GLO A;  4WJO A;  4AP4 C;  1WXM A;  5DYG A;  1TTE A;  4NC6 A;  2QIE B;  4J3O D;  4NJ6 A;  2XU5 A;  1I42 A;  1MDW A;  2ZAM A;  2FIF A;  2JXT A;  1VEJ A;  2FYE A;  1OEY A;  4WQO B;  2D7E A;  1TDZ A;  1AU3 A;  2JQR B;  1TZO A;  1QDQ A;  3LXS A;  5IKC M;  3FIL B;  1L0Y B;  3W30 A;  3GPP A;  1S4V A;  2MX2 A;  4ANV A;  1X37 A;  2JXX A;  4II2 B;  5IOI A;  4LK0 M;  3L0W B;  3UIP B;  5ITU A;  3VQI A;  4DXA B;  2H1R A;  2V6Z M;  1PJJ A;  3W0F A;  3L13 A;  2R9N A;  1R5L A;  2BQQ A;  3PVS A;  1F0Z A;  4DK5 A;  2WZJ A;  3FRI A;  2NQ8 C;  3HU2 A;  1D5X C;  4L4U A;  1VDV A;  3K9P A;  3IT6 B;  1YMH E;  4GSW A;  3NHE B;  1N61 A;  4GB9 A;  1PGA A;  2K39 A;  3B9P A;  2LHG A;  3DHG C;  4MZO A;  2MJ3 A;  1XQQ A;  4GDK A;  2KFJ A;  1F77 A;  1DGG A;  2MLB A;  4M01 A;  2CKH B;  2DYB A;  3WHL A;  1V80 A;  2O2V A;  2KTR B;  2R44 A;  4LZZ A;  3CTW B;  2KDI A;  1EUV B;  2DCB A;  2G45 B;  4WWM A;  2DZY A;  2DEN A;  4P7I A;  2F4V M;  2KJR A;  2WXI A;  4D8I A;  4MI7 A;  1SXJ C;  5L8R F;  3TSS A;  1EM7 A;  2BDL A;  2BJV A;  2A5U A;  2XU3 A;  3VTW A;  3HM3 A;  4N79 A;  2J7Q C;  2L4F A;  4DBG B;  3IT4 B;  1JQP A;  4DV3 M;  4B95 A;  1KH0 A;  1FIQ A;  4HXD A;  5KPT A;  2RGF A;  2WDR B;  2V4I B;  1C4C A;  4WJP A;  1WXV A;  1CV8 A;  2IGH A;  2PVG C;  3A9J B;  3AE3 B;  1K82 A;  2IO2 B;  3HU1 A;  1R2Z A;  4WH4 A;  1J7A A;  2CHQ A;  5FPW A;  4LTU A;  1SBB B;  4RGT A;  3HVD A;  2CHG A;  5D3D A;  5IT9 S;  3KSJ A;  1FCL A;  1S3S A;  1SEB D;  3U6O A;  2D3G A;  3W67 A;  1E8Z A;  1VZ8 A;  4YVA A;  1ORY B;  1NVM A;  3KOY E;  3GP7 A;  2YJ8 A;  2UYZ B;  2RPQ A;  4B0M A;  3BBA A;  4HPM B;  4WAF A;  4BPV A;  4B3R M;  4EEW A;  3PRP B;  3FAH A;  2IGG A;  2DC9 A;  4PS7 A;  1DYQ A;  1LQB A;  5LNK 1;  3WA0 A;  1MS6 A;  3VK7 A;  4LNI A;  4HWY A;  1VG5 A;  1C3T A;  2JA2 A;  1JML A;  1U9W A;  4CDD B;  3DZD A;  3B2G A;  1P1A A;  1K3W A;  4QRV A;  1XF5 L;  3GLF B;  1Q3C A;  3TL5 A;  2CU1 A;  4ZRQ A;  5LXI B;  2G3Q A;  1ZW7 A;  3GS2 A;  3HX3 A;  1HEZ E;  4NRV A;  2CHZ A;  3X0W A;  2WXR A;  4S12 A;  2FUH B;  2LGY A;  1WGL A;  1XNR M;  4FUL A;  1MVK A;  1NYQ A;  3U8E A;  4KKJ A;  4YSZ B;  2LHD A;  4EFO A;  4YTN B;  1PAD A;  2K9D A;  2J52 A;  2AQ1 B;  2MHJ A;  4KDI C;  1K51 A;  2V3N A;  1NI2 A;  2F7D A;  3KP0 E;  3H8B A;  3PHX A;  4GDL B;  1N78 A;  2QBY A;  1N60 A;  4WWN A;  3U61 A;  1WRI A;  3KOZ E;  1A5R A;  1GB1 A;  2YR0 A;  3ZNG C;  3Q14 C;  4BKT A;  1FXA A;  1WX8 A;  3D8L A;  2JWU A;  1E7U A;  1P98 A;  3IXS A;  4OVV A;  3DBH I;  4OU7 A;  1WFY A;  2OJW A;  3RFW A;  1YQB A;  2KO3 A;  2OHF A;  4P6G A;  3UQB A;  4A20 A;  1J5E M;  3WHK A;  2QSF X;  4LF8 M;  4ZRK A;  2KNA A;  4DR2 M;  4QRX A;  5EZS A;  4EKU A;  5BR8 M;  4GIT A;  4IM3 A;  1AYV A;  2AGA A;  3OTO M;  3J81 S;  3SAR A;  3KS4 A;  4HJK A;  4I07 A;  4YYW A;  1EWP A;  2LGS A;  2AUZ A;  1W5T A;  3CF2 A;  1G8P A;  3BPF A;  2FS1 A;  4IBB A;  2WDV B;  4JL9 A;  3GO8 A;  4WIP A;  4OZB A;  4M9Z A;  1IY2 A;  3N3K A;  4ZHP A;  1AU4 A;  4GOC A;  3GB1 A;  4F7Z A;  3B0A A;  3OQC A;  1WHC A;  4ZPX A;  2AEH A;  2NTS A;  2L00 B;  3E4R A;  4D80 A;  2BS4 B;  4HLQ A;  5G2N A;  3I51 A;  3AEG B;  4XWW A;  4A9A A;  4RKX A;  3RNC C;  4HKZ E;  1S3S G;  4L23 A;  1KM7 A;  1YX5 B;  3BIN A;  4DUZ M;  4ZDV A;  2Q2E B;  3RGP A;  3WAN A;  2AYN A;  2G4S A;  2B3T A;  3VXW A;  2OOA A;  4KO8 A;  1WMH B;  5CHV A;  4BOS C;  1GJT A;  2W9N A;  4LDT D;  5FK9 C;  5EE3 A;  2HJ8 A;  3AEC B;  1QAN A;  2N9E B;  2PJH A;  4LY6 A;  1DGB A;  2JUO A;  1G71 A;  1QOB A;  4D8B A;  3RFZ B;  1U4A A;  4MGK E;  2WXN A;  4IIW A;  4ANU A;  1KHQ A;  4A3O A;  3ZUA A;  3GZN I;  2VH2 A;  3MP9 A;  2KD0 A;  2Z59 B;  3U4E G;  4W4U A;  3W1Y A;  2I1J A;  4AG6 A;  1KLU D;  4DR3 M;  1S1Q B;  1GMY A;  2D5G A;  4G3O A;  2CP8 A;  3V6E A;  2MCN B;  1UNS A;  4WWO A;  1N34 M;  2D10 A;  1XWI A;  1QUS A;  2J0K A;  2BWE S;  5JI3 E;  3HJ8 A;  1E7P B;  2EMS A;  3OG5 A;  4OHJ A;  2NQD B;  1GEC E;  2XK5 A;  1ACC A;  1HE8 A;  4IWO A;  4RM9 A;  1K53 A;  4TMA B;  3SFE B;  3SAW A;  4DHJ D;  4K7S A;  1XXH B;  5FR3 A;  1ZQ9 A;  1B1Z A;  4KX6 B;  4B7F A;  3NWL A;  1XKG A;  4YSY B;  3VH4 B;  3P2B A;  3B7N A;  4HDO A;  3FTC A;  3E56 A;  1V5O A;  5FTN A;  3HHM A;  1QAQ A;  1WIA A;  3AOG A;  4OEL A;  4ACF A;  4AI6 A;  1PM5 A;  3PSE B;  3EIE A;  3HGI A;  2EJS A;  3NJT A;  3KFU G;  2WXQ A;  4KHP M;  1E8Y A;  1ZMV A;  1FO4 A;  2FQ9 A;  4JXJ A;  3K2L A;  3RPF C;  4IBF A;  3SFZ A;  3GOE A;  3GLG E;  3GRU A;  2MJE A;  3PTF C;  2FUG 1;  1WJ4 A;  3OAW A;  1IYF A;  3KDS E;  2AL3 A;  4YHH M;  1O0E A;  1V86 A;  1ZAE A;  2A4Z A;  1HNX M;  5EP3 A;  1SNK A;  1ZMU A;  2BNK A;  5EJC A;  1E7V A;  4ZHO A;  8CAT A;  1V1P B;  2V1Y A;  4L15 A;  4FJY A;  4M0D A;  4DR1 M;  1MG8 A;  3L08 A;  4JI4 M;  2XH9 A;  5DPT A;  1MN3 A;  1WR1 B;  4IBG A;  3LJ3 A;  1C9F A;  2IPP B;  1V9J A;  4FLH A;  2KDE B;  1N36 M;  3HHZ A;  5EE9 A;  2V3P A;  3DQV A;  2M8S A;  2R4E A;  3PRP A;  1KFX L;  1OJL A;  1R7S A;  2BGF A;  1GVN A;  3JYU A;  4HPP A;  3SDL C;  3LMM A;  2JQF R;  2HHH M;  1Z6T A;  3QYE A;  2G9H D;  1NBF C;  1CQD A;  3QWL A;  2L7H A;  2JU6 X;  1J7K A;  4FVM A;  3LB8 C;  1L2N A;  3PO0 A;  2MBE A;  2BTW A;  1P9D U;  2LXA A;  2MWS B;  3MHS A;  4K1R B;  3HHI A;  2JY8 A;  5IWA M;  2MP2 B;  1JWA D;  3AJI B;  2BS3 B;  2QEJ C;  3QT4 A;  1DOX A;  2ZBK B;  3PNR A;  3C0R B;  3IHP A;  1TS3 A;  2KC2 A;  1Y8G A;  1JWU D;  2QQ8 A;  1SIF A;  3P5V A;  3KUC B;  1OAI A;  5G5G A;  1PIP A;  1I4X A;  4BKS A;  2DHR A;  3KW6 A;  1Q39 A;  2K6Q A;  1GL7 A;  4GKK M;  2K6B A;  1E6E B;  3DPD A;  3HWN A;  2JZP A;  4L8R C;  1HZ6 A;  2IO1 B;  1FPY A;  3AE2 B;  3SHF A;  1PPD A;  4GN1 A;  3Q8G A;  1IGC A;  3GLI E;  1G41 A;  3KOW E;  4IM0 A;  5H37 D;  1THE A;  1XB2 B;  3CF6 E;  4BOZ A;  3U60 B;  4LDT B;  4F8C B;  3A33 B;  3PBH A;  3H7P A;  1QVR A;  2MBO A;  3W31 A;  2JX5 A;  1NNU C;  1YZB A;  2J0M A;  3GLF E;  3AE7 B;  2P5T A;  4CJ6 A;  4ZOH C;  3U30 A;  3ZNH B;  2R2O A;  3LDZ E;  2KZS A;  2F5S A;  2L32 A;  3IFU A;  2ZTD A;  3TE6 A;  3PNY A;  3Q3F A;  3KSE A;  3Q8B A;  4I81 A;  3BWU D;  2KTR A;  4II7 A;  2WSC F;  2KMM A;  3B21 A;  1QKZ A;  2CHX A;  2GRI A;  2Y21 A;  3PLU A;  2C5L C;  1T0Q C;  2DJF B;  4YY3 M;  2KN5 A;  3THG A;  3Q8F A;  4BKG A;  1C76 A;  1WZ3 A;  2DKL A;  3PNV A;  1TDH A;  3ZYY X;  3P5W A;  2EKF A;  1JWB D;  1QYR A;  2D7H A;  1YN4 A;  1A70 A;  1X9Y A;  3GLH A;  3L54 A;  1E5W A;  2J4X A;  3M95 A;  1N5X A;  3QAR A;  2O5R A;  2RGH A;  4BKS D;  2DAI A;  1ZDV A;  1DEU A;  4B08 A;  4FK5 A;  4BBN C;  3D6S A;  2LRU A;  4IUM A;  3B79 A;  2CV2 A;  1WSP A;  5C2T B;  4AJW A;  2FH0 A;  4F2L A;  4RNA A;  4DV2 M;  3RZF A;  2VHS A;  2DEN B;  1HNZ M;  2F1G A;  2NCN A;  4DMY A;  1CS8 A;  3R8F A;  3H8H A;  4TUU A;  4CZW A;  2N9L A;  2CB5 A;  1QQW A;  2LVP C;  3OVX A;  1JWM D;  4BFR A;  1J19 A;  1GAB A;  2V9H A;  5E6N A;  5E6J A;  4GH9 A;  4GMQ A;  1N75 A;  3QJZ A;  1D0K A;  4DWF A;  1MIR A;  1KFU L;  2LXC A;  2DLB A;  4RH6 A;  1W5S A;  4K3C A;  3K8Z A;  2F5N A;  2YFQ A;  2OUL A;  2DAM A;  4OZC A;  2R4J A;  3LYY A;  1D3Z A;  3PZ8 A;  3PFI A;  2FE8 A;  2VH1 A;  4FWG A;  2SEB D;  1JB0 F;  3MHS D;  4Q8H A;  4AXM A;  4PP1 A;  3TEZ A;  1UUP A;  4WP2 A;  1ZPS A;  3WAM A;  1T0S C;  2YJC A;  4P1C C;  2YQZ A;  4HRS A;  4GGQ A;  2TSS A;  3O0U A;  3SYK A;  1N33 M;  2RDG A;  2N9K A;  2R62 A;  3TIX A;  1JR3 D;  3QAQ A;  4TUW A;  3H8C A;  2EKI A;  4KV2 A;  3PPA A;  2WSE F;  4REZ A;  2IND C;  2VRR B;  2FAZ A;  2FNA A;  4LLG M;  2WX0 A;  1TKE A;  3DVN U;  2OOB A;  2XEW A;  4AJY B;  1NYR A;  4AXL A;  1AWD A;  3DFZ A;  2BYF A;  2PAD A;  4MSM B;  1NQC A;  1NJF A;  1SE2 A;  4CHK A;  2M1M A;  3JR4 A;  4CIS A;  3ZDM C;  4A90 A;  1QF6 A;  1LM8 B;  2JVC A;  4LGY A;  4UDU C;  1Q10 A;  3VUY A;  1NPZ A;  3QWZ B;  3C9E A;  3V62 A;  1R4M B;  2ZPN A;  2C9W B;  3PRM A;  3PRM B;  2EUC A;  1UBI A;  3M99 A;  4A8X C;  2ZZP B;  4QRG A;  3AOE A;  1C7Y A;  3ONS A;  2DNF A;  4KGS A;  4X57 B;  3CBK A;  3GRY A;  2K47 A;  3T1Y M;  3X23 A;  3UK6 A;  2DC7 A;  2EKK A;  5J2R A;  2K25 A;  3PGE A;  4IBK A;  1HA5 A;  2O6V A;  3U6Q A;  1MU5 A;  1J7C A;  4BBN F;  3RZW C;  4CQN A;  2XZU A;  2BVC A;  4YYU A;  1C1K A;  1XHB A;  1YOV B;  3I4Y A;  2JYE A;  5BO4 B;  1Q5W B;  3K9M A;  3ML9 A;  2KMA A;  1TS4 A;  2KNV A;  2X38 A;  3D32 A;  1TLO A;  4KLN A;  4AG5 A;  5HHD G;  4I6L B;  1FEH A;  3FYD A;  3RNV A;  2XF3 A;  3U5Z A;  2HD5 A;  3BK1 A;  2QDF A;  2VQE M;  1CK1 A;  3IOQ A;  1OEY J;  3VFD A;  5BMI A;  2ZAO A;  4FBJ B;  4AS1 A;  3TJP A;  4BOU A;  1ZUD 2;  2HE7 A;  3PV1 A;  3ZRC A;  2VQF M;  2WU2 B;  1E9S A;  1TKY A;  3VK8 A;  1MX0 A;  2I2Y A;  2NQA A;  4MZS A;  2BDZ A;  3SMS A;  1DKI A;  1STE A;  5EXT A;  1FMA D;  1EFU B;  2KZU A;  1LO5 D;  3NVV A;  4L16 A;  4PS3 A;  3FC4 A;  4LRT A;  2VF7 A;  4C56 C;  3W1S A;  1WGR A;  2N1W A;  3U6D A;  2XEP A;  4EZK A;  4I5S A;  1MHH E;  2Z3X A;  2IPK D;  1SIJ A;  4FXC A;  2M19 A;  3I01 M;  2LBC A;  1I4P A;  4HJG E;  4L2Y A;  3AI8 A;  2DXI A;  3N3G A;  1SGH A;  4X6I A;  3J27 B;  4C80 A;  3N1Z C;  1NV9 A;  2C7H A;  2ON8 A;  3CIR B;  1TGU A;  2LWX A;  1NI3 A;  2CS4 A;  3IBE A;  1QQR A;  1MEM A;  4OW0 A;  1NB3 A;  3C19 A;  2J0J A;  1OQQ A;  3APD A;  3L2A A;  3M63 B;  4MAC A;  1PVJ A;  1SP4 B;  2WXO A;  2PW9 A;  4FCW A;  3HIZ A;  2ONQ A;  4KVG B;  1STF E;  2KTF A;  1Q1O A;  2KT7 A;  4DQO C;  2B3A A;  1NB5 A;  4LGM A;  2K9X A;  1DGJ A;  1PYW D;  1V49 A;  1E9R A;  3AXC A;  3N3K B;  3AE6 B;  4NXM M;  3T8M A;  2E02 A;  2XFT A;  3SU8 X;  2QC8 A;  1CZP A;  1TY0 A;  2D3A A;  2WQY B;  1KOT A;  4B7G A;  3UGJ A;  4QBB A;  1WRD B;  3P4R B;  4K3B A;  4TV3 A;  3RNB C;  3N9Y C;  3B1L X;  3EHV A;  2HCB A;  4WA6 A;  1ZXH A;  1KFV A;  3B2F A;  3AEF B;  5JHA A;  1C4P A;  1TGZ B;  4MEM A;  2KN4 A;  3AV8 A;  3A1Q B;  4X6J A;  3FD9 A;  4W9J A;  4NL4 H;  1Q6K A;  2LWP A;  2WXF A;  1WJU A;  1D6E C;  4NAW A;  2AYO B;  3DBL B;  4FAD A;  1HR0 M;  2VII A;  5A24 A;  3GQ5 A;  1HT1 E;  2VHF A;  5J18 A;  2HH5 A;  4NY0 A;  2YLM A;  3BC3 A;  2MRO B;  3MC9 A;  1VZ6 A;  2LTU A;  1T6O A;  2KQ4 X;  1V33 A;  1WGD A;  3L17 A;  4MEL A;  4RGO S;  4JI5 M;  3I63 C;  3NUH B;  3P1M A;  2BWE A;  3RNE C;  1IBX A;  3Q3N C;  1AU0 A;  4K0K M;  1MI0 A;  2CUZ A;  4XZX A;  1WM2 A;  3JSV B;  4K81 A;  2DYO A;  1IN6 A;  2KEB A;  4M00 A;  4MT5 A;  5IAA C;  2I38 A;  5DNY A;  3IG3 A;  4AKH A;  2RD0 A;  2DC8 A;  3EUB 2;  4KDL B;  3KFQ A;  2KMC A;  3AU4 A;  2DCD A;  1UWM A;  2DC6 A;  3HHX A;  1I4Q A;  2DJG B;  1K52 A;  1RRB A;  4WUR A;  2DI0 A;  4LNN A;  1ROE A;  4ANX A;  4LJ8 A;  1PPP A;  3MHZ A;  3KKU A;  1ET6 A;  2L8J A;  1I4W A;  1YE9 A;  1ET9 A;  1FRR A;  2M60 A;  4R7G A;  2LUE A;  1K3B B;  4XGI A;  4GKJ M;  5EGW A;  1MHX A;  2R46 A;  3A4S C;  5GKN A;  3DWG C;  2XZF A;  1HUC B;  1MHW A;  3ZJU A;  1E10 A;  3ZXV A;  1IXS B;  2JZ1 A;  1WR6 E;  4BAX A;  5F02 A;  1NNJ A;  1P7F A;  2UUA M;  1UF0 A;  4MH8 A;  4AQ7 A;  4BVU C;  4WWP A;  1TH4 A;  1GC7 A;  2IGD A;  1D5M C;  3P4P B;  3B7Z A;  3PS6 A;  5ITT A;  2QMT A;  3GP1 A;  4LNO A;  5DPW A;  2H7J A;  3N4C A;  1JRU A;  4AZF A;  5JH5 C;  2AVW A;  3ZIM A;  4JGH B;  5CX3 A;  1HTQ A;  3KX1 A;  3TMP A;  4JI1 M;  5BMH A;  2MR9 A;  1DF0 A;  2C9O A;  1QLB B;  3IG8 A;  1OIZ A;  2VF8 A;  3P4S B;  4DHZ B;  4MGI E;  4JWS C;  2DZO B;  3NS1 A;  4IKG A;  1AAR A;  2R0I A;  4YYV A;  3HHA A;  3SYL A;  2I1K A;  2A5Y B;  2MRP A;  1U5I A;  4D8E A;  3TWK A;  2KAC A;  2L1A A;  2N35 A;  2DYM A;  3C58 A;  5CVO B;  3F92 A;  2FOI C;  1GC6 A;  2ZCB A;  1U9X A;  1YUB A;  2KX0 A;  2HKJ A;  1KRH A;  2C7N B;  4IG7 B;  3S3Q A;  2C60 A;  2QCU A;  1F4I A;  3GZN B;  3FE3 A;  1GL6 A;  2KW0 A;  3WXG A;  4EE2 A;  3MMP A;  1X1M A;  4HLE A;  5FTM A;  3HK0 A;  3L4P A;  4F1S A;  2QBY B;  3RN9 C;  2C5R A;  1TYG B;  4ICU A;  4K7C A;  4XR7 A;  2KOX A;  4W9C A;  1TR8 A;  4ZRI A;  1GJS A;  1UH6 A;  1L1T A;  3MTN B;  2JY6 B;  2HD5 B;  1EE8 A;  1YSY A;  2DZI A;  1WX7 A;  2YJB A;  1F52 A;  2DWZ B;  2LZ6 A;  4GHA A;  4BB9 A;  2AIM A;  2AYO A;  2LHE A;  2V1C A;  3BYY B;  1V92 A;  1IWD A;  3S2A A;  1YN3 A;  3VUW A;  3EFC A;  1H6U A;  1EWO A;  2PTL A;  5JI2 E;  1WIV A;  2JY5 A;  2CV0 A;  3TRK A;  2XU1 A;  4EOY A;  3C3E A;  1ZGU B;  2QIL A;  3KYC D;  1E94 E;  4G4R A;  1P7E A;  3L10 B;  5KPZ A;  4FIP A;  2LH0 A;  3TUO A;  2FCN A;  4IDI A;  1T3Q A;  5DFL A;  4HVB A;  3RGS A;  1Q02 A;  2BPS A;  2L09 A;  4KGT A;  3VH3 B;  4QOS A;  1KF6 B;  2N1V A;  4NZL B;  1N63 A;  3JR5 A;  4DV7 M;  2UXB M;  3SR6 A;  1PGB A;  4NPN A;  1DOY A;  2WYQ A;  4RCO A;  1Z2M A;  2LI5 A;  4LNF A;  3CWI A;  1AIM A;  4TQ1 A;  3QJ3 A;  3LQR A;  2WNM A;  1FNW A;  1HT2 E;  1UD7 A;  3SFD B;  3PXG A;  1L2D A;  4M8N A;  4QH6 A;  2XN9 C;  3WXF A;  3DBR I;  3Q3M C;  1WMH A;  1TT5 B;  1QXP A;  4PAD A;  1SB3 C;  4G50 A;  3NVY A;  5A2Q S;  4XZ4 A;  3AUL A;  1Z5C A;  2GMI C;  3C9P A;  1UZX B;  1CJL A;  4YYS A;  3GLH E;  5J94 A;  3U61 B;  4IOI E;  3RD2 A;  3RVW A;  2QSD A;  3GPU A;  4I05 A;  1N32 M;  3CST A;  1R7R A;  1WXA A;  4NAW B;  5K16 A;  2MBH A;  4KLB A;  1ICF A;  2IBI A;  1RYJ A;  4YWG G;  2LVO C;  2O6V D;  4XX5 A;  2KYW A;  1VSN A;  4IUM B;  1GOZ A;  1SXJ A;  2WXK A;  4BS5 A;  2WXM A;  2ZJD A;  3SEB A;  2O2V B;  2WP9 B;  3HY5 A;  1TKG A;  3ENE A;  1EWM A;  3W2D A;  4B6W A;  3Q8X A;  1I35 A;  1BML C;  3R9X B;  1KJT A;  3PLV A;  2J7Q A;  2R9M A;  4FWH A;  3SAU A;  3DHI C;  1VDD A;  1YQ4 B;  2ZEQ A;  3GLI A;  2IO0 B;  4B7H A;  3SAS A;  2K8B A;  1FNN A;  1J09 A;  1AIP C;  5DYI A;  5E6O A;  4HCP B;  2ACT A;  1XLN A;  5EE1 A;  3IEJ A;  2KZR A;  3OJ4 B;  3ILK A;  3QIJ A;  1EIJ A;  4HWI B;  2WXL A;  4W9L A;  4LCD E;  5JZE B;  5EXX A;  2J7N A;  3Q6B A;  4W9G A;  2QJL A;  3KSX A;  2FRA A;  2R61 A;  2MQJ A;  4OVZ A;  2Y5B A;  3M7G A;  4MJS B;  3KVF B;  1EWY C;  4M02 A;  1E8W A;  3UIO B;  1NLJ A;  1WZ0 A;  3LQQ A;  4GDK B;  5FSW A;  4PCZ A;  1M94 A;  1V1P A;  3EIH A;  2WU5 B;  1NHG C;  2ZCC A;  5TSS A;  1CB5 A;  2KVR A;  1ENF A;  3QX1 A;  1YJI A;  1MJG M;  3L27 A;  3IV2 A;  1FFU A;  3HD3 A;  1N62 A;  1QAM A;  3J80 S;  4JYA M;  2Z4S A;  3IMA A;  1YQ3 B;  2DCC A;  1F2R C;  5EF4 A;  2CE7 A; 
#chains in the Genus database with same CATH homology
 2WXJ A;  4KKI A;  1G4A E;  2L83 A;  2Z4R A;  4KGR A;  3KP1 E;  1GAQ B;  2ZW1 A;  3LVW A;  2LXE A;  5E26 A;  4M9S A;  3LXF A;  4M9X A;  1VR9 A;  4N58 A;  4LFB M;  3DA1 A;  4LJ5 A;  4LJ7 A;  1XMQ M;  4L78 A;  3AMZ A;  1MPE A;  1BXT A;  1D5Z C;  4QNM A;  1PJI A;  1UGJ A;  1AN8 A;  1FM0 D;  4G6Z A;  4IJE A;  3A45 A;  3FTD A;  5ITX A;  4X64 M;  3U6P A;  4X62 M;  1IBX B;  1NY6 A;  3H4M A;  2JSV X;  5KPR A;  2NMQ A;  4MGZ E;  3AN1 A;  2INN E;  3ZGZ A;  2UXC M;  1FCC C;  1J7B A;  2MEK A;  1PDX A;  3HHY A;  3T3O A;  1QZM A;  5BYS A;  3ABV B;  2DBY A;  2BW2 A;  3ZNH A;  4NXN M;  1JWS D;  1T6B X;  4A55 A;  4CHT B;  3U52 E;  1CJE A;  3O65 A;  1IM2 A;  1GLN A;  2JRI A;  4XBO A;  1AYF A;  1HQR D;  4JX1 C;  2DZN B;  2B76 B;  4MGY E;  4GLS C;  2EEL A;  4PDI A;  4OVZ B;  2RPV A;  4O1N A;  2L7I A;  1NJG A;  4XDD A;  2FBW B;  5BYR A;  2J7O A;  3MP2 A;  4WQM A;  2DOS A;  3MK6 A;  2BT6 A;  1ZE3 D;  4JI8 M;  3FTE A;  4QHS A;  2X49 A;  4H2A A;  2CJO A;  3BVG A;  3HRD D;  3OWE B;  1IN4 A;  4LF9 M;  4Q2J A;  4W5W A;  3PSE A;  3P4Q B;  2DWM A;  3BB7 A;  2AQ3 B;  1VZ7 A;  1Q3B A;  3NVZ A;  5KQ8 A;  2UU9 M;  4GHL A;  3VKH A;  2ZW0 A;  2UZJ A;  1SF0 A;  4KOD A;  1KTK A;  4DXF A;  2BTE A;  1N77 A;  5LMN M;  1QT9 A;  2W82 A;  4X65 M;  3U6M A;  2DVW B;  2G8L A;  3Q8C A;  2K0P A;  3SHG B;  1T3T A;  4QOZ C;  5KO3 A;  1FD6 A;  1I4H A;  4DV0 M;  2UXD M;  4G4N A;  2Y0Q A;  2Y20 A;  3HJS A;  4IBE A;  5I4D A;  2BJW A;  2E5L M;  1RFK A;  1UWX A;  2R18 A;  3TWM A;  4Z6Y A;  1VLB A;  4FCV A;  4B0E A;  4ARI A;  4R3D A;  2RGO A;  4RF1 A;  2BTW B;  3FUW A;  1PFD A;  2LFI A;  3W5U B;  2M56 B;  1GKI A;  2NTT A;  1NEN B;  1ZDX A;  2AQ2 B;  2CV1 A;  1HZ5 A;  4JV5 M;  5HFY A;  3TEW A;  2KRK A;  4D81 A;  5G5H A;  3NZ3 A;  4DV6 M;  3SAV A;  1UKF A;  4OX9 M;  4L1B A;  3KOX E;  3U5Z B;  3AFH A;  1Z5A A;  4M0W A;  3TL4 X;  3HWS A;  1C4A A;  1FNU A;  4C7Z A;  2W54 A;  4BLC A;  3GLG B;  4HEA 1;  3U6C A;  1EU4 A;  3HKP A;  2E6X A;  5BYQ A;  3FUT A;  5D3I B;  1DO2 A;  1EU3 A;  3ETR A;  2N0S B;  4LF7 M;  2Z7J A;  2G1E A;  4JPS A;  2BU3 A;  4BOQ A;  2LUM A;  5F3W A;  1JRO A;  4P6V F;  4JWU C;  3AE8 B;  5BMG A;  1I7H A;  3FKE A;  1PUT A;  1OFI A;  2I7N A;  1IN5 A;  1QOA A;  3DWM A;  1L4Z B;  3TPZ A;  2M5Z A;  4LF5 M;  4DR7 M;  4YTM B;  3JAM S;  1NEK B;  1E32 A;  2CE7 A;  2OQ4 A;  5IZ7 D;  3AKZ A;  2XSZ A;  1NY5 A;  3KLS X;  4HKQ A;  3C8Y A;  4ITQ A;  2L52 A;  3AEA B;  1PGX A;  4PD2 A;  3U6E A;  1R6B X;  5C18 A;  2RDH A;  3M6A A;  2EO2 A;  3VKG A;  2BYT A;  3GQ4 A;  1SXJ B;  2C9C A;  3AL0 C;  3R2I A;  4PDG A;  2LNH C;  3UJN A;  4IJF A;  1HQC A;  2HDE A;  2MH7 A;  4IBD A;  3AED B;  2OED A;  2V1U A;  4JN6 A;  1SSN A;  4US8 A;  5H8Y E;  4I8O A;  2WS3 B;  1DGF A;  1FJG M;  3TEX A;  1XCT L;  3AE9 B;  1IBK M;  4LFC M;  3FUU A;  1TJE A;  1C78 A;  1IN8 A;  2K3U A;  4NAM A;  3V3X A;  4DR6 M;  1SE4 A;  1WGK A;  3P63 A;  1L0V B;  2Z84 A;  4RGN A;  3RE8 A;  1IXZ A;  2V0G A;  2WXP A;  4NOO B;  1K50 A;  3AV0 A;  2R65 A;  1ESF A;  2J53 A;  2VZK D;  3J7B A;  4ARC A;  2Y5P A;  5IRE B;  3VDP A;  3I57 A;  1XEE A;  3GLH B;  2KA6 B;  1V97 A;  2XGN A;  1L2B A;  3W0L B;  1SE3 A;  1YNT E;  5FTK A;  3I4V A;  3VRA B;  1SXJ D;  4NJC A;  3ZCB B;  5EXP A;  1QOG A;  2WLB A;  3J2P B;  3SAT A;  2KRU A;  2C99 A;  1K3X A;  1KSF X;  4FCT A;  2ACZ B;  4RF0 A;  3KS8 A;  4B3M M;  2LGI A;  5FLX S;  3FIL A;  1I4G A;  1IXR C;  4X66 M;  4BOS A;  4ZYS A;  3A98 B;  2CEA A;  1OFH A;  4NSR A;  1OQR A;  1KYI A;  1I4R A;  1TS5 A;  1WXQ A;  3GRV A;  4LJ4 A;  4LG2 A;  2VZK B;  4IBC A;  2PMV A;  4DV4 M;  2LMC A;  1JR3 A;  2MJD A;  3DOA A;  4EIW A;  1V8C A;  1IGD A;  2G5G X;  3VDU A;  3GPY A;  2IJ0 A;  3L28 A;  4HL4 A;  2K22 A;  3AM9 A;  4A6Q A;  1SXJ E;  3A42 A;  4D2K A;  3Q69 A;  4CGY B;  1JAL A;  1TH3 A;  3SC3 A;  2YEP B;  1FNV A;  2CFO A;  3GQ3 A;  4WW0 A;  3NRZ A;  3K1J A;  4LJ6 A;  1JW9 D;  2RMM A;  3ZJT A;  3MTV A;  3AH7 A;  3VLF B;  3WCQ A;  3EA6 A;  4D82 A;  2ZAN A;  1OFF A;  1JQJ C;  3HUI A;  2ZM6 M;  2UUC M;  1C79 A;  3QAU A;  1G59 A;  1XMO M;  5EZQ A;  4YT0 B;  4G4O A;  5JXV A;  3GPX A;  3AE1 B;  3PZ7 A;  2WXH A;  3HHW A;  4GRI A;  1QAO A;  4US9 A;  4DV1 M;  1XLP A;  3J9C A;  3W5V B;  3TWL A;  4LFA M;  1I94 M;  1XC8 A;  4NSO B;  1XO3 A;  1T5X D;  3AE5 B;  4XWT A;  4B3T M;  2HWK A;  4GC9 A;  3LVV A;  3SMP A;  2F5O A;  3MJ5 A;  1G3I A;  5FTL A;  3E9S A;  3U60 A;  2W3R A;  4TQ0 A;  1WYG A;  1XXG A;  2YNM D;  1C77 A;  1M4V A;  4IP3 A;  1WWT A;  3MHV C;  5KQD A;  3O13 A;  4P16 A;  1GB4 A;  3CF0 A;  3U6S A;  3K92 A;  1D2N A;  1SXT A;  1XLQ A;  2KWD A;  2HL7 A;  3ZH9 B;  4A5U A;  2E3T A;  3B9J A;  4OZA A;  2W55 A;  1L2C A;  1ZP0 B;  1SJE D;  3T1H M;  1IQP A;  1IBM M;  2L6O A;  2KDM A;  1YJJ A;  4GIP A;  3KWL A;  3GLF A;  1EWC A;  4LF6 M;  2C96 A;  1KFY B;  2F5P A;  1VJK A;  5EP4 A;  3U7Z A;  2SAK A;  5LMU M;  1YN5 A;  4A3V B;  1IBL M;  1XLO A;  1HNW M;  4NRW A;  1TS2 A;  1HXY D;  3IAM 1;  1DO0 A;  1B9R A;  1R2Y A;  4TSS A;  1L6U A;  4DV5 M;  2RKO A;  4YSX B;  2Y0T A;  3T3N A;  2PLP A;  4YXD B;  1XCQ L;  4MB7 A;  4GC5 A;  2YEP F;  1DGH B;  3FTF A;  2X8A A;  3AB5 A;  3AEB B;  1ZOY B;  3MFG A;  4RFB A;  3TEY A;  2WDQ B;  3L26 A;  2Y5C A;  2H89 B;  4XDC A;  2R45 A;  2F5Q A;  7CAT A;  4FWD A;  2I7P A;  5HG2 A;  1N5W A;  5T8I A;  5FTJ A;  5EQT A;  1Y56 A;  1F2R I;  2PVO D;  3IAS 1;  1L5P A;  3KQ4 A;  3L29 A;  4JI2 M;  3ZQ4 A;  3M0E A;  2X4A A;  3UZU A;  2J42 A;  1HQY E;  4LF4 M;  5AUK A;  2CU3 A;  4MH0 E;  4USA A;  4ZTB A;  3AE4 B;  2W3S A;  4N6E B;  3A46 A;  3AOE C;  3VR9 B;  3P42 A;  1NHW C;  1JQ4 A;  2XSZ D;  3ZC7 B;  4I4L A;  4LRS A;  2CHV A;  3TQS A;  5MPO A;  2HTM E;  4MGH A;  1E9M A;  3NBI A;  3GLG A;  2CJN A;  5AUI A;  3V05 A;  3KXE C;  3PHW A;  3HU3 A;  5EP2 A;  3GLI B;  4JI0 M;  1FXI A;  2JTC A;  1JCK B;  1BUI C;  3U2S C;  1XXH A;  2GI9 A;  2OPF A;  4AKI A;  4MM3 B;  2ERC A;  1IY1 A;  2EA0 A;  1SJH D;  5EXS A;  2N7J A;  2WXG A;  3C0R A;  1TY2 A;  3KVW A;  5BPV A;  1TH2 A;  1IY0 A;  4LJA A;  4B3S M;  2DWL A;  2DWQ A;  3HVZ A;  2XLJ A;  4XE0 A;  3I9V 1;  3IG5 A;  2Z8L A;  2K5P A;  4LZJ A;  1UM8 A;  5ITR A;  2FFJ A;  4JE3 B;  4GUA A;  2IDY A;  1QOF A;  3UMM A;  3AEE B;  4N59 A;  4BOP A;  2QP9 X;  4JI3 M;  1RM6 C;  2Q5W D;  4IBJ A;  5EP1 A;  4JI6 M;  3U6L A;  4QNR A;  1JRP A;  4HRO A;  5JZE A;  1DOI A;  4DXG A;  3BOS A;  2AHM A;  3KWV A;  3BK2 A;  2D7G A;  1NSF A;  1L0X B;  3Q8E A;  3PHU A;  5ITX E;  1Z59 A;  1IN7 A;  2QZ4 A;  3W9C B;  3NVW A;  1FRD A;  1L6V A;  1ZXI A;  4LCB A;  3VR8 B;  1FFV A;  5H92 C;  3BY4 A;  2QEN A;  2M0A A;  4RGM A;  1LV7 A;  2H88 B;  3SBJ A;  3BYT B;  3FYC A;  2BB5 A;  2PIA A;  2KXE A;  3BVZ A;  2LJI A;  5GXG B;  3R8B A;  2UUB M;  2BBC A;  4Z8X A;  4JI7 M;  3VRB B;  3FUX A;  3EGR A;  4DR4 M;  3HJQ A;  4ITK A;  1AW7 A;  4BBA A;  2AX5 A;  1RWS A;  2KAJ A;  1Z5B A;  3ZJV A;  5EE0 A;  3URY A;  5HI1 A;  3J7A S;  4YTP B;  4AQY M;  1CQV A;  1L4D B;  2PKO A;  1E0Z A;  3L25 A;  3MC0 B;  5C3J B;  5FKA C;  5C1B A;  2BB6 A;  3BII D;  1D4B A;  2XNA C;  1NVI D;  4C7Y A;  1VRA B;  5ITQ A;  4HXD B;  4AW4 A;  4AKG A;  2DWN A;  2QPA A;  3D8B A;  3GRR A;  1XNQ M;  2BS2 B;  4FW9 A;  3BVM A;  4DR5 M;  3FUV A;  2C98 A;  1V1O A;  3T15 A;  3T38 A;  4ZRP A;  2JYT A;  1L1Z A;  4QHT A;  3R2T A;  1GPX A;  3UI3 A;  1L8Q A;  3BZD B;  5ITY A;  4PT5 A;  4IBI A;  3Q8A A;  3PT2 A;  5D7G A;  4G4Q A;  1IUE A;  4LJ9 A;  4DUY M;  1QIL A;  4FD2 A;  2Y3A A;  2XFS A;  2LEK A;  2ICI A;  1KLG D;  1DGH A;  2GB1 A;  5DYG A;  2QIE B;  4J3O D;  2ZAM A;  2JXT A;  2D7E A;  1TDZ A;  2JQR B;  1TZO A;  3FIL B;  1L0Y B;  3W30 A;  3GPP A;  1X37 A;  4LK0 M;  5ITU A;  3VQI A;  2H1R A;  2V6Z M;  1PJJ A;  3W0F A;  3PVS A;  1F0Z A;  2NQ8 C;  3HU2 A;  1D5X C;  4L4U A;  1VDV A;  3IT6 B;  1YMH E;  1N61 A;  1PGA A;  3B9P A;  2MJ3 A;  1F77 A;  1DGG A;  3WHL A;  4LZZ A;  3CTW B;  4WWM A;  2F4V M;  2WXI A;  4D8I A;  4MI7 A;  1SXJ C;  3TSS A;  1EM7 A;  2BJV A;  2J7Q C;  3IT4 B;  4DV3 M;  1KH0 A;  1FIQ A;  5KPT A;  2WDR B;  2V4I B;  1C4C A;  2IGH A;  2PVG C;  3AE3 B;  1K82 A;  3HU1 A;  1R2Z A;  4WH4 A;  1J7A A;  2CHQ A;  4LTU A;  1SBB B;  4RGT A;  5D3D A;  2CHG A;  3HVD A;  5IT9 S;  3KSJ A;  1FCL A;  1S3S A;  3U6O A;  1SEB D;  1VZ8 A;  1ORY B;  1NVM A;  3KOY E;  3GP7 A;  4B0M A;  3BBA A;  4WAF A;  4B3R M;  3FAH A;  2IGG A;  1DYQ A;  5LNK 1;  3VK7 A;  2JA2 A;  1JML A;  3DZD A;  3B2G A;  1K3W A;  1XF5 L;  3GLF B;  1Q3C A;  4ZRQ A;  3GS2 A;  1HEZ E;  4NRV A;  2WXR A;  4S12 A;  1XNR M;  1MVK A;  1NYQ A;  4KKJ A;  4YSZ B;  2LHD A;  4YTN B;  2J52 A;  2AQ1 B;  1K51 A;  2V3N A;  3KP0 E;  3PHX A;  4GDL B;  1N78 A;  2QBY A;  1N60 A;  3U61 A;  1WRI A;  3KOZ E;  1GB1 A;  2YR0 A;  1FXA A;  3D8L A;  2JWU A;  3IXS A;  4OU7 A;  3RFW A;  2OHF A;  1J5E M;  3WHK A;  4LF8 M;  4DR2 M;  5EZS A;  5BR8 M;  4GIT A;  2AGA A;  3OTO M;  3J81 S;  3SAR A;  3KS4 A;  1W5T A;  3CF2 A;  1G8P A;  4IBB A;  2WDV B;  3GO8 A;  4WIP A;  4OZB A;  4M9Z A;  1IY2 A;  4ZHP A;  3GB1 A;  3OQC A;  4ZPX A;  2NTS A;  3E4R A;  4D80 A;  2BS4 B;  4HLQ A;  3I51 A;  3AEG B;  4XWW A;  4A9A A;  4RKX A;  4HKZ E;  4L23 A;  4DUZ M;  2Q2E B;  3RGP A;  4KO8 A;  5FK9 C;  5EE3 A;  3AEC B;  1QAN A;  4LY6 A;  1DGB A;  1QOB A;  4D8B A;  3RFZ B;  4MGK E;  2WXN A;  4IIW A;  3MP9 A;  3U4E G;  4AG6 A;  1KLU D;  4DR3 M;  2D5G A;  1UNS A;  1N34 M;  1XWI A;  5JI3 E;  3HJ8 A;  1E7P B;  4OHJ A;  1ACC A;  1K53 A;  4TMA B;  3SFE B;  3SAW A;  1XXH B;  5FR3 A;  1ZQ9 A;  1B1Z A;  4KX6 B;  4B7F A;  3NWL A;  4YSY B;  3FTC A;  3E56 A;  5FTN A;  1QAQ A;  3AOG A;  4AI6 A;  1PM5 A;  3EIE A;  3HGI A;  3KFU G;  2WXQ A;  4KHP M;  1FO4 A;  4JXJ A;  3K2L A;  3RPF C;  4IBF A;  3SFZ A;  3GRU A;  2MJE A;  2FUG 1;  3KDS E;  4YHH M;  1ZAE A;  1HNX M;  5EP3 A;  2BNK A;  5EJC A;  4ZHO A;  8CAT A;  1V1P B;  4L15 A;  4M0D A;  4DR1 M;  4JI4 M;  2XH9 A;  4IBG A;  1C9F A;  1N36 M;  3HHZ A;  5EE9 A;  2V3P A;  2R4E A;  3PRP A;  1OJL A;  1R7S A;  1GVN A;  3LMM A;  2HHH M;  1Z6T A;  2G9H D;  3QWL A;  2L7H A;  2JU6 X;  1J7K A;  4FVM A;  3LB8 C;  2BTW A;  3PO0 A;  5IWA M;  1JWA D;  3AJI B;  2BS3 B;  2QEJ C;  1DOX A;  2ZBK B;  1TS3 A;  1JWU D;  5G5G A;  1I4X A;  2DHR A;  3KW6 A;  1Q39 A;  1GL7 A;  4GKK M;  1E6E B;  2JZP A;  4L8R C;  1HZ6 A;  3AE2 B;  3SHF A;  1IGC A;  1G41 A;  3KOW E;  5H37 D;  3CF6 E;  4BOZ A;  3U60 B;  1QVR A;  3W31 A;  2JX5 A;  1NNU C;  1YZB A;  3AE7 B;  2P5T A;  4ZOH C;  2KZS A;  2F5S A;  2L32 A;  3IFU A;  3TE6 A;  3PNY A;  3Q8B A;  4I81 A;  3BWU D;  4II7 A;  2KMM A;  3B21 A;  1QKZ A;  2GRI A;  2Y21 A;  4YY3 M;  3Q8F A;  3THG A;  1C76 A;  3PNV A;  1TDH A;  3ZYY X;  1JWB D;  1QYR A;  2D7H A;  1YN4 A;  1A70 A;  3GLH A;  2J4X A;  1N5X A;  2O5R A;  2RGH A;  1ZDV A;  4B08 A;  4IUM A;  2CV2 A;  1WSP A;  5C2T B;  4DV2 M;  4RNA A;  1HNZ M;  3R8F A;  3H8H A;  2N9L A;  1QQW A;  1JWM D;  5E6J A;  4GH9 A;  4GMQ A;  1N75 A;  2DLB A;  4RH6 A;  1W5S A;  3K8Z A;  2F5N A;  2YFQ A;  4OZC A;  2R4J A;  3LYY A;  3PZ8 A;  3PFI A;  2FE8 A;  4FWG A;  2SEB D;  3TEZ A;  1UUP A;  1ZPS A;  2YQZ A;  4HRS A;  2TSS A;  3SYK A;  1N33 M;  2RDG A;  2N9K A;  2R62 A;  1JR3 D;  4TUW A;  2EKI A;  4REZ A;  2FNA A;  4LLG M;  1TKE A;  1NYR A;  1AWD A;  3DFZ A;  1NJF A;  1SE2 A;  3JR4 A;  4CIS A;  4A90 A;  1QF6 A;  4UDU C;  4LGY A;  1Q10 A;  3PRM A;  2EUC A;  4A8X C;  3AOE A;  4KGS A;  3GRY A;  2K47 A;  3T1Y M;  3UK6 A;  4IBK A;  1HA5 A;  3U6Q A;  1MU5 A;  1J7C A;  4CQN A;  2XZU A;  1C1K A;  1XHB A;  3I4Y A;  2JYE A;  1TS4 A;  2X38 A;  4KLN A;  4AG5 A;  5HHD G;  1FEH A;  3FYD A;  3RNV A;  2XF3 A;  3U5Z A;  3BK1 A;  2VQE M;  1CK1 A;  3VFD A;  5BMI A;  2ZAO A;  4AS1 A;  4BOU A;  1ZUD 2;  2VQF M;  2WU2 B;  1E9S A;  1TKY A;  3VK8 A;  1MX0 A;  2I2Y A;  3SMS A;  1DKI A;  1STE A;  5EXT A;  1FMA D;  2KZU A;  1LO5 D;  3NVV A;  4L16 A;  3FC4 A;  4LRT A;  4C56 C;  3W1S A;  3U6D A;  2XEP A;  4I5S A;  1MHH E;  2Z3X A;  2IPK D;  4FXC A;  1SIJ A;  2M19 A;  4HJG E;  4L2Y A;  1I4P A;  2DXI A;  3J27 B;  4C80 A;  2ON8 A;  3CIR B;  1TGU A;  2LWX A;  1NI3 A;  1QQR A;  4OW0 A;  1OQQ A;  3L2A A;  4MAC A;  1PVJ A;  2WXO A;  2PW9 A;  4FCW A;  2ONQ A;  4DQO C;  4LGM A;  2K9X A;  1DGJ A;  1PYW D;  1E9R A;  3AE6 B;  4NXM M;  2XFT A;  1CZP A;  1TY0 A;  2WQY B;  4B7G A;  3UGJ A;  3P4R B;  3N9Y C;  2HCB A;  1ZXH A;  1KFV A;  3B2F A;  3AEF B;  1C4P A;  2KN4 A;  3AV8 A;  3FD9 A;  4NL4 H;  2WXF A;  1D6E C;  1HR0 M;  2VII A;  3GQ5 A;  1HT1 E;  1VZ6 A;  2KQ4 X;  4RGO S;  4JI5 M;  3NUH B;  3P1M A;  1IBX A;  4K0K M;  1MI0 A;  2CUZ A;  4XZX A;  2DYO A;  1IN6 A;  2KEB A;  4MT5 A;  2I38 A;  5DNY A;  4AKH A;  3EUB 2;  1UWM A;  3HHX A;  1I4Q A;  1K52 A;  4WUR A;  1ROE A;  4LJ8 A;  3MHZ A;  1ET6 A;  1I4W A;  1YE9 A;  1ET9 A;  1FRR A;  2M60 A;  4R7G A;  4XGI A;  4GKJ M;  1MHX A;  2R46 A;  5GKN A;  3DWG C;  2XZF A;  3ZJU A;  1E10 A;  1IXS B;  1NNJ A;  1P7F A;  2UUA M;  4MH8 A;  4AQ7 A;  1TH4 A;  2IGD A;  1D5M C;  3P4P B;  5ITT A;  2QMT A;  3GP1 A;  4AZF A;  3TMP A;  4JI1 M;  5BMH A;  2C9O A;  1QLB B;  3IG8 A;  3P4S B;  4MGI E;  4JWS C;  2DZO B;  3NS1 A;  4IKG A;  3SYL A;  2A5Y B;  4D8E A;  3TWK A;  2KAC A;  2L1A A;  2DYM A;  3C58 A;  2FOI C;  1YUB A;  2HKJ A;  1KRH A;  2QCU A;  1GL6 A;  2KW0 A;  4EE2 A;  5FTM A;  3L4P A;  2QBY B;  2C5R A;  1TYG B;  1L1T A;  1EE8 A;  1YSY A;  2DWZ B;  4GHA A;  4BB9 A;  2LHE A;  2V1C A;  3BYY B;  1YN3 A;  1H6U A;  2PTL A;  5JI2 E;  2CV0 A;  3TRK A;  2QIL A;  1E94 E;  4G4R A;  1P7E A;  5KPZ A;  2LH0 A;  3TUO A;  4IDI A;  1T3Q A;  3RGS A;  2L09 A;  4KGT A;  4QOS A;  1KF6 B;  4NZL B;  1N63 A;  3JR5 A;  4DV7 M;  2UXB M;  3SR6 A;  1PGB A;  1DOY A;  4RCO A;  3CWI A;  4TQ1 A;  3LQR A;  2WNM A;  1FNW A;  1HT2 E;  3SFD B;  3PXG A;  1L2D A;  2XN9 C;  1SB3 C;  3NVY A;  5A2Q S;  1Z5C A;  3U61 B;  4IOI E;  2QSD A;  3GPU A;  1N32 M;  1R7R A;  4NAW B;  1RYJ A;  4YWG G;  1GOZ A;  1SXJ A;  2WXK A;  2WXM A;  3SEB A;  2WP9 B;  1TKG A;  3W2D A;  3Q8X A;  1BML C;  3R9X B;  2J7Q A;  4FWH A;  3SAU A;  1VDD A;  1YQ4 B;  3GLI A;  4B7H A;  3SAS A;  1FNN A;  1J09 A;  5DYI A;  1XLN A;  5EE1 A;  3ILK A;  2WXL A;  5EXX A;  2J7N A;  2QJL A;  3KSX A;  2R61 A;  4OVZ A;  3M7G A;  1EWY C;  3LQQ A;  4GDK B;  5FSW A;  4PCZ A;  1V1P A;  2WU5 B;  3EIH A;  5TSS A;  1NHG C;  1ENF A;  1YJI A;  3L27 A;  1FFU A;  1QAM A;  4JYA M;  3J80 S;  1N62 A;  2Z4S A;  1YQ3 B;  1F2R C;  2INP E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...