4REZA

Crystal structure of the middle-east respiratory syndrome coronavirus papain-like protease
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
320
structure length
311
Chain Sequence
TIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTAPDFVAFNVFQGGHYVHARLKLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSDCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords ORF1ab protein
publication title Crystal Structure of the Middle East Respiratory Syndrome Coronavirus (MERS-CoV) Papain-like Protease Bound to Ubiquitin Facilitates Targeted Disruption of Deubiquitinating Activity to Demonstrate Its Role in Innate Immune Suppression.
pubmed doi rcsb
source organism Human betacoronavirus 2c jordan-n3/2012
total genus 79
structure length 311
sequence length 320
ec nomenclature
pdb deposition date 2014-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4rezA02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rezA01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4rezA03
5KO3A 4R3DA 4RNAA 4M0WA 2FE8A 3E9SA 5E6JA 4RF1A 3MP2A 4RF0A 4MM3B 4REZA 3MJ5A 4P16A 4OW0A 4OVZA 4PT5A 4OVZB 4WURA
chains in the Genus database with same CATH superfamily
1VLBA 1CQVA 1IN6A 1KJTA 5LMNM 3LXFA 3GLIA 2KJ6A 5BYQA 2PPHA 1MIRA 1DF0A 5BMHA 4NRVA 3SYLA 3W68A 1D2NA 4ZOHC 3V61A 4ITQA 4W9FA 2KMCA 2AQ3B 1EU3A 4NY0A 3A9KA 1VDDA 2PJHA 1VRAB 2WDRB 3H1UA 1V1OA 3BC3A 4FJYA 3NRZA 2EA0A 3SARA 4Y28F 4URKA 2DZLA 4XDCA 1RRBA 2W82A 4II7A 3K8ZA 1KHPA 1SXJD 5FTMA 2KNVA 4ZRQA 3SHGB 4NSRA 3GP1A 3EGRA 3RZWC 4CQNA 3FD9A 2R46A 1CMXB 1UBQA 1AU2A 3LQRA 5EQTA 4AI6A 2Y0QA 1IXSA 3PDFA 3J9CA 3RNBC 3U4EG 2EO2A 2XU4A 2KWVB 3SU8X 1JROA 2IY1B 1Z2MA 1NNJA 4C4VA 5EE9A 3ML9A 3B21A 3BVZA 2HJ8A 1E32A 2JWZA 3GLGB 5AUIA 1GABA 4KZCA 2JY8A 3PO0A 1P3QQ 2GBJA 2KD0A 4X6HA 4LFCM 1DOXA 1WMHA 1GJZA 2KZSA 2L0TA 1TH2A 1IN5A 4EE2A 5EF4A 4NNJB 1WX8A 3VKHA 1PCIA 3AOEC 4IJFA 2MW5A 4D8BA 3T1YM 3D6SA 2DVWB 2G3QA 1XXHB 3KOZE 1RFKA 5EGWA 4BAXA 1IBMM 1PJIA 3KX1A 1Q1OA 2UXCM 2FRQA 1AIPC 1F77A 2RD0A 4X64M 2KHHA 1AYUA 1BXTA 3ZRFA 4CIZA 2G9HD 3CF6E 3ZVVA 4KIKB 3BVGA 4X65M 4DR6M 3PHWA 1AIMA 1T0RC 5GMVA 3I4VA 2VDBB 2LVQD 1L2NA 4M00A 4I6LB 2YLMA 2FUDA 1QOFA 2MROB 4DXGA 3M63B 2O6XA 2NPTB 2KQSA 3DWMA 1PGYA 3HWSA 4HK2A 4OW0A 1DGJA 2M1MA 2Y5BA 2B1MA 2IPKD 1GNUA 2LASA 3KYDD 4QRXA 5C1BA 4IIWA 1ICFA 2L4EA 1WJUA 3HZJA 3PSEB 2R0IA 1SE4A 1UD7A 3U2SC 2ZBKB 2K1FA 3AOGA 3OJ3A 1MI0A 3Q3MC 4L2YA 1TJEA 1AU0A 3IFWB 3BPMA 3KOWE 3RGSA 1PPPA 1XCQL 2KTRB 1VJVA 2EMSA 2KWCA 2KXJA 3IBEA 2KLGA 4LJ5A 2K0BX 5JXVA 3T8MA 2B1NA 5CHVA 2I7PA 2JU6X 4P1CC 3BYTB 4PS8A 1PYWD 3RNFC 5G5GA 4OELA 4II3B 4XYCA 5FPWA 2MGWA 4GOCA 2X8AA 1NVID 3FILA 1I42A 1E9RA 3U6PA 2JYTA 2EKEC 4EZJA 2Y3AA 2PE6B 3QK0A 4DHZE 1NQCA 3AULA 1YVBA 3EC8A 4OU7A 1WE7A 2J52A 4NAWA 4DR2M 4BBNF 4IUMA 3GLFB 4D8EA 4MELA 2A5UA 4AXLA 3AEAB 4CHTB 3NG0A 2YJBA 2Z84A 3N3KA 1IM2A 3FTCA 2KHWB 3H8HA 3N20C 2DNAA 2AU1A 3GPYA 2ZJDA 1XMQM 2O2VA 4N9F4 1R2YA 3W5UB 1TBEA 2K6DB 3P4RB 1QAOA 1E7PB 4EZLA 2CV0A 1TDZA 5D2MB 4X66M 2RRUA 1XLQA 1HQYE 2RMMA 3IG3A 1G3IA 3Q3OC 5BPVA 5CHVC 3SEBA 3W1SA 2C9WB 2LI5A 1C77A 4HPPA 4BKGA 4DV7M 3VH4B 4MDKE 3GLHE 3AMZA 2IBIA 3JYUA 2FRAA 4KHPM 2ZPYA 3KYCD 4LGMA 1Y8RC 1NDDA 2K39A 2L05A 1G6JA 1PXVA 2PREA 4FCWA 1V5OA 2JX5A 3MTNA 1CPJA 5IN7A 1TH3A 4FCVA 1L2DA 2OO9A 5FTLA 2DAMA 4ZRIA 2DZMA 1I35A 4YYWA 4AKHA 2E6XA 4BOUA 3GLHA 3VQIA 5J2RA 1TLOA 2ZANA 3PRZA 4X6JA 2L7HA 2FS1A 2DZOB 2E00A 3ZTCA 2MBOA 4DR4M 4MJSB 4YSZB 4DDGD 2DOSA 4I07A 1S3SG 2O6VA 3OTOM 4D2KA 3QAUA 3W2DA 3U8ZA 3B2FA 4EKUA 2ZZPB 1XF5L 1A5TA 2VQEM 3SMSA 1Q02A 1PPOA 4RY2A 3PNVA 2MP2A 3HKPA 4ICUA 3H8BA 3UF8A 3I4YA 2VQFM 3NVVA 2ARYA 1Y4HA 2NQDB 2OULA 2JY5A 1G8PA 2V6ZM 3PRPB 4RGOS 3APFA 3ZUNA 5KHQA 3PW3A 1SE2A 2C60A 1N5XA 3MTVA 2L2DA 1F29A 4JI1M 1GOZA 5E6PA 5EP4A 2IGHA 4KSLC 2QJLA 4NRWA 4B7HA 3C9EA 2HH5A 2VZKD 2ZEQA 4WA6A 3WHKA 5IWAM 5T8IA 2E01A 3RVXA 1JWSD 1OIPA 3UGJA 1TS4A 1EU4A 1SG9A 2YJ9A 3DBLI 2BF8B 5DPTA 1VDLA 2DYMA 2R2QA 4DHJB 4EIWA 3L17A 4NJ7A 4DUZM 4BSQA 2LXEA 1CTEA 1I4GA 1SXJC 3QARA 2GMIC 4K7UA 3M0EA 3RNEC 2Y0TA 5DNYA 4YTPB 5F02A 3AL0C 2DCCA 4XZ4A 3AEBB 1ME4A 1AN8A 3CSFA 2CU3A 1C9FA 5IKCM 4ZUXU 3PFIA 1P1AA 1XNQM 2JVCA 2RGFA 4KGSA 4MGKE 1K8RB 3ALBA 2IGDA 4W9LA 3Q14C 3J2PB 1YN4A 5C3JB 3HX3A 4FHKA 2C9OA 1D0MA 1EWCA 1ZDVA 5EP3A 3E56A 1R5LA 3ZJVA 1WJ4A 3AH7A 1Z5SB 3KW9A 4MZOA 3RVWA 4MGHA 4IBGA 3RFWA 2AL6A 2HJ1A 1LXDA 2FE8A 4ANWA 2C5RA 1BY8A 3HHYA 3AKZA 1TGUA 3I51A 1L0VB 4BBAA 3FYCA 5LXHA 2M17A 3PTFC 3U60B 2OHFA 4G4OA 4DDID 2XSZA 1YSYA 3DOAA 2NVUI 2R9NA 2BB5A 2XU3A 2KW0A 5KPTA 1FD6A 1GJSA 3PT2A 2QPAA 2WXOA 3JR5A 3F92A 1EWOA 3BINA 2G1EA 3C58A 4IM2A 1DOIA 2ZVNA 1V5TA 5FR3A 2J7NA 1WE6A 1B1ZA 5JHAA 1NYQA 2LWPA 3Q8GA 1MEGA 3KSXA 1FRDA 2PADA 1J7BA 3AI8A 1YX6B 1X37A 3TUOA 2YQZA 3I04M 2MCNB 2J5YA 4OVZA 3SAWA 2Z3XA 5JH5C 1I4WA 1J09A 1KYIA 1DGBA 3GE3C 1QZMA 3T6PA 4ZRKA 1SP4B 4FXCA 4JXJA 3HRDD 2AYOB 4BB9A 4N6EB 3B0AA 1KH0A 2VH1A 4D81A 2D3GA 4M0WA 4WQMA 3TJPA 2Y6EA 2JP7A 2HD5B 2QSFX 5CHTA 3RNAC 1NYRA 1AWDA 1SXJB 3E4RA 3W0LB 2JXNA 1QUTA 4LJ4A 1ZXIA 1HJPA 3AE5B 2Z8YM 5HI1A 2DCBA 2DENA 1PRBA 1HR0M 1L4ZB 1ZIVA 2QILA 5A2QS 3TIXA 4EEWA 1L0XB 3PNRA 1N77A 4G4QA 3AE7B 3ZNID 2DJFB 1STFE 4BOSA 4ZRJA 2K9DA 4GUAA 1EE8A 5C23A 1QYRA 4HEA1 1GMYA 3U30A 2R62A 3IXSA 5DPSA 3TMPB 1NY6A 4KLBA 1L5PA 4YYQA 4A8XC 2QHOA 3D32A 4PI3A 4NC6A 3GZNB 1SJHD 3EFUA 4HWYA 4KO8A 3Q8XA 2L83A 4RCOA 4TMAB 2J0MA 3DBRB 3IV2A 2FO5A 1TYGB 2KAJA 1IXZA 3TQSA 1YT7A 2AWTA 3H7PA 4LNOA 4W5CA 1M94A 4XE0A 3UQBA 2V4IB 5EE0A 4PCZA 1N78A 2PNSA 1KLVA 3QA8A 2MEKA 4LJ6A 1T43A 3BWKA 1TZOA 4W9CA 5EDSA 1CUKA 4M9XA 5JZEB 3BYYB 2DZJA 3N30A 3RVVA 4BOSC 3TNXA 1K3BB 1VQ1A 1XXGA 2ZW1A 3R7RA 1VZ6A 4G3OA 3AV0A 4F1SA 1HTQA 3GPPA 1Q0WB 4FD2A 4PT5A 2EMTA 1N33M 4B6WA 2ZCCA 1N32M 3DBSA 4EOYA 1IBLM 3PZ7A 4IG7B 3J7AS 3BY4A 3VR8B 2CP8A 3I01M 5KO3A 2L6OA 1ZP0B 2DZIA 1XWIA 4P1BC 2VH2A 2JZ1A 4AZFA 2Q2EB 1K50A 3P5WA 4L4UA 4AOFA 2ZTCA 1V1PB 1E7UA 1XC8A 3BOWA 3DBHI 4KT0F 2N1VA 4MM3A 1MJGM 3MP2A 4E74A 3RN9C 1FFVA 2LBCA 3VK8A 1ZMUA 3GRVA 1UZXB 2M5ZA 2KMMA 2JXTA 3IEJA 4II2B 1IBXA 1BGOA 5C18A 5BYRA 1WJ6A 2JT4B 2F5OA 3LYYA 4OHJA 3S3RA 6PADA 1FNNA 1J8CA 1SIJA 1F1HA 2CEAA 1K82A 1NB3A 2YEPB 1NV8A 3OISA 4L23A 2M0AA 1UKFA 1E8XA 1E6EB 1D6EC 2UXDM 2DI0A 1E94E 1OQRA 1Q10A 1BP4A 1CVZA 1D5XC 2KDBA 2N9EB 4ARCA 1UH6A 2BTWB 2KXEA 1TKYA 2BYVE 1NPZA 4NQKE 4KZ0A 1K53A 2BBCA 1WYGA 2L3ZA 3ZRCA 1RAXA 4GDKA 4QH6A 1DO2A 3Q8FA 2CHWA 2ZNVC 1QQWA 4OEMA 4YYUA 4K7WA 4JI2M 4PYUA 3EHVA 4BQVA 3H9DA 4B3RM 2M56B 3V76A 1F2AA 1A5RA 5FSWA 2J7OA 1LTMA 3SHQA 5LMUM 2D2QA 1TF0B 3O65B 3VK7A 4I05A 3DZDA 4IDIA 3GLGE 3AE8B 4DXFA 1POPA 2LVPA 3QC8B 1HT2E 4HPLB 1XKGA 1E5WA 2F5SA 4XWWA 1T3TA 1QOLA 4E71A 5CVMA 4HKZE 3GLGA 2IJ0A 4NXMM 4KLNA 1F4IA 1MHWA 3UZUA 2H89B 3AU5A 1NL6A 4GH9A 1XT9B 4K7CA 1XXHE 1MJDA 2RSUA 1DGFA 2N9LA 2FCQA 4G6ZA 2FIFA 3IVFA 2HL7A 4YT0B 1XEEA 4XK8F 1SBBB 1PPDA 3PPAA 3DFZA 3KVWA 4BKSD 4GKJM 3NZSA 1XXHA 2K9XA 1R7SA 2QENA 5DYIA 1L1TA 3VUWA 2EJSA 1TDHA 2LVPC 2L09A 4R7GA 4IM0A 1N60A 1PPNA 1QUSA 1CJLA 3OVXA 3P4PB 3OVZA 4KIKA 5EZSA 1PM5A 2WS3B 2JRIB 1F52A 1D0KA 5G55A 2PMVA 4BOZB 1LQBA 2AX5A 4O1NA 2IDYA 3VAWA 4WWMA 2VHFA 5AUKA 4M02A 3WALA 3KQ4A 5J18A 1V34A 3H4MA 1QANA 1EFUB 5EXTA 2NPTA 3MHVC 2YVCA 3DHIC 3MFGA 5J94A 1D0LA 3U61B 4X57B 1QDQA 3SMPA 4P17A 2XLJA 3C8YA 4GSWA 2VZKB 4JYAM 4F8CB 2NQGA 1CZPA 4Q7JA 1OFIA 5E6OA 2L52A 2L8JA 2E5LM 3DDCB 3PSEA 2ZNVB 1STEA 2W3SA 2F7DA 4ANXA 3DVNV 2WP9B 4MH8A 2LHCA 1UGMA 3ZNGC 1JWMD 1OJLA 2KTRA 3O0UA 1JMLA 3P1MA 3KW6A 1W5TA 5H37D 3RI7C 1WHCA 4GLSC 4QBBA 1F2RC 4B7GA 4B95A 3DBLB 1N34M 5BMIA 2ZTDA 4M9ZA 4B3TM 3RGPA 4CDEB 3HD3A 4WWOA 3GLFE 3U6MA 3ZLZA 3B9JA 2CWBA 3RE8A 2CV1A 4B3MM 1H4RA 1GJTA 1QLBB 3TBLD 2LXAA 1NNUC 1RFAA 3NS1A 2BWFA 4PP1A 4W9JA 4A20A 3GLFA 5E6JA 1I4QA 3RULA 1WR6E 2K6QA 1GLNA 1JQPA 5EE3A 4PDGA 4GRIA 1L2CA 1D3ZA 3ZQJA 2RDBC 3ENEA 4A6QA 1VZ7A 4JGHB 2LUEA 1MDWA 5EZQA 1OQQA 3WAMA 3A33B 3ILKA 2LRWA 1K52A 2GQFA 3FRHA 3AOEA 1D4BA 3UQAA 4LF9M 4AKGA 2D3AA 3HHAA 2K3UA 4LG2A 1TTEA 4LNNA 1R4MI 3L10B 3AE4B 3BK2A 4S0RA 1U9WA 3BCNA 1T3QA 4YTNB 3M6AA 1GG3A 2JZZA 3IHPC 2YJCA 1NENB 4WJQA 2PEAA 1JWUD 2VRRB 3I3TB 2DWNA 4MZSA 5KPRA 2XU1A 3NBXX 3C9PA 3NS8A 1XLNA 2RR9A 4JPSA 3LXSA 4BOQA 3ZIMA 1L6VA 1TL9A 1Q5WB 2NS5A 4Q8HA 2AQ2B 2KC2A 4BBNC 4MSXA 2DAFA 3Q8CA 2MJDA 4HCNB 4MJSA 1IWDA 2BS3B 3W5VB 4RKUF 4D82A 3EIHA 4DR3M 5C1ZA 3JR4A 3R9XB 1JALA 4WW0A 3A4SC 1GECE 4M0DA 1WGNA 3HU2A 2Y20A 1UM8A 3A98B 2FCSA 3B1LX 2DZNB 1QZEA 2V3PA 1W5SA 3MC9A 2FNJB 2HHNA 4JI3M 1R7RA 3VTWA 1V92A 1T5XD 1KFVA 3SR6A 2N9KA 4I81A 4AJWA 2C99A 1WZ3A 2D11A 4HVBA 4Z8XA 3PRPA 4WURA 1R2ZA 1ZPSA 1G4AE 2IPPB 3CTWB 4PS3A 2W9NA 1OTRB 4NJCA 4P6VF 3SAVA 3MC8A 2KX0A 4IM3A 4CZWA 1WFYA 2WXJA 1ZV1A 2CU1A 3BB7A 3ZC7B 4HDOA 2LFIA 4IBCA 2KFKB 2G8EA 3DCGA 2XN9C 5IT9S 4P6EA 1XMOM 4ASWC 4KKJA 3T9LA 3JAMS 2V4LA 4GIPA 1EWLA 1FXAA 1MHXA 3P5VA 2DYBA 4LF4M 3RMKC 1XLPA 4A3OA 1H6UA 5D6JB 3DVGX 2IO3B 3H4JA 5LLIA 3Q2AC 1WWTA 1NI3A 1I4RA 3NWLA 4AJYB 1IP9A 2GLSA 1ISNA 3H6SA 3R2TA 2MLBA 3SFEB 1UNSA 3B7QA 1KFXL 2HWKA 3K9OB 3T1HM 5C2TB 3KWZA 1PFDA 4K3CA 4JI0M 4XX5A 2G7YA 5FTJA 1NSFA 2KJRA 1WXAA 3B2GA 4AS1A 3RYTA 3QWLA 3PVLA 2KQ4X 1JW9D 2VHSA 2BS4B 4BLCA 3DHGC 3MHHA 2LVOC 1SB3C 4KKIA 2BQQA 2L0FA 4FCTA 4M01A 1IBKM 1A70A 2E02A 2VF7A 1J7AA 4US8A 2BVCA 2MH7A 3R66C 2DAKA 2R9CA 4G0NB 1THEA 3HUIA 1UWXA 5IZ7D 3FUVA 2WHIA 4ACFA 2DZZA 2HE7A 3SHFA 2WSEF 1ZUD2 4YYRA 3NHEB 4NZLB 1RWSA 2DXIA 1E9MA 4K0KM 1M4VA 2AL3A 1IUEA 4A9AA 1ZKHA 1LGRA 3S3QA 3QHTA 2DAGA 3KDSE 2JY6B 2KDFB 1WH3A 1Z6TA 1FMAD 1BUIC 2DHRA 4A55A 1K3XA 3TEYA 3SYKA 4HJGE 3AEEB 2ACTA 3FYDA 1HXYD 3IUTA 5H8YE 2BKFA 4MGZE 4BOPA 2O01F 2XBBC 3DBHB 1MVKA 3K9MA 3W67A 2IGGA 1M6DA 3FKEA 4AUQC 5D3IB 1QKZA 3PZDA 1F0ZA 4GIVA 4HXDB 3AEFB 5JHBA 1DKIA 3UMMA 1N61A 1HT1E 1SXJE 1DGGA 1T0SC 4N58A 2BU3A 2AYOA 4JL9A 5CHFA 1OFHA 3KSJA 2PBHA 4BKTA 4KGRA 3BOSA 3K2LA 1FFUA 2R18A 1C79A 3GOEA 4BFRA 2HD5A 3AN1A 2XFSA 4GHLA 2D07B 2LHDA 3P63A 3I5JC 1E10A 2A4ZA 2G45B 1SXJA 2KZUA 2LVNC 3PLVA 1JR3E 3HY5A 2K0PA 3KWVA 3WAOA 2QMTA 1T0QC 4HPMB 1C4PA 4PADA 3LFYA 1YN5A 1D5MC 2MRPA 3R8BA 3U6QA 2BNKA 1XB2B 2KN5A 1JR3A 2D10A 2A5YB 2XF3A 4EUTA 3B89A 1XO3A 3VUYA 2GFOA 1EM7A 1LFDA 2Z8LA 5IAAC 1QQRA 1AECA 3TMPA 2Y5CA 3PZ8A 2FFJA 3MHSD 4LTUA 2HTME 3UJNA 2WYQA 1C4CA 3KFUG 1V49A 3B7NA 2INDC 2WXRA 2CV2A 1KFUL 1DV0A 3RD2A 4G50A 5DPRA 4I4LA 2X49A 4L15A 3VDUA 1C7YA 3HHMA 4WH4A 2DKLA 4C56C 4YVAA 2N7JA 3Q3JA 5AZGA 2B3AA 3O13A 4H2AA 2F5NA 2HTHA 4BS5A 4GEWA 3ECIA 2GBRA 3ZNZB 4W9DA 2DCDA 2DHZA 1OEYJ 4IBDA 3DVGY 1AYWA 1MU5A 3NVZA 2RPQA 1S1QB 2LHEA 3TEXA 3PRMB 3R2IA 3ZQ4A 2R4JA 3EUB2 4GGQA 4I6NB 1FCLA 3GQ3A 3GCBA 5JZEA 2EKFA 3LCVB 5F3WA 2NQIA 1TTNA 1VSNA 3TEWA 2MHJA 1TKEA 2G8LA 3DPDA 1KM7A 1WSPA 3A1QB 1V8CA 1ZOYB 2VIIA 4AG6A 4I5SA 3IT4B 4TUUA 2D3BA 1QAMA 2HKJA 1NLJA 2LVQA 4WP2A 2WDQB 1IXRC 3ZDMC 1WRDB 2AIMA 1C1YB 3R3MA 1QOBA 3L27A 1R4GA 2QQ8A 4IBIA 3D8BA 3DVNU 4FJZA 3CH2X 4B0MA 3V6EB 1BQIA 3GRRA 4W9HA 1V1PA 1UFZA 2ZCBA 3ZW3A 2WX1A 4N59A 3DHHC 4GC9A 1P9DU 3BZDB 1GLOA 1EF7A 5E6NA 2DWMA 5LNK1 1E0ZA 4GB9A 3IECA 2WXLA 2L4FA 3U7ZA 1I4PA 2Z4SA 4JI5M 2W3RA 3APDA 3KW5B 4YYSA 1BVSA 4HLQA 5AEKB 1SXTA 4IBEA 2RPVA 2AYNA 2INPE 3P4QB 2UU7A 4CDFB 3WANA 3ZKJC 2KDIA 2QBYB 2GB1A 1TS3A 2BTWA 3P2BA 2VF8A 1V2YA 3VRBB 4IJEA 1SSNA 3A4RA 3GS2A 1EWMA 3Q8AA 1VEGA 2V1UA 4QHSA 4HWIB 4WAFA 3K9PB 4C7YA 5BYSA 2F5PA 1C78A 4HEOA 5ITYA 2C7HA 2K5PA 2LXCA 3IOQA 4LFBM 4ZHOA 2PLPA 1WGRA 4M8MA 1EUVB 3V60A 1AARA 3FAHA 4QRGA 2N4FA 3U6EA 4M8NA 3L26A 3IFUA 3O65A 2N9XA 2KACA 3LMMA 3KKUA 1RU3A 1T6BX 2OJRA 1GCBA 2ON8A 4JE3B 4KDIC 4J6IA 4HL4A 1I4HA 2MBHA 5GXGB 2DZKA 1OEYA 3OG5A 1MPEA 1R4NI 3TE6A 3USVA 1TY2A 3SATA 2KT7A 3IAS1 4ZYSA 3PNYA 2KFJA 2CKHB 4RM8A 3A9JB 2FCNA 2WXQA 8CATA 4PP2E 1BMLC 1FO4A 1ORYB 2LH0A 3J81S 1IY2A 1SE9A 2AEHA 1TGZB 3KFQA 3ZNHB 1FNUA 3WXGA 2KDEB 4US9A 2NCNA 4YWGG 3PHXB 3APCA 1R4MB 2FH0A 3VFKA 3VUXA 2PVGC 5IP4D 4AQ7A 2B76B 2MJ5B 3AFHA 3HGIA 1Q3CA 4AKIA 4L1BA 3Q6BA 4P7IA 1DEUA 4LRSA 1ZCMA 2CHXA 4LK0M 3HWNA 4HLEA 5J17A 4BZAA 1PJTA 2ZVOA 2K47A 2UUCM 1ZAEA 1V81A 2KYWA 1FXIA 4OZAA 1CS8A 1KLGD 4I04A 2XEWA 2JRIA 1VG5A 4DK5A 4K7SA 4KDLB 2YJ8A 2FUHB 4BOZA 3HVZA 1QAQA 1V33A 1J0GA 3E46A 4IWPA 2YNMD 1AU3A 2FUG1 2K22A 2APLA 2MJEA 1YK7A 1OKSA 2JY7A 4WJOA 1L4DB 3L29A 4YSXB 4ZRPA 4OVVA 2W55A 1YZBA 3U61A 1SE3A 1KHQA 3DQVA 1AUAA 3U6OA 2WDVB 4FK5A 2BYEA 2CB5A 4N8WA 5L8RF 4CO7A 4LJ8A 3RUIB 1GL7A 2LJIA 3ZTDA 2BJWA 1VEKA 2BT6A 1TIFA 3MP9A 5GKNA 1K51A 4LLGM 2G4DB 1SJED 1T6OA 2HWJA 2KC1A 4QOSA 5ITRA 3BXWA 5FR6A 3FKYA 4QOZC 4YHHM 3KVFB 4KSKC 1QDTA 2JPHA 3HM6X 5IO9A 5EXPA 1EWPA 1WRIA 2M8SA 3TWKA 1V80A 3IMAA 4FWDA 2R65A 4TUWA 1WIVA 3MMPA 1ET9A 2N9PC 2ERCA 1HZ5A 2RDHA 1GB4A 5KPZA 2WXMA 4DV1M 2WWZA 4XWTA 4DR1M 1NO1A 1AU4A 4GHAA 3IG5A 2QSDA 3NOBA 3M62B 4I6PA 1DO0A 1OFFA 3A46A 2JUJA 2JF5A 3R7QA 3M99A 4W9EA 2D7HA 4RH6A 4W5BA 2FTDA 3SD5A 2L1AA 4F1IA 2IYDB 4TQ0A 4JI6M 4ZTBA 1J7KA 2FIDA 4WWPA 3CBKA 1PQSA 1FM0D 3ZJTA 3L2AA 1L0YB 2XZFA 2KNBA 5KHOA 5L95C 1GC7A 1U9VA 4IP3A 1L2BA 4G3XB 4B9KA 4RF0A 4AWJA 4MSMB 3FC4A 2W54A 3I3TA 1F2BA 1PDXA 1EF5A 1S4VA 3HK0A 1U4AA 3H8CA 1DGHB 3DOWA 1GPXA 3HJ8A 1HEZE 1CQDA 4OVZB 3I9V1 4GN1A 1TZ1A 1TKGA 2R9MA 2KDLA 3I06A 1YJJA 2I7NA 4C7ZA 4DV0M 4NJ6A 2JWUA 1YNTE 4RM9A 2XZUA 1FNWA 1L6UA 3FTFA 1IFYA 1Y8GA 3AEGB 3ZJUA 2M60A 1MS6A 2N35A 2JA2A 1Z59A 1N75A 1TY0A 3SDLC 2BPSA 1L1ZA 4CDCB 1YMHE 2FCMA 2NTTA 3RZFA 3HHXA 1PBHA 1ROEA 1FEHA 1OTRA 4JI8M 4LJ7A 1YN3A 2V0GA 1V97A 3CIRB 1WGKA 2QC8A 3ERVA 1CJEA 3NZUA 2GHUA 2BS2B 3E21A 2OPFA 2H5XA 4LZJA 2WXPA 3KOXE 2KFKA 4ARIA 3JSVB 4XBOA 2AHMA 4N79A 5ITUA 4LDTD 2G5GX 4TQ1A 1J5EM 3U6DA 4S17A 3VTUA 3Q69A 3NY5A 4QNRA 4JIOU 1YQ3B 1JRUA 3HM3A 1E7VA 1GL6A 4TSSA 2AUXA 4P6GA 3WXFA 4AP4C 3F75A 1BT0A 2J7QC 3QX1A 1HTOA 2JQGR 3AECB 3L16A 2C96A 4RMAA 1AYFA 1VCBA 3K9OA 2KX3A 4WWNA 3KOYE 4K81A 4AW4A 3EIEA 1TS5A 1P7FA 3HJSA 3T3NA 5IOIA 4MGIE 1LM8B 3ML8A 2DX5B 4OVUA 3FUUA 1YD8U 2C5LC 3VDPA 2JZ3B 3AE3B 2GRIA 2WGSA 4W9GA 2Y21A 2DWQA 1GVNA 1KTKA 1WI0A 4IOIE 4D8IA 3F5VA 3IHPA 4MB7A 2REXA 4USAA 2LZ6A 5BO4B 2CJNA 2QCZA 3P5XA 4JI4M 4LZZA 3CBJA 2LGYA 2XEPA 4GDLB 2C0YA 3NHEA 2DAIA 2IO0B 2QIEB 1NJGA 3GO8A 4LCBA 3LB8C 2KNZA 3OJ4B 4DV3M 3H7DA 1ZDXA 2JY6A 2NQAA 3AJIB 4N4ZA 4ZYNA 2PKOA 2UU9M 4B0EA 4DR7M 4G4NA 5D94A 1U5IA 4YYVA 2N7EA 2YFQA 5G5HA 1PE6A 2ZAOA 1WZ0A 2MX2A 1MFWA 4W9KA 3PHUA 2UUAM 1WGDA 3C0RB 4DMYA 2WX0A 1QILA 1E8WA 3FRIA 3L25A 5EE1A 2BDZA 3NVWA 2OOBB 2C7NB 4GDKB 2P86A 1J7CA 3T38A 4D80A 3L08A 1ET6A 2QEJC 4HXDA 2Q5WD 3BBZA 3KP0E 4WJNA 2E3TA 2XH9A 1LO5D 2Z59B 1CB5A 3TRKA 1C4AA 2O6VD 3NUHB 1HNZM 2XK5B 3UI3A 2NMQA 3Q3FA 4FHJA 4LJPB 5CX3A 5I4DA 1E8YA 1UBIA 4FULA 3RNVA 2WXNA 3GZNI 1QOAA 2KZRA 2ZPNA 3V6CB 1EF1A 2I38A 1JR3D 1VDVA 2C7MB 3VKGA 3DBRI 4JLCA 2J7QB 4NL4H 1WGYA 2R44A 4FN2A 2LWXA 2E03A 4UN2B 2V1CA 2R9FA 2J53A 4PK1A 1NJFA 5EXSA 3U5ZB 2EKIA 2OZ2A 1ZW7A 3A42A 3ZGZA 1WM2A 2CHVA 3BWUD 1FH0A 1TH4A 3W1YA 4L8RC 3C3EA 2HHHM 3H89A 4XZXA 1JQ4A 1PGXA 2JQRB 2JQFR 1RYJA 2LVOA 4XC2A 2Z7JA 4MT5A 4A3VB 1UWMA 3QYEA 2R6FA 3HIZA 3J7BA 2XNAC 1KFYB 1X9YA 2V3SA 3HHWA 2AQ1B 2KVZA 5DYGA 1HNWM 1R4NB 2KNAA 2V1YA 2CIOA 4PD2A 2LGXA 3U52E 4HCPB 1JWBD 1SIFA 3AV8A 2IO2B 4ICVA 1PGBA 3V05A 4BKSA 1ZMVA 3CMMB 5BR8M 3B74A 2KO3A 2KWDA 2AS8A 1FNVA 3FTDA 5DPWA 3GQ5A 2PTLA 3TCAA 3P5UA 3PRMA 3ZUAA 1PUTA 3PS6A 4W9IA 3NVYA 1TU6A 2MJ3A 3H6NA 2EKKA 3UGBB 4A3PA 2KOXA 4NQLB 1N36M 3S2AA 2UYZB 4C80A 2K8BA 3A1QA 2HCBA 3L28A 2BDLA 5JI2E 1WGLA 1TR8A 3GP7A 2MR9A 2KQ7A 4FJVB 4F7ZA 2Z0EB 5K16A 3HHIA 3VH3B 4FJCA 1NHWC 1WX9A 1O0EA 1L7YA 1RLFA 2RGHA 3V6EA 2WU5B 2XSZD 2CHZA 4OZBA 3KLSX 2PE9A 2INCC 4FWHA 5FKAC 4MEMA 2BYTA 1IQPA 4PS7A 3L54A 2CUZA 1UELA 2DC6A 1J19A 2LGIA 2L32A 2J0KA 2O5RA 3DWGC 3U60A 2R9OA 2CFOA 5D3DA 4RGMA 1N63A 1QOGA 3GE8C 1MG8A 2WZJA 1UGJA 4NPNA 2UZJA 3I57A 3ONSA 1XQQA 3WXEA 4A5UA 2KANA 1HZ6A 1IPGA 1HE8A 4DBGB 4WJPA 1ZMWA 5TR5A 4LF7M 1SF0A 5D7GA 3UIOB 4ANVA 1WR1B 3PGEA 4EZKA 1ITOA 2AVWA 2L7IA 1TS2A 3V62A 2Z4RA 1KOTA 1OIZA 2FYEA 1YX5B 3KUDB 3TSSA 5EXXA 4X6IA 2QBYA 2IY0B 4R3DA 2BB6A 3GLIB 4YSYB 3T3OA 1FJGM 1CK1A 2K25A 4CDDB 5JH3A 1FPYA 4DMXA 2F4VM 2D5GA 1HNXM 3K9PA 2J42A 1NI2A 1SEBD 1GB1A 4XGAB 3A9KB 4G4RA 4KV2A 2H1RA 1K3WA 4DXAB 3ZH9B 2R2OA 5LXIB 3QT4A 5A24A 2SEBD 2B3TA 3QJZA 4A90A 3K92A 3VXWA 4QNMA 2DWZB 2JWSA 1NBFC 4MSQB 2LEKA 4Q8GA 3JVZX 2KLCA 4JI7M 1ATKA 1N6ZA 2MH8A 1V9JA 1UF0A 2Z0DB 5IA7A 1ME3A 1XNRM 4LJAA 5CVNB 1PVJA 4HRSA 1IXSB 2KWUB 2ACZB 2RGOA 4GKKM 4G54A 2DAEA 2HDEA 5HHDG 1X1MA 2LD9A 1Z5CA 2DLBA 4IC7B 4LNFA 1QVRA 4ZDVA 1GUAB 4C4VB 3N1YC 3BK1A 3A9JA 3ZDTA 4IBFA 4LF8M 2GBKA 1NV9A 2GBMA 1ZXHA 3RNCC 1NHGC 2MBQA 2WXIA 2JNHA 3DF0A 2WXGA 2BWBA 1PJJA 1DYQA 3ZNHA 5DCNA 2JXXA 2G6DA 5FTNA 1FXTB 3PHXA 1GAQB 4R71A 4MACA 3K24A 2ZAMA 4EFOA 4DUYM 1WMHB 2RDGA 1IN4A 4F2LA 3M95A 2WSCF 1OAOC 3M7GA 3BIID 3MHZA 4YL8A 4YTMB 1CV8A 4CJ6A 1CSBB 2PVOD 4REZA 1KXRA 4PYZA 2KN4A 4MI7A 4RFBA 2G3QB 3W1SC 2ICIA 3SAUA 4S12A 3MORA 2FNAA 3ZXVA 1S3SA 4FA6A 2GOWA 3U8EA 3DA1A 3W31A 3OAWA 4L78A 3NZ3A 4GITA 5PADA 2CHGA 2EELA 1OGWA 2M19A 3IT6B 3U7DA 4IBBA 2BW2A 2KDMA 1I7HA 3PHWB 2AUZA 3QSDA 3HU1A 1YQ4B 1Z5BA 3B79A 3TL5A 3ZO5B 4L6V6 4Z6YA 1WJNA 3VFDA 1C1KA 1ZGUB 2M0XA 3SC3A 4DV6M 1QF6A 3CF0A 2MBEA 4XUIA 2Y5BB 4QRVA 4IWQA 2C98A 3AU4A 2FOIC 1ACCA 2CJOA 3GB1A 4LDTB 1VEJA 1IYFA 2P0RA 4DV2M 1MX0A 1PJQA 3K8UA 3JW0X 4RNAA 4TV3A 4QHTA 3Q3NC 1JQJC 2ONQA 2NBWB 5CHWA 3L4PA 1WXQA 2NQ8C 2QNJA 4K1RB 2MSED 4NXNM 4LY6A 3J27B 1WF9A 2JUOA 1PJSA 3U6CA 2R61A 1WXMA 2V9HA 4K3BA 3IAM1 1G41A 2KMAA 3KP1E 4NSOB 2J4XA 2P7UA 2WLBA 3HJQA 5HKHA 1HA5A 2JSVX 2FBWB 1XCTL 3W9CB 1N5WA 1HUCB 2LMCA 1NEKB 4UDUC 4KGTA 3MC0B 3FILB 3RCZA 5EJCA 1ZE3D 2DCAA 4GMQA 3KWBX 4NAWB 3VHTC 4IUMB 3VVWB 3A45A 1YLAA 1YALA 1VZ8A 2NTSA 4JV5M 1YOVB 2R6NA 3V3XA 2AGAA 5FK9C 2WDTB 2WNMA 1KSFX 2DBYA 2G4SA 7PCKA 2OQ4A 5DFLA 2QP9X 2DYOA 3N3KB 4P16A 4DHZB 2LTUA 2O25A 3AE1B 5L83A 4GU2A 4LCDE 2O2VB 4YV8A 3WHLA 2JZPA 2KKCA 4G11A 1Z5AA 1V86A 2LNHC 1R6BX 1E9SA 1FCCC 1WJ7A 1JRPA 3PXGA 4RKXA 2LGSA 2DHYA 4KODA 2NBVB 2MWSB 1YJ1A 3E9SA 2X38A 1Q6KA 3FUXA 4MGYE 4HJKA 1Y56A 2IBIB 3URYA 3KS4A 3Q8BA 2X8XX 1XHBA 2ASQA 2N1WA 2GI9A 1DGHA 3QIJA 1P98A 2FAZA 3MTNB 2BKRB 4IWOA 5AZFA 3N4CA 4GC5A 2H7JA 1IY0A 3N9YC 4W4UA 1NY5A 2D3CA 3GLHB 1QT9A 3B08A 4RGTA 5EP2A 1EIJA 4J3OD 1DOYA 1F2RI 2D7EA 3KUCB 3VR9B 2G8JA 3K1JA 3AE6B 1WXVA 3O1GA 3KUZA 2GNOA 3GPUA 2GBNA 4FBJB 2O6VB 1T0YA 1KRHA 1IGDA 4CYEA 1MEMA 2IO1B 5EP1A 2FQ9A 4FADA 3ETRA 3WIMA 4BVUC 3TL4X 3WA0A 1C3TA 1ENFA 2KRKA 2L7RA 3FUTA 2MP2B 1C76A 1G71A 2RKOA 1OQYA 4WQOB 4HDQA 3GQ4A 2KTFA 1WIAA 2DNFA 3FTEA 4I8OA 5CVOB 2MQJA 2WU2B 5E26A 3UIPB 2JYEA 2TSSA 3P4SB 3WAPA 3C3DA 4LNKA 1D5ZC 4NOOB 4W5WA 3HVDA 8PCHA 3M3JA 4Q2JA 2PIAA 3E1ZB 2F5QA 3JSVA 3SBJA 2NR2A 2OOAA 4BS6A 3TPZA 5KQ8A 4CISA 1XLOA 4LJOB 3BBAA 1VR9A 1E8ZA 1IN7A 2DZYA 3MHSA 3D8LA 3T15A 3OF9A 2I1JA 2JRHA 3J80S 3AXCA 3FUWA 2BYFA 2CE7A 2QDFA 2X4AA 3W0FA 2BJVA 3QQ8B 3N1XC 3KWLA 1GO5A 4HROA 2LHGA 2HAKA 2MA9B 1YE9A 3VRAB 4FLHA 2XGNA 2F1GA 3N32A 3SFZA 1OAIA 1ZQ9A 2WXHA 3LJ3A 3N3GA 1Y08A 1EWYC 4JWSC 3RNGC 2KJHB 2DJGB 2UWQA 1FRRA 3NJTA 2DWLA 3R8FA 3U6LA 1A6RA 2L00B 4YXDB 2KRUA 1IGCA 3OWEB 2IZVB 2J0JA 2ZM6M 1SNKA 2LJ5A 4IBKA 3L0WB 2OJWA 4KX6B 3U6SA 4LF6M 1U9QX 4OX9M 1WYWB 3RT3B 3CGWA 5ITXE 1P7EA 3QJ3A 1XD3B 4M9SA 3GPXA 1JB0F 4JN6A 4MH0E 4LGYA 3H7SA 4TKNA 1G59A 3ABVB 4ZHPA 1JWAD 2DAJA 3EECA 3CF2A 4GDLA 1NB5A 4IW0A 1KLUD 3LW5F 3QAQA 2KVRA 3ZYYX 3PREA 5MPOA 2CRUA 1Q39A 1JCKB 5ITXA 1I94M 3RFZB 4KVGB 2K8CA 4DV5M 2LRUA 2SAKA 4PDIA 2DC8A 3C19A 5IREB 2YEPF 2YR0A 2MBBB 3CWIA 1ESFA 2CS4A 2LUMA 1HQRD 3PT2B 3OF8A 4ANUA 3KS8A 5CTRC 5ITQA 2UXBM 1PADA 4DR5M 3PLUA 2HXZA 2QZ4A 4LF5M 2WXKA 2L76A 3LVWA 3B9PA 3VTVA 2D7GA 5FTKA 5FLXS 2LVAA 3PVSA 3EA6A 3RPFC 1QDRA 2K6BA 3IG8A 3C0RA 3L13A 5HG2A 1HQCA 4ZPXA 3WCQA 3HU3A 2BGFA 1F9JA 1GC6A 4IKGA 5BMGA 3N1ZC 2OOBA 4CGYB 2NBUA 1YK8A 3AE2B 2XFTA 1V6EA 3OLMD 5G2NA 1LV7A 4B7FA 4GXBA 3MJ5A 2C9CA 3PV1A 3VDZA 4JX1C 2H88B 4GMVA 2XK5A 2QCUA 1SGHA 2JTCA 2BTEA 1WGGA 1PIPA 3LCUA 1QXPA 2R45A 4C00A 2PW9A 3MJWA 2V3NA 1FIQA 3X23A 9PAPA 3SFDB 4JQWC 3KXEC 4M0WB 1IY1A 3V6CA 4HKQA 1YJIA 2J7QA 1KF6B 5HFYA 1H8CA 7CATA 4OZCA 2DENB 3QCAA 2JZ0A 3AB5A 3U5ZA 1EO6A 3THGA 2LGDA 2CHQA 2DC9A 2KEBA 2Y5PA 3LQQA 2I1KA 3TEZA 1L8QA 3Q8EA 4LNIA 3HHZA 3BPFA 5TSSA 2WQYB 3VLFB 4X62M 3TWMA 3LVVA 3EFCA 1N62A 4CHKA 4ANRA 4DHJD 4AQYM 3LDZE 2ATOA 2OP3A 3UINB 2ZW0A 2QHOB 2KA6B 3AI5A 2BWES 2INNE 3AE9B 2EUCA 4FWGA 3B7ZA 1IN8A 4ITKA 4FIPA 2UUBM 3GRUA 2N0SB 4QAYA 1TT5B 3KSEA 3UK6A 4YY3M 5AZHA 1MN3A 5H92C 4NAMA 1WY8A 1Q3BA 3H7PB 1MHHE 2OEDA 5ITTA 3OQCA 1WX7A 1YQBA 3SASA 4FVMA 2K8HA 1MG4A 3W30A 1YUBA 2N7DA 1E90A 1VD2A 4L16A 3QYBA 4RF1A 1GKIA 3QWZB 3NBIA 4DV4M 4BPVA 1UUPA 1WM3A 4RGNA 2XU5A 2FT2A 3PBHA 4DQOC 4JWUC 1NVMA 2M4NA 5JI3E 5JA7A 3ZCBB 1I4XA 3I63C 2P5TA 3KH0A 4B08A 3P42A 4AXMA 2BWEA 3CH3X 2CR5A 2I2YA 4DWFA 3TWLA 3MK6A 2YJ2A 4WAAA 4LRTA 1PGAA 4IBJA 4WIPA 3BY4B 3AM9A 4B3SM 1B9RA 4E3CA 1F2CA 1P0RA 2WXFA 3ZXRA 4AG5A 3X0WA 1U9XA 1WGHA 4XGIA 2DC7A 4MM3B 1P3QU 1RM6C 3AEDB 2KK8A 3GLIE 4LFAM 4DBGA 1IBXB 4XR7A 2WSFF 1VJKA 4LJ9A 4FW9A 5KQDA 1WR1A 3BVMA 1WXSA 3CSTA 1YIWA 1QMYA 1AYVA 3FE3A 1AW7A 2WBFX 2R4EA 3GRYA 4XDDA
chains in the Genus database with same CATH topology
1VLBA 1CQVA 1IN6A 5LMNM 3LXFA 3GLIA 5BYQA 5BMHA 4NRVA 3SYLA 1D2NA 4ZOHC 4ITQA 2AQ3B 1EU3A 1VDDA 1VRAB 2WDRB 1V1OA 3NRZA 2EA0A 3SARA 4XDCA 2W82A 4II7A 3K8ZA 1SXJD 5FTMA 4ZRQA 3SHGB 4NSRA 3GP1A 3EGRA 4CQNA 3FD9A 2R46A 3LQRA 5EQTA 4AI6A 2Y0QA 3J9CA 3U4EG 2EO2A 1JROA 1NNJA 5EE9A 3B21A 3BVZA 1E32A 3GLGB 5AUIA 3PO0A 4LFCM 1DOXA 2KZSA 1TH2A 1IN5A 4EE2A 3VKHA 4D8BA 3AOEC 4IJFA 3T1YM 2DVWB 1XXHB 3KOZE 1RFKA 1IBMM 1PJIA 2UXCM 1F77A 4X64M 1BXTA 2G9HD 3CF6E 3BVGA 4X65M 4DR6M 3PHWA 3I4VA 1QOFA 4DXGA 3DWMA 3HWSA 4OW0A 1DGJA 2IPKD 5C1BA 4IIWA 1SE4A 3U2SC 2ZBKB 3AOGA 1MI0A 4L2YA 1TJEA 3KOWE 3RGSA 1XCQL 4LJ5A 5JXVA 2I7PA 2JU6X 3BYTB 1PYWD 5G5GA 2X8AA 1NVID 3FILA 1E9RA 3U6PA 2JYTA 2Y3AA 4OU7A 2J52A 4DR2M 4IUMA 3GLFB 4D8EA 3AEAB 4CHTB 2Z84A 1IM2A 3FTCA 3H8HA 3GPYA 1XMQM 1R2YA 3W5UB 3P4RB 1QAOA 1E7PB 2CV0A 1TDZA 4X66M 1XLQA 1HQYE 2RMMA 1G3IA 5BPVA 3W1SA 3SEBA 1C77A 4DV7M 3AMZA 4KHPM 4LGMA 4FCWA 2JX5A 1TH3A 4FCVA 1L2DA 5FTLA 4AKHA 2E6XA 4BOUA 3GLHA 3VQIA 2ZANA 2L7HA 2DZOB 4DR4M 4YSZB 2DOSA 3OTOM 4D2KA 3QAUA 3W2DA 3B2FA 1XF5L 2VQEM 3SMSA 3PNVA 3HKPA 3I4YA 2VQFM 3NVVA 1G8PA 2V6ZM 4RGOS 1SE2A 1N5XA 3MTVA 4JI1M 1GOZA 5EP4A 2IGHA 2QJLA 4NRWA 4B7HA 2VZKD 3WHKA 5IWAM 5T8IA 1JWSD 3UGJA 1TS4A 1EU4A 2DYMA 4EIWA 4DUZM 2LXEA 1I4GA 1SXJC 3M0EA 2Y0TA 5DNYA 4YTPB 3AL0C 3AEBB 1AN8A 2CU3A 1C9FA 3PFIA 1XNQM 4KGSA 4MGKE 2IGDA 3J2PB 1YN4A 5C3JB 2C9OA 1EWCA 1ZDVA 5EP3A 3E56A 3ZJVA 3AH7A 4MGHA 4IBGA 3RFWA 2FE8A 2C5RA 3HHYA 3AKZA 1TGUA 3I51A 1L0VB 4BBAA 3FYCA 3U60B 2OHFA 4G4OA 2XSZA 1YSYA 3DOAA 2BB5A 2KW0A 5KPTA 1FD6A 3PT2A 2QPAA 2WXOA 3JR5A 2G1EA 3C58A 1DOIA 5FR3A 2J7NA 1B1ZA 1NYQA 3KSXA 1FRDA 1J7BA 1X37A 3TUOA 2YQZA 4OVZA 3SAWA 2Z3XA 1I4WA 1J09A 1KYIA 1DGBA 1QZMA 4FXCA 4JXJA 3HRDD 4N6EB 4BB9A 1KH0A 4D81A 4M0WA 4WQMA 1AWDA 3AE5B 1NYRA 1SXJB 3E4RA 3W0LB 1ZXIA 4LJ4A 5HI1A 1HR0M 1L4ZB 2QILA 5A2QS 1L0XB 1N77A 4G4QA 3AE7B 4BOSA 4GUAA 1EE8A 1QYRA 4HEA1 2R62A 3IXSA 1NY6A 1L5PA 4A8XC 1SJHD 4KO8A 3Q8XA 2L83A 4RCOA 4TMAB 1TYGB 2KAJA 1IXZA 3TQSA 4XE0A 2V4IB 5EE0A 4PCZA 1N78A 2MEKA 4LJ6A 1TZOA 4M9XA 3BYYB 1XXGA 2ZW1A 1VZ6A 3AV0A 3GPPA 4FD2A 4PT5A 1N33M 1N32M 1IBLM 3PZ7A 3J7AS 3BY4A 3VR8B 5KO3A 2L6OA 1ZP0B 1XWIA 4AZFA 1K50A 2Q2EB 4L4UA 1V1PB 1XC8A 3MP2A 1FFVA 3VK8A 3GRVA 2M5ZA 2KMMA 2JXTA 1IBXA 5C18A 5BYRA 3LYYA 2F5OA 4OHJA 1FNNA 1SIJA 2CEAA 1K82A 2YEPB 4L23A 2M0AA 1UKFA 1E6EB 1D6EC 2UXDM 1E94E 1OQRA 1Q10A 1D5XC 4ARCA 2BTWB 2KXEA 1TKYA 1K53A 2BBCA 1WYGA 1DO2A 3Q8FA 1QQWA 4JI2M 4B3RM 2M56B 5FSWA 2J7OA 5LMUM 3VK7A 3DZDA 4IDIA 3AE8B 4DXFA 1HT2E 2F5SA 4XWWA 1T3TA 4HKZE 3GLGA 2IJ0A 4NXMM 4KLNA 3UZUA 2H89B 4GH9A 1DGFA 2N9LA 4G6ZA 2HL7A 4YT0B 1XEEA 1SBBB 3DFZA 3KVWA 4GKJM 1XXHA 2K9XA 1R7SA 2QENA 5DYIA 1L1TA 1TDHA 2L09A 4R7GA 1N60A 3P4PB 5EZSA 1PM5A 2WS3B 2PMVA 2AX5A 4O1NA 2IDYA 4WWMA 5AUKA 3KQ4A 3H4MA 1QANA 5EXTA 3MFGA 3MHVC 3U61B 3SMPA 2XLJA 3C8YA 2VZKB 4JYAM 1CZPA 1OFIA 2L52A 2E5LM 3PSEA 1STEA 2W3SA 2WP9B 4MH8A 1JWMD 1OJLA 1JMLA 3P1MA 3KW6A 1W5TA 5H37D 4GLSC 1F2RC 4B7GA 1N34M 5BMIA 4M9ZA 4B3TM 3RGPA 3U6MA 3B9JA 3RE8A 2CV1A 4B3MM 1QLBB 1NNUC 3NS1A 3GLFA 5E6JA 1I4QA 1GLNA 5EE3A 4PDGA 4GRIA 1L2CA 4A6QA 1VZ7A 5EZQA 1OQQA 3ILKA 1K52A 3AOEA 1D4BA 4LF9M 4AKGA 2K3UA 4LG2A 3AE4B 3BK2A 1T3QA 4YTNB 3M6AA 1NENB 1JWUD 2DWNA 5KPRA 1XLNA 4JPSA 4BOQA 1L6VA 2AQ2B 3Q8CA 2MJDA 2BS3B 3W5VB 4D82A 3EIHA 4DR3M 3JR4A 3R9XB 1JALA 4WW0A 4M0DA 3HU2A 2Y20A 1UM8A 3A98B 2DZNB 2V3PA 1W5SA 4JI3M 1R7RA 1T5XD 1KFVA 3SR6A 2N9KA 4I81A 2C99A 4Z8XA 3PRPA 4WURA 1R2ZA 1ZPSA 1G4AE 3CTWB 4NJCA 4P6VF 3SAVA 2WXJA 3BB7A 3ZC7B 2LFIA 4IBCA 2XN9C 5IT9S 1XMOM 4KKJA 3JAMS 4GIPA 1FXAA 1MHXA 4LF4M 1XLPA 1H6UA 1WWTA 1NI3A 1I4RA 3NWLA 3R2TA 3SFEB 1UNSA 2HWKA 3T1HM 5C2TB 1PFDA 4JI0M 5FTJA 1NSFA 4AS1A 3B2GA 3QWLA 2KQ4X 1JW9D 2BS4B 4BLCA 1SB3C 4KKIA 4FCTA 1IBKM 1A70A 1J7AA 4US8A 2MH7A 3HUIA 1UWXA 5IZ7D 3FUVA 3SHFA 1ZUD2 4NZLB 1RWSA 2DXIA 1E9MA 4K0KM 1M4VA 4A9AA 1IUEA 3KDSE 1Z6TA 1FMAD 1BUIC 2DHRA 4A55A 1K3XA 3TEYA 3SYKA 4HJGE 3AEEB 3FYDA 1HXYD 5H8YE 4MGZE 4BOPA 1MVKA 2IGGA 3FKEA 5D3IB 1QKZA 1F0ZA 4HXDB 3AEFB 1DKIA 3UMMA 1N61A 1HT1E 1SXJE 1DGGA 4N58A 2BU3A 1OFHA 3KSJA 4KGRA 3BOSA 3K2LA 1FFUA 2R18A 1C79A 3AN1A 2XFSA 4GHLA 2LHDA 3P63A 1E10A 1SXJA 2KZUA 3KWVA 2K0PA 2QMTA 1C4PA 1YN5A 1D5MC 3R8BA 3U6QA 2BNKA 1JR3A 2A5YB 2XF3A 1XO3A 2Z8LA 1EM7A 1QQRA 3TMPA 2Y5CA 3PZ8A 2FFJA 4LTUA 2HTME 3UJNA 1C4CA 3KFUG 2WXRA 2CV2A 4I4LA 2X49A 4L15A 3VDUA 4WH4A 4C56C 2N7JA 3O13A 4H2AA 2F5NA 4IBDA 1MU5A 3NVZA 2LHEA 3TEXA 3R2IA 3ZQ4A 2R4JA 3EUB2 1FCLA 3GQ3A 5JZEA 5F3WA 3TEWA 1TKEA 2G8LA 1WSPA 1V8CA 1ZOYB 2VIIA 4AG6A 4I5SA 3IT4B 1QAMA 2HKJA 2WDQB 1IXRC 3L27A 1QOBA 4IBIA 3D8BA 4B0MA 3GRRA 1V1PA 4N59A 4GC9A 3BZDB 2DWMA 5LNK1 1E0ZA 3U7ZA 2WXLA 1I4PA 2Z4SA 4JI5M 2W3RA 4HLQA 1SXTA 4IBEA 2RPVA 2INPE 3P4QB 2QBYB 2GB1A 1TS3A 2BTWA 3VRBB 4IJEA 1SSNA 3GS2A 3Q8AA 2V1UA 4WAFA 4QHSA 4C7YA 5BYSA 2F5PA 1C78A 5ITYA 2K5PA 4LFBM 4ZHOA 2PLPA 3FAHA 3IFUA 3U6EA 3O65A 3L26A 2KACA 3LMMA 1T6BX 2ON8A 4JE3B 4HL4A 1I4HA 5GXGB 1MPEA 3TE6A 1TY2A 3SATA 3IAS1 4ZYSA 3PNYA 2WXQA 8CATA 1BMLC 1FO4A 1ORYB 2LH0A 3J81S 1IY2A 1FNUA 4US9A 4YWGG 2PVGC 4AQ7A 2B76B 3AFHA 3HGIA 1Q3CA 4AKIA 4L1BA 4LRSA 4LK0M 2K47A 2UUCM 1ZAEA 4OZAA 1FXIA 1KLGD 2JRIA 4BOZA 3HVZA 1QAQA 2YNMD 2FUG1 2K22A 2MJEA 1L4DB 3L29A 4YSXB 4ZRPA 2W55A 1YZBA 3U61A 1SE3A 2WDVB 3U6OA 4LJ8A 1GL7A 2LJIA 2BJWA 2BT6A 3MP9A 5GKNA 1K51A 4LLGM 1SJED 4QOSA 5ITRA 4QOZC 4YHHM 5EXPA 1WRIA 3TWKA 4FWDA 2R65A 4TUWA 1ET9A 2ERCA 1HZ5A 2RDHA 1GB4A 2WXMA 5KPZA 4DV1M 4XWTA 4DR1M 4GHAA 3IG5A 2QSDA 1DO0A 1OFFA 3A46A 2D7HA 4RH6A 2L1AA 4TQ0A 4JI6M 4ZTBA 1J7KA 1FM0D 3ZJTA 3L2AA 1L0YB 2XZFA 4IP3A 1L2BA 4RF0A 3FC4A 2W54A 1PDXA 1DGHB 1GPXA 3HJ8A 1HEZE 4OVZB 3I9V1 1TKGA 1YJJA 2I7NA 4C7ZA 4DV0M 2JWUA 1YNTE 2XZUA 1FNWA 1L6UA 3FTFA 3ZJUA 3AEGB 2M60A 2JA2A 1Z59A 1N75A 1TY0A 1L1ZA 1YMHE 2NTTA 3HHXA 1ROEA 1FEHA 4JI8M 4LJ7A 1YN3A 2V0GA 1V97A 3CIRB 1WGKA 1CJEA 2BS2B 2OPFA 4LZJA 2WXPA 3KOXE 4ARIA 4XBOA 2AHMA 5ITUA 2G5GX 4TQ1A 1J5EM 3U6DA 3Q69A 4QNRA 1YQ3B 4TSSA 1GL6A 2J7QC 3AECB 2C96A 1AYFA 3KOYE 4AW4A 3EIEA 1TS5A 1P7FA 3HJSA 3T3NA 4MGIE 3FUUA 3VDPA 3AE3B 2GRIA 2Y21A 2DWQA 1GVNA 1KTKA 4IOIE 4D8IA 4MB7A 4USAA 2CJNA 4JI4M 4LZZA 2XEPA 4GDLB 2QIEB 1NJGA 3GO8A 4LCBA 3LB8C 4DV3M 1ZDXA 3AJIB 2PKOA 2UU9M 4B0EA 4DR7M 4G4NA 2YFQA 5G5HA 2ZAOA 3PHUA 2UUAM 1QILA 5EE1A 3L25A 3NVWA 4GDKB 1J7CA 3T38A 4D80A 1ET6A 2QEJC 2Q5WD 3KP0E 2E3TA 2XH9A 1LO5D 3TRKA 1C4AA 3NUHB 1HNZM 3UI3A 2NMQA 5I4DA 3RNVA 2WXNA 1QOAA 2I38A 1JR3D 1VDVA 3VKGA 4NL4H 2LWXA 2V1CA 2J53A 1NJFA 5EXSA 3U5ZB 2EKIA 3A42A 3ZGZA 2CHVA 3BWUD 1TH4A 4L8RC 2HHHM 4XZXA 1JQ4A 1PGXA 2JQRB 1RYJA 2Z7JA 4MT5A 4A3VB 1UWMA 2XNAC 3J7BA 1KFYB 3HHWA 2AQ1B 5DYGA 1HNWM 4PD2A 3U52E 1JWBD 3AV8A 1PGBA 3V05A 5BR8M 2KWDA 1FNVA 3FTDA 3GQ5A 2PTLA 3PRMA 1PUTA 3NVYA 2MJ3A 1N36M 4C80A 2HCBA 3L28A 5JI2E 3GP7A 1NHWC 2RGHA 2WU5B 2XSZD 4OZBA 3KLSX 4FWHA 5FKAC 2BYTA 1IQPA 2CUZA 2LGIA 2L32A 2O5RA 3DWGC 3U60A 2CFOA 5D3DA 4RGMA 1N63A 1QOGA 1UGJA 2UZJA 3I57A 4A5UA 1HZ6A 4LF7M 1SF0A 5D7GA 1TS2A 2L7IA 2Z4RA 3TSSA 5EXXA 2QBYA 4R3DA 2BB6A 3GLIB 4YSYB 3T3OA 1FJGM 1CK1A 2F4VM 2D5GA 1HNXM 2J42A 1SEBD 1GB1A 4G4RA 2H1RA 1K3WA 3ZH9B 2SEBD 4A90A 3K92A 4QNMA 2DWZB 2LEKA 4JI7M 1XNRM 4LJAA 1PVJA 4HRSA 1IXSB 2ACZB 2RGOA 4GKKM 2HDEA 5HHDG 1Z5CA 2DLBA 1QVRA 3BK1A 4IBFA 4LF8M 1ZXHA 1NHGC 2WXIA 2WXGA 1PJJA 1DYQA 3ZNHA 5FTNA 3PHXA 1GAQB 4MACA 2ZAMA 4DUYM 2RDGA 1IN4A 3M7GA 3BIID 3MHZA 4YTMB 2PVOD 4REZA 2KN4A 4MI7A 4RFBA 2ICIA 3SAUA 4S12A 2FNAA 1S3SA 3DA1A 3W31A 4L78A 3NZ3A 4GITA 2CHGA 2EELA 2M19A 3IT6B 4IBBA 2BW2A 2KDMA 1I7HA 3HU1A 1YQ4B 1Z5BA 4Z6YA 3VFDA 1C1KA 3SC3A 4DV6M 1QF6A 3CF0A 2C98A 2FOIC 1ACCA 2CJOA 3GB1A 4DV2M 1MX0A 4RNAA 4QHTA 1JQJC 2ONQA 3L4PA 1WXQA 2NQ8C 4NXNM 4LY6A 3J27B 3U6CA 2R61A 3IAM1 1G41A 3KP1E 4NSOB 2J4XA 2WLBA 3HJQA 1HA5A 2JSVX 2FBWB 1XCTL 3W9CB 1N5WA 2LMCA 1NEKB 4UDUC 4KGTA 3MC0B 3FILB 5EJCA 1ZE3D 4GMQA 4NAWB 3A45A 1VZ8A 2NTSA 4JV5M 3V3XA 2AGAA 5FK9C 2WNMA 1KSFX 2DBYA 2OQ4A 2QP9X 2DYOA 4P16A 3AE1B 3WHLA 2JZPA 1Z5AA 2LNHC 1R6BX 1E9SA 1FCCC 1JRPA 3PXGA 4RKXA 4KODA 3E9SA 2X38A 3FUXA 4MGYE 1Y56A 3URYA 3KS4A 3Q8BA 1XHBA 2GI9A 1DGHA 4GC5A 1IY0A 3N9YC 1NY5A 3GLHB 1QT9A 4RGTA 5EP2A 4J3OD 1DOYA 1F2RI 2D7EA 3VR9B 3K1JA 3AE6B 3GPUA 1KRHA 1IGDA 5EP1A 3ETRA 3TL4X 1ENFA 2KRKA 3FUTA 1C76A 2RKOA 3GQ4A 3FTEA 4I8OA 2WU2B 5E26A 2JYEA 2TSSA 3P4SB 1D5ZC 4NOOB 4W5WA 3HVDA 4Q2JA 2PIAA 2F5QA 3SBJA 3TPZA 5KQ8A 4CISA 1XLOA 3BBAA 1VR9A 1IN7A 3D8LA 3T15A 3J80S 3FUWA 2CE7A 2X4AA 3W0FA 2BJVA 3KWLA 4HROA 1YE9A 3VRAB 2XGNA 3SFZA 1ZQ9A 2WXHA 1EWYC 4JWSC 1FRRA 2DWLA 3R8FA 3U6LA 4YXDB 2KRUA 1IGCA 3OWEB 2ZM6M 4IBKA 4KX6B 3U6SA 4LF6M 4OX9M 5ITXE 1P7EA 4M9SA 3GPXA 4JN6A 4MH0E 4LGYA 4ZHPA 1G59A 3ABVB 1JWAD 3CF2A 1KLUD 3ZYYX 5MPOA 1Q39A 1JCKB 5ITXA 1I94M 3RFZB 4DV5M 2SAKA 4PDIA 5IREB 2YEPF 2YR0A 3CWIA 1ESFA 2LUMA 1HQRD 3KS8A 5ITQA 2UXBM 4DR5M 2QZ4A 4LF5M 2WXKA 3LVWA 3B9PA 2D7GA 5FTKA 5FLXS 3PVSA 3RPFC 3EA6A 3IG8A 3C0RA 5HG2A 1HQCA 4ZPXA 3WCQA 3HU3A 5BMGA 4IKGA 4CGYB 3AE2B 2XFTA 1LV7A 4B7FA 3MJ5A 2C9CA 4JX1C 2H88B 2QCUA 2JTCA 2BTEA 2R45A 2PW9A 2V3NA 1FIQA 3SFDB 3KXEC 1IY1A 4HKQA 1YJIA 2J7QA 1KF6B 5HFYA 7CATA 4OZCA 3AB5A 3U5ZA 3THGA 2CHQA 2KEBA 2Y5PA 3LQQA 3TEZA 1L8QA 3Q8EA 3HHZA 5TSSA 2WQYB 3VLFB 4X62M 3TWMA 3LVVA 1N62A 4AQYM 2ZW0A 2KA6B 2INNE 3AE9B 2EUCA 4FWGA 1IN8A 4ITKA 2UUBM 3GRUA 2N0SB 3UK6A 4YY3M 5H92C 4NAMA 1Q3BA 1MHHE 2OEDA 5ITTA 3OQCA 3SASA 4FVMA 3W30A 1YUBA 4L16A 4RF1A 1GKIA 3NBIA 4DV4M 1UUPA 4RGNA 4DQOC 4JWUC 1NVMA 5JI3E 3ZCBB 1I4XA 2P5TA 4B08A 3P42A 2I2YA 3TWLA 3MK6A 4LRTA 1PGAA 4IBJA 4WIPA 3AM9A 4B3SM 1B9RA 2WXFA 4AG5A 4XGIA 4MM3B 1RM6C 3AEDB 4LFAM 1IBXB 1VJKA 3BVMA 4LJ9A 4FW9A 5KQDA 1AW7A 2R4EA 3GRYA 4XDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KO3 A;  4R3D A;  4RNA A;  4M0W A;  2FE8 A;  3E9S A;  5E6J A;  4RF1 A;  3MP2 A;  4RF0 A;  4MM3 B;  4REZ A;  3MJ5 A;  4P16 A;  4OW0 A;  4OVZ A;  4PT5 A;  4OVZ B;  4WUR A; 
#chains in the Genus database with same CATH topology
 1VLB A;  1CQV A;  1IN6 A;  1KJT A;  5LMN M;  3LXF A;  3GLI A;  2KJ6 A;  5BYQ A;  2PPH A;  1MIR A;  1DF0 A;  5BMH A;  4NRV A;  3SYL A;  3W68 A;  1D2N A;  4ZOH C;  3V61 A;  4ITQ A;  4W9F A;  2KMC A;  2AQ3 B;  1EU3 A;  4NY0 A;  3A9K A;  1VDD A;  2PJH A;  1VRA B;  2WDR B;  3H1U A;  1V1O A;  3BC3 A;  4FJY A;  3NRZ A;  2EA0 A;  3SAR A;  4Y28 F;  4URK A;  2DZL A;  4XDC A;  1RRB A;  2W82 A;  4II7 A;  3K8Z A;  1KHP A;  1SXJ D;  5FTM A;  2KNV A;  4ZRQ A;  3SHG B;  4NSR A;  3GP1 A;  3EGR A;  3RZW C;  4CQN A;  3FD9 A;  2R46 A;  1CMX B;  1UBQ A;  1AU2 A;  3LQR A;  5EQT A;  4AI6 A;  2Y0Q A;  1IXS A;  3PDF A;  3J9C A;  3RNB C;  3U4E G;  2EO2 A;  2XU4 A;  2KWV B;  3SU8 X;  1JRO A;  2IY1 B;  1Z2M A;  1NNJ A;  4C4V A;  5EE9 A;  3ML9 A;  3B21 A;  3BVZ A;  2HJ8 A;  1E32 A;  2JWZ A;  3GLG B;  5AUI A;  1GAB A;  4KZC A;  2JY8 A;  3PO0 A;  1P3Q Q;  2GBJ A;  2KD0 A;  4X6H A;  4LFC M;  1DOX A;  1WMH A;  1GJZ A;  2KZS A;  2L0T A;  1TH2 A;  1IN5 A;  4EE2 A;  5EF4 A;  4NNJ B;  1WX8 A;  3VKH A;  1PCI A;  3AOE C;  4IJF A;  2MW5 A;  4D8B A;  3T1Y M;  3D6S A;  2DVW B;  2G3Q A;  1XXH B;  3KOZ E;  1RFK A;  5EGW A;  4BAX A;  1IBM M;  1PJI A;  3KX1 A;  1Q1O A;  2UXC M;  2FRQ A;  1AIP C;  1F77 A;  2RD0 A;  4X64 M;  2KHH A;  1AYU A;  1BXT A;  3ZRF A;  4CIZ A;  2G9H D;  3CF6 E;  3ZVV A;  4KIK B;  3BVG A;  4X65 M;  4DR6 M;  3PHW A;  1AIM A;  1T0R C;  5GMV A;  3I4V A;  2VDB B;  2LVQ D;  1L2N A;  4M00 A;  4I6L B;  2YLM A;  2FUD A;  1QOF A;  2MRO B;  4DXG A;  3M63 B;  2O6X A;  2NPT B;  2KQS A;  3DWM A;  1PGY A;  3HWS A;  4HK2 A;  4OW0 A;  1DGJ A;  2M1M A;  2Y5B A;  2B1M A;  2IPK D;  1GNU A;  2LAS A;  3KYD D;  4QRX A;  5C1B A;  4IIW A;  1ICF A;  2L4E A;  1WJU A;  3HZJ A;  3PSE B;  2R0I A;  1SE4 A;  1UD7 A;  3U2S C;  2ZBK B;  2K1F A;  3AOG A;  3OJ3 A;  1MI0 A;  3Q3M C;  4L2Y A;  1TJE A;  1AU0 A;  3IFW B;  3BPM A;  3KOW E;  3RGS A;  1PPP A;  1XCQ L;  2KTR B;  1VJV A;  2EMS A;  2KWC A;  2KXJ A;  3IBE A;  2KLG A;  4LJ5 A;  2K0B X;  5JXV A;  3T8M A;  2B1N A;  5CHV A;  2I7P A;  2JU6 X;  4P1C C;  3BYT B;  4PS8 A;  1PYW D;  3RNF C;  5G5G A;  4OEL A;  4II3 B;  4XYC A;  5FPW A;  2MGW A;  4GOC A;  2X8A A;  1NVI D;  3FIL A;  1I42 A;  1E9R A;  3U6P A;  2JYT A;  2EKE C;  4EZJ A;  2Y3A A;  2PE6 B;  3QK0 A;  4DHZ E;  1NQC A;  3AUL A;  1YVB A;  3EC8 A;  4OU7 A;  1WE7 A;  2J52 A;  4NAW A;  4DR2 M;  4BBN F;  4IUM A;  3GLF B;  4D8E A;  4MEL A;  2A5U A;  4AXL A;  3AEA B;  4CHT B;  3NG0 A;  2YJB A;  2Z84 A;  3N3K A;  1IM2 A;  3FTC A;  2KHW B;  3H8H A;  3N20 C;  2DNA A;  2AU1 A;  3GPY A;  2ZJD A;  1XMQ M;  2O2V A;  4N9F 4;  1R2Y A;  3W5U B;  1TBE A;  2K6D B;  3P4R B;  1QAO A;  1E7P B;  4EZL A;  2CV0 A;  1TDZ A;  5D2M B;  4X66 M;  2RRU A;  1XLQ A;  1HQY E;  2RMM A;  3IG3 A;  1G3I A;  3Q3O C;  5BPV A;  5CHV C;  3SEB A;  3W1S A;  2C9W B;  2LI5 A;  1C77 A;  4HPP A;  4BKG A;  4DV7 M;  3VH4 B;  4MDK E;  3GLH E;  3AMZ A;  2IBI A;  3JYU A;  2FRA A;  4KHP M;  2ZPY A;  3KYC D;  4LGM A;  1Y8R C;  1NDD A;  2K39 A;  2L05 A;  1G6J A;  1PXV A;  2PRE A;  4FCW A;  1V5O A;  2JX5 A;  3MTN A;  1CPJ A;  5IN7 A;  1TH3 A;  4FCV A;  1L2D A;  2OO9 A;  5FTL A;  2DAM A;  4ZRI A;  2DZM A;  1I35 A;  4YYW A;  4AKH A;  2E6X A;  4BOU A;  3GLH A;  3VQI A;  5J2R A;  1TLO A;  2ZAN A;  3PRZ A;  4X6J A;  2L7H A;  2FS1 A;  2DZO B;  2E00 A;  3ZTC A;  2MBO A;  4DR4 M;  4MJS B;  4YSZ B;  4DDG D;  2DOS A;  4I07 A;  1S3S G;  2O6V A;  3OTO M;  4D2K A;  3QAU A;  3W2D A;  3U8Z A;  3B2F A;  4EKU A;  2ZZP B;  1XF5 L;  1A5T A;  2VQE M;  3SMS A;  1Q02 A;  1PPO A;  4RY2 A;  3PNV A;  2MP2 A;  3HKP A;  4ICU A;  3H8B A;  3UF8 A;  3I4Y A;  2VQF M;  3NVV A;  2ARY A;  1Y4H A;  2NQD B;  2OUL A;  2JY5 A;  1G8P A;  2V6Z M;  3PRP B;  4RGO S;  3APF A;  3ZUN A;  5KHQ A;  3PW3 A;  1SE2 A;  2C60 A;  1N5X A;  3MTV A;  2L2D A;  1F29 A;  4JI1 M;  1GOZ A;  5E6P A;  5EP4 A;  2IGH A;  4KSL C;  2QJL A;  4NRW A;  4B7H A;  3C9E A;  2HH5 A;  2VZK D;  2ZEQ A;  4WA6 A;  3WHK A;  5IWA M;  5T8I A;  2E01 A;  3RVX A;  1JWS D;  1OIP A;  3UGJ A;  1TS4 A;  1EU4 A;  1SG9 A;  2YJ9 A;  3DBL I;  2BF8 B;  5DPT A;  1VDL A;  2DYM A;  2R2Q A;  4DHJ B;  4EIW A;  3L17 A;  4NJ7 A;  4DUZ M;  4BSQ A;  2LXE A;  1CTE A;  1I4G A;  1SXJ C;  3QAR A;  2GMI C;  4K7U A;  3M0E A;  3RNE C;  2Y0T A;  5DNY A;  4YTP B;  5F02 A;  3AL0 C;  2DCC A;  4XZ4 A;  3AEB B;  1ME4 A;  1AN8 A;  3CSF A;  2CU3 A;  1C9F A;  5IKC M;  4ZUX U;  3PFI A;  1P1A A;  1XNQ M;  2JVC A;  2RGF A;  4KGS A;  4MGK E;  1K8R B;  3ALB A;  2IGD A;  4W9L A;  3Q14 C;  3J2P B;  1YN4 A;  5C3J B;  3HX3 A;  4FHK A;  2C9O A;  1D0M A;  1EWC A;  1ZDV A;  5EP3 A;  3E56 A;  1R5L A;  3ZJV A;  1WJ4 A;  3AH7 A;  1Z5S B;  3KW9 A;  4MZO A;  3RVW A;  4MGH A;  4IBG A;  3RFW A;  2AL6 A;  2HJ1 A;  1LXD A;  2FE8 A;  4ANW A;  2C5R A;  1BY8 A;  3HHY A;  3AKZ A;  1TGU A;  3I51 A;  1L0V B;  4BBA A;  3FYC A;  5LXH A;  2M17 A;  3PTF C;  3U60 B;  2OHF A;  4G4O A;  4DDI D;  2XSZ A;  1YSY A;  3DOA A;  2NVU I;  2R9N A;  2BB5 A;  2XU3 A;  2KW0 A;  5KPT A;  1FD6 A;  1GJS A;  3PT2 A;  2QPA A;  2WXO A;  3JR5 A;  3F92 A;  1EWO A;  3BIN A;  2G1E A;  3C58 A;  4IM2 A;  1DOI A;  2ZVN A;  1V5T A;  5FR3 A;  2J7N A;  1WE6 A;  1B1Z A;  5JHA A;  1NYQ A;  2LWP A;  3Q8G A;  1MEG A;  3KSX A;  1FRD A;  2PAD A;  1J7B A;  3AI8 A;  1YX6 B;  1X37 A;  3TUO A;  2YQZ A;  3I04 M;  2MCN B;  2J5Y A;  4OVZ A;  3SAW A;  2Z3X A;  5JH5 C;  1I4W A;  1J09 A;  1KYI A;  1DGB A;  3GE3 C;  1QZM A;  3T6P A;  4ZRK A;  1SP4 B;  4FXC A;  4JXJ A;  3HRD D;  2AYO B;  4BB9 A;  4N6E B;  3B0A A;  1KH0 A;  2VH1 A;  4D81 A;  2D3G A;  4M0W A;  4WQM A;  3TJP A;  2Y6E A;  2JP7 A;  2HD5 B;  2QSF X;  5CHT A;  3RNA C;  1NYR A;  1AWD A;  1SXJ B;  3E4R A;  3W0L B;  2JXN A;  1QUT A;  4LJ4 A;  1ZXI A;  1HJP A;  3AE5 B;  2Z8Y M;  5HI1 A;  2DCB A;  2DEN A;  1PRB A;  1HR0 M;  1L4Z B;  1ZIV A;  2QIL A;  5A2Q S;  3TIX A;  4EEW A;  1L0X B;  3PNR A;  1N77 A;  4G4Q A;  3AE7 B;  3ZNI D;  2DJF B;  1STF E;  4BOS A;  4ZRJ A;  2K9D A;  4GUA A;  1EE8 A;  5C23 A;  1QYR A;  4HEA 1;  1GMY A;  3U30 A;  2R62 A;  3IXS A;  5DPS A;  3TMP B;  1NY6 A;  4KLB A;  1L5P A;  4YYQ A;  4A8X C;  2QHO A;  3D32 A;  4PI3 A;  4NC6 A;  3GZN B;  1SJH D;  3EFU A;  4HWY A;  4KO8 A;  3Q8X A;  2L83 A;  4RCO A;  4TMA B;  2J0M A;  3DBR B;  3IV2 A;  2FO5 A;  1TYG B;  2KAJ A;  1IXZ A;  3TQS A;  1YT7 A;  2AWT A;  3H7P A;  4LNO A;  4W5C A;  1M94 A;  4XE0 A;  3UQB A;  2V4I B;  5EE0 A;  4PCZ A;  1N78 A;  2PNS A;  1KLV A;  3QA8 A;  2MEK A;  4LJ6 A;  1T43 A;  3BWK A;  1TZO A;  4W9C A;  5EDS A;  1CUK A;  4M9X A;  5JZE B;  3BYY B;  2DZJ A;  3N30 A;  3RVV A;  4BOS C;  3TNX A;  1K3B B;  1VQ1 A;  1XXG A;  2ZW1 A;  3R7R A;  1VZ6 A;  4G3O A;  3AV0 A;  4F1S A;  1HTQ A;  3GPP A;  1Q0W B;  4FD2 A;  4PT5 A;  2EMT A;  1N33 M;  4B6W A;  2ZCC A;  1N32 M;  3DBS A;  4EOY A;  1IBL M;  3PZ7 A;  4IG7 B;  3J7A S;  3BY4 A;  3VR8 B;  2CP8 A;  3I01 M;  5KO3 A;  2L6O A;  1ZP0 B;  2DZI A;  1XWI A;  4P1B C;  2VH2 A;  2JZ1 A;  4AZF A;  2Q2E B;  1K50 A;  3P5W A;  4L4U A;  4AOF A;  2ZTC A;  1V1P B;  1E7U A;  1XC8 A;  3BOW A;  3DBH I;  4KT0 F;  2N1V A;  4MM3 A;  1MJG M;  3MP2 A;  4E74 A;  3RN9 C;  1FFV A;  2LBC A;  3VK8 A;  1ZMU A;  3GRV A;  1UZX B;  2M5Z A;  2KMM A;  2JXT A;  3IEJ A;  4II2 B;  1IBX A;  1BGO A;  5C18 A;  5BYR A;  1WJ6 A;  2JT4 B;  2F5O A;  3LYY A;  4OHJ A;  3S3R A;  6PAD A;  1FNN A;  1J8C A;  1SIJ A;  1F1H A;  2CEA A;  1K82 A;  1NB3 A;  2YEP B;  1NV8 A;  3OIS A;  4L23 A;  2M0A A;  1UKF A;  1E8X A;  1E6E B;  1D6E C;  2UXD M;  2DI0 A;  1E94 E;  1OQR A;  1Q10 A;  1BP4 A;  1CVZ A;  1D5X C;  2KDB A;  2N9E B;  4ARC A;  1UH6 A;  2BTW B;  2KXE A;  1TKY A;  2BYV E;  1NPZ A;  4NQK E;  4KZ0 A;  1K53 A;  2BBC A;  1WYG A;  2L3Z A;  3ZRC A;  1RAX A;  4GDK A;  4QH6 A;  1DO2 A;  3Q8F A;  2CHW A;  2ZNV C;  1QQW A;  4OEM A;  4YYU A;  4K7W A;  4JI2 M;  4PYU A;  3EHV A;  4BQV A;  3H9D A;  4B3R M;  2M56 B;  3V76 A;  1F2A A;  1A5R A;  5FSW A;  2J7O A;  1LTM A;  3SHQ A;  5LMU M;  2D2Q A;  1TF0 B;  3O65 B;  3VK7 A;  4I05 A;  3DZD A;  4IDI A;  3GLG E;  3AE8 B;  4DXF A;  1POP A;  2LVP A;  3QC8 B;  1HT2 E;  4HPL B;  1XKG A;  1E5W A;  2F5S A;  4XWW A;  1T3T A;  1QOL A;  4E71 A;  5CVM A;  4HKZ E;  3GLG A;  2IJ0 A;  4NXM M;  4KLN A;  1F4I A;  1MHW A;  3UZU A;  2H89 B;  3AU5 A;  1NL6 A;  4GH9 A;  1XT9 B;  4K7C A;  1XXH E;  1MJD A;  2RSU A;  1DGF A;  2N9L A;  2FCQ A;  4G6Z A;  2FIF A;  3IVF A;  2HL7 A;  4YT0 B;  1XEE A;  4XK8 F;  1SBB B;  1PPD A;  3PPA A;  3DFZ A;  3KVW A;  4BKS D;  4GKJ M;  3NZS A;  1XXH A;  2K9X A;  1R7S A;  2QEN A;  5DYI A;  1L1T A;  3VUW A;  2EJS A;  1TDH A;  2LVP C;  2L09 A;  4R7G A;  4IM0 A;  1N60 A;  1PPN A;  1QUS A;  1CJL A;  3OVX A;  3P4P B;  3OVZ A;  4KIK A;  5EZS A;  1PM5 A;  2WS3 B;  2JRI B;  1F52 A;  1D0K A;  5G55 A;  2PMV A;  4BOZ B;  1LQB A;  2AX5 A;  4O1N A;  2IDY A;  3VAW A;  4WWM A;  2VHF A;  5AUK A;  4M02 A;  3WAL A;  3KQ4 A;  5J18 A;  1V34 A;  3H4M A;  1QAN A;  1EFU B;  5EXT A;  2NPT A;  3MHV C;  2YVC A;  3DHI C;  3MFG A;  5J94 A;  1D0L A;  3U61 B;  4X57 B;  1QDQ A;  3SMP A;  4P17 A;  2XLJ A;  3C8Y A;  4GSW A;  2VZK B;  4JYA M;  4F8C B;  2NQG A;  1CZP A;  4Q7J A;  1OFI A;  5E6O A;  2L52 A;  2L8J A;  2E5L M;  3DDC B;  3PSE A;  2ZNV B;  1STE A;  2W3S A;  2F7D A;  4ANX A;  3DVN V;  2WP9 B;  4MH8 A;  2LHC A;  1UGM A;  3ZNG C;  1JWM D;  1OJL A;  2KTR A;  3O0U A;  1JML A;  3P1M A;  3KW6 A;  1W5T A;  5H37 D;  3RI7 C;  1WHC A;  4GLS C;  4QBB A;  1F2R C;  4B7G A;  4B95 A;  3DBL B;  1N34 M;  5BMI A;  2ZTD A;  4M9Z A;  4B3T M;  3RGP A;  4CDE B;  3HD3 A;  4WWO A;  3GLF E;  3U6M A;  3ZLZ A;  3B9J A;  2CWB A;  3RE8 A;  2CV1 A;  4B3M M;  1H4R A;  1GJT A;  1QLB B;  3TBL D;  2LXA A;  1NNU C;  1RFA A;  3NS1 A;  2BWF A;  4PP1 A;  4W9J A;  4A20 A;  3GLF A;  5E6J A;  1I4Q A;  3RUL A;  1WR6 E;  2K6Q A;  1GLN A;  1JQP A;  5EE3 A;  4PDG A;  4GRI A;  1L2C A;  1D3Z A;  3ZQJ A;  2RDB C;  3ENE A;  4A6Q A;  1VZ7 A;  4JGH B;  2LUE A;  1MDW A;  5EZQ A;  1OQQ A;  3WAM A;  3A33 B;  3ILK A;  2LRW A;  1K52 A;  2GQF A;  3FRH A;  3AOE A;  1D4B A;  3UQA A;  4LF9 M;  4AKG A;  2D3A A;  3HHA A;  2K3U A;  4LG2 A;  1TTE A;  4LNN A;  1R4M I;  3L10 B;  3AE4 B;  3BK2 A;  4S0R A;  1U9W A;  3BCN A;  1T3Q A;  4YTN B;  3M6A A;  1GG3 A;  2JZZ A;  3IHP C;  2YJC A;  1NEN B;  4WJQ A;  2PEA A;  1JWU D;  2VRR B;  3I3T B;  2DWN A;  4MZS A;  5KPR A;  2XU1 A;  3NBX X;  3C9P A;  3NS8 A;  1XLN A;  2RR9 A;  4JPS A;  3LXS A;  4BOQ A;  3ZIM A;  1L6V A;  1TL9 A;  1Q5W B;  2NS5 A;  4Q8H A;  2AQ2 B;  2KC2 A;  4BBN C;  4MSX A;  2DAF A;  3Q8C A;  2MJD A;  4HCN B;  4MJS A;  1IWD A;  2BS3 B;  3W5V B;  4RKU F;  4D82 A;  3EIH A;  4DR3 M;  5C1Z A;  3JR4 A;  3R9X B;  1JAL A;  4WW0 A;  3A4S C;  1GEC E;  4M0D A;  1WGN A;  3HU2 A;  2Y20 A;  1UM8 A;  3A98 B;  2FCS A;  3B1L X;  2DZN B;  1QZE A;  2V3P A;  1W5S A;  3MC9 A;  2FNJ B;  2HHN A;  4JI3 M;  1R7R A;  3VTW A;  1V92 A;  1T5X D;  1KFV A;  3SR6 A;  2N9K A;  4I81 A;  4AJW A;  2C99 A;  1WZ3 A;  2D11 A;  4HVB A;  4Z8X A;  3PRP A;  4WUR A;  1R2Z A;  1ZPS A;  1G4A E;  2IPP B;  3CTW B;  4PS3 A;  2W9N A;  1OTR B;  4NJC A;  4P6V F;  3SAV A;  3MC8 A;  2KX0 A;  4IM3 A;  4CZW A;  1WFY A;  2WXJ A;  1ZV1 A;  2CU1 A;  3BB7 A;  3ZC7 B;  4HDO A;  2LFI A;  4IBC A;  2KFK B;  2G8E A;  3DCG A;  2XN9 C;  5IT9 S;  4P6E A;  1XMO M;  4ASW C;  4KKJ A;  3T9L A;  3JAM S;  2V4L A;  4GIP A;  1EWL A;  1FXA A;  1MHX A;  3P5V A;  2DYB A;  4LF4 M;  3RMK C;  1XLP A;  4A3O A;  1H6U A;  5D6J B;  3DVG X;  2IO3 B;  3H4J A;  5LLI A;  3Q2A C;  1WWT A;  1NI3 A;  1I4R A;  3NWL A;  4AJY B;  1IP9 A;  2GLS A;  1ISN A;  3H6S A;  3R2T A;  2MLB A;  3SFE B;  1UNS A;  3B7Q A;  1KFX L;  2HWK A;  3K9O B;  3T1H M;  5C2T B;  3KWZ A;  1PFD A;  4K3C A;  4JI0 M;  4XX5 A;  2G7Y A;  5FTJ A;  1NSF A;  2KJR A;  1WXA A;  3B2G A;  4AS1 A;  3RYT A;  3QWL A;  3PVL A;  2KQ4 X;  1JW9 D;  2VHS A;  2BS4 B;  4BLC A;  3DHG C;  3MHH A;  2LVO C;  1SB3 C;  4KKI A;  2BQQ A;  2L0F A;  4FCT A;  4M01 A;  1IBK M;  1A70 A;  2E02 A;  2VF7 A;  1J7A A;  4US8 A;  2BVC A;  2MH7 A;  3R66 C;  2DAK A;  2R9C A;  4G0N B;  1THE A;  3HUI A;  1UWX A;  5IZ7 D;  3FUV A;  2WHI A;  4ACF A;  2DZZ A;  2HE7 A;  3SHF A;  2WSE F;  1ZUD 2;  4YYR A;  3NHE B;  4NZL B;  1RWS A;  2DXI A;  1E9M A;  4K0K M;  1M4V A;  2AL3 A;  1IUE A;  4A9A A;  1ZKH A;  1LGR A;  3S3Q A;  3QHT A;  2DAG A;  3KDS E;  2JY6 B;  2KDF B;  1WH3 A;  1Z6T A;  1FMA D;  1BUI C;  2DHR A;  4A55 A;  1K3X A;  3TEY A;  3SYK A;  4HJG E;  3AEE B;  2ACT A;  3FYD A;  1HXY D;  3IUT A;  5H8Y E;  2BKF A;  4MGZ E;  4BOP A;  2O01 F;  2XBB C;  3DBH B;  1MVK A;  3K9M A;  3W67 A;  2IGG A;  1M6D A;  3FKE A;  4AUQ C;  5D3I B;  1QKZ A;  3PZD A;  1F0Z A;  4GIV A;  4HXD B;  3AEF B;  5JHB A;  1DKI A;  3UMM A;  1N61 A;  1HT1 E;  1SXJ E;  1DGG A;  1T0S C;  4N58 A;  2BU3 A;  2AYO A;  4JL9 A;  5CHF A;  1OFH A;  3KSJ A;  2PBH A;  4BKT A;  4KGR A;  3BOS A;  3K2L A;  1FFU A;  2R18 A;  1C79 A;  3GOE A;  4BFR A;  2HD5 A;  3AN1 A;  2XFS A;  4GHL A;  2D07 B;  2LHD A;  3P63 A;  3I5J C;  1E10 A;  2A4Z A;  2G45 B;  1SXJ A;  2KZU A;  2LVN C;  3PLV A;  1JR3 E;  3HY5 A;  2K0P A;  3KWV A;  3WAO A;  2QMT A;  1T0Q C;  4HPM B;  1C4P A;  4PAD A;  3LFY A;  1YN5 A;  1D5M C;  2MRP A;  3R8B A;  3U6Q A;  2BNK A;  1XB2 B;  2KN5 A;  1JR3 A;  2D10 A;  2A5Y B;  2XF3 A;  4EUT A;  3B89 A;  1XO3 A;  3VUY A;  2GFO A;  1EM7 A;  1LFD A;  2Z8L A;  5IAA C;  1QQR A;  1AEC A;  3TMP A;  2Y5C A;  3PZ8 A;  2FFJ A;  3MHS D;  4LTU A;  2HTM E;  3UJN A;  2WYQ A;  1C4C A;  3KFU G;  1V49 A;  3B7N A;  2IND C;  2WXR A;  2CV2 A;  1KFU L;  1DV0 A;  3RD2 A;  4G50 A;  5DPR A;  4I4L A;  2X49 A;  4L15 A;  3VDU A;  1C7Y A;  3HHM A;  4WH4 A;  2DKL A;  4C56 C;  4YVA A;  2N7J A;  3Q3J A;  5AZG A;  2B3A A;  3O13 A;  4H2A A;  2F5N A;  2HTH A;  4BS5 A;  4GEW A;  3ECI A;  2GBR A;  3ZNZ B;  4W9D A;  2DCD A;  2DHZ A;  1OEY J;  4IBD A;  3DVG Y;  1AYW A;  1MU5 A;  3NVZ A;  2RPQ A;  1S1Q B;  2LHE A;  3TEX A;  3PRM B;  3R2I A;  3ZQ4 A;  2R4J A;  3EUB 2;  4GGQ A;  4I6N B;  1FCL A;  3GQ3 A;  3GCB A;  5JZE A;  2EKF A;  3LCV B;  5F3W A;  2NQI A;  1TTN A;  1VSN A;  3TEW A;  2MHJ A;  1TKE A;  2G8L A;  3DPD A;  1KM7 A;  1WSP A;  3A1Q B;  1V8C A;  1ZOY B;  2VII A;  4AG6 A;  4I5S A;  3IT4 B;  4TUU A;  2D3B A;  1QAM A;  2HKJ A;  1NLJ A;  2LVQ A;  4WP2 A;  2WDQ B;  1IXR C;  3ZDM C;  1WRD B;  2AIM A;  1C1Y B;  3R3M A;  1QOB A;  3L27 A;  1R4G A;  2QQ8 A;  4IBI A;  3D8B A;  3DVN U;  4FJZ A;  3CH2 X;  4B0M A;  3V6E B;  1BQI A;  3GRR A;  4W9H A;  1V1P A;  1UFZ A;  2ZCB A;  3ZW3 A;  2WX1 A;  4N59 A;  3DHH C;  4GC9 A;  1P9D U;  3BZD B;  1GLO A;  1EF7 A;  5E6N A;  2DWM A;  5LNK 1;  1E0Z A;  4GB9 A;  3IEC A;  2WXL A;  2L4F A;  3U7Z A;  1I4P A;  2Z4S A;  4JI5 M;  2W3R A;  3APD A;  3KW5 B;  4YYS A;  1BVS A;  4HLQ A;  5AEK B;  1SXT A;  4IBE A;  2RPV A;  2AYN A;  2INP E;  3P4Q B;  2UU7 A;  4CDF B;  3WAN A;  3ZKJ C;  2KDI A;  2QBY B;  2GB1 A;  1TS3 A;  2BTW A;  3P2B A;  2VF8 A;  1V2Y A;  3VRB B;  4IJE A;  1SSN A;  3A4R A;  3GS2 A;  1EWM A;  3Q8A A;  1VEG A;  2V1U A;  4QHS A;  4HWI B;  4WAF A;  3K9P B;  4C7Y A;  5BYS A;  2F5P A;  1C78 A;  4HEO A;  5ITY A;  2C7H A;  2K5P A;  2LXC A;  3IOQ A;  4LFB M;  4ZHO A;  2PLP A;  1WGR A;  4M8M A;  1EUV B;  3V60 A;  1AAR A;  3FAH A;  4QRG A;  2N4F A;  3U6E A;  4M8N A;  3L26 A;  3IFU A;  3O65 A;  2N9X A;  2KAC A;  3LMM A;  3KKU A;  1RU3 A;  1T6B X;  2OJR A;  1GCB A;  2ON8 A;  4JE3 B;  4KDI C;  4J6I A;  4HL4 A;  1I4H A;  2MBH A;  5GXG B;  2DZK A;  1OEY A;  3OG5 A;  1MPE A;  1R4N I;  3TE6 A;  3USV A;  1TY2 A;  3SAT A;  2KT7 A;  3IAS 1;  4ZYS A;  3PNY A;  2KFJ A;  2CKH B;  4RM8 A;  3A9J B;  2FCN A;  2WXQ A;  8CAT A;  4PP2 E;  1BML C;  1FO4 A;  1ORY B;  2LH0 A;  3J81 S;  1IY2 A;  1SE9 A;  2AEH A;  1TGZ B;  3KFQ A;  3ZNH B;  1FNU A;  3WXG A;  2KDE B;  4US9 A;  2NCN A;  4YWG G;  3PHX B;  3APC A;  1R4M B;  2FH0 A;  3VFK A;  3VUX A;  2PVG C;  5IP4 D;  4AQ7 A;  2B76 B;  2MJ5 B;  3AFH A;  3HGI A;  1Q3C A;  4AKI A;  4L1B A;  3Q6B A;  4P7I A;  1DEU A;  4LRS A;  1ZCM A;  2CHX A;  4LK0 M;  3HWN A;  4HLE A;  5J17 A;  4BZA A;  1PJT A;  2ZVO A;  2K47 A;  2UUC M;  1ZAE A;  1V81 A;  2KYW A;  1FXI A;  4OZA A;  1CS8 A;  1KLG D;  4I04 A;  2XEW A;  2JRI A;  1VG5 A;  4DK5 A;  4K7S A;  4KDL B;  2YJ8 A;  2FUH B;  4BOZ A;  3HVZ A;  1QAQ A;  1V33 A;  1J0G A;  3E46 A;  4IWP A;  2YNM D;  1AU3 A;  2FUG 1;  2K22 A;  2APL A;  2MJE A;  1YK7 A;  1OKS A;  2JY7 A;  4WJO A;  1L4D B;  3L29 A;  4YSX B;  4ZRP A;  4OVV A;  2W55 A;  1YZB A;  3U61 A;  1SE3 A;  1KHQ A;  3DQV A;  1AUA A;  3U6O A;  2WDV B;  4FK5 A;  2BYE A;  2CB5 A;  4N8W A;  5L8R F;  4CO7 A;  4LJ8 A;  3RUI B;  1GL7 A;  2LJI A;  3ZTD A;  2BJW A;  1VEK A;  2BT6 A;  1TIF A;  3MP9 A;  5GKN A;  1K51 A;  4LLG M;  2G4D B;  1SJE D;  1T6O A;  2HWJ A;  2KC1 A;  4QOS A;  5ITR A;  3BXW A;  5FR6 A;  3FKY A;  4QOZ C;  4YHH M;  3KVF B;  4KSK C;  1QDT A;  2JPH A;  3HM6 X;  5IO9 A;  5EXP A;  1EWP A;  1WRI A;  2M8S A;  3TWK A;  1V80 A;  3IMA A;  4FWD A;  2R65 A;  4TUW A;  1WIV A;  3MMP A;  1ET9 A;  2N9P C;  2ERC A;  1HZ5 A;  2RDH A;  1GB4 A;  5KPZ A;  2WXM A;  4DV1 M;  2WWZ A;  4XWT A;  4DR1 M;  1NO1 A;  1AU4 A;  4GHA A;  3IG5 A;  2QSD A;  3NOB A;  3M62 B;  4I6P A;  1DO0 A;  1OFF A;  3A46 A;  2JUJ A;  2JF5 A;  3R7Q A;  3M99 A;  4W9E A;  2D7H A;  4RH6 A;  4W5B A;  2FTD A;  3SD5 A;  2L1A A;  4F1I A;  2IYD B;  4TQ0 A;  4JI6 M;  4ZTB A;  1J7K A;  2FID A;  4WWP A;  3CBK A;  1PQS A;  1FM0 D;  3ZJT A;  3L2A A;  1L0Y B;  2XZF A;  2KNB A;  5KHO A;  5L95 C;  1GC7 A;  1U9V A;  4IP3 A;  1L2B A;  4G3X B;  4B9K A;  4RF0 A;  4AWJ A;  4MSM B;  3FC4 A;  2W54 A;  3I3T A;  1F2B A;  1PDX A;  1EF5 A;  1S4V A;  3HK0 A;  1U4A A;  3H8C A;  1DGH B;  3DOW A;  1GPX A;  3HJ8 A;  1HEZ E;  1CQD A;  4OVZ B;  3I9V 1;  4GN1 A;  1TZ1 A;  1TKG A;  2R9M A;  2KDL A;  3I06 A;  1YJJ A;  2I7N A;  4C7Z A;  4DV0 M;  4NJ6 A;  2JWU A;  1YNT E;  4RM9 A;  2XZU A;  1FNW A;  1L6U A;  3FTF A;  1IFY A;  1Y8G A;  3AEG B;  3ZJU A;  2M60 A;  1MS6 A;  2N35 A;  2JA2 A;  1Z59 A;  1N75 A;  1TY0 A;  3SDL C;  2BPS A;  1L1Z A;  4CDC B;  1YMH E;  2FCM A;  2NTT A;  3RZF A;  3HHX A;  1PBH A;  1ROE A;  1FEH A;  1OTR A;  4JI8 M;  4LJ7 A;  1YN3 A;  2V0G A;  1V97 A;  3CIR B;  1WGK A;  2QC8 A;  3ERV A;  1CJE A;  3NZU A;  2GHU A;  2BS2 B;  3E21 A;  2OPF A;  2H5X A;  4LZJ A;  2WXP A;  3KOX E;  2KFK A;  4ARI A;  3JSV B;  4XBO A;  2AHM A;  4N79 A;  5ITU A;  4LDT D;  2G5G X;  4TQ1 A;  1J5E M;  3U6D A;  4S17 A;  3VTU A;  3Q69 A;  3NY5 A;  4QNR A;  4JIO U;  1YQ3 B;  1JRU A;  3HM3 A;  1E7V A;  1GL6 A;  4TSS A;  2AUX A;  4P6G A;  3WXF A;  4AP4 C;  3F75 A;  1BT0 A;  2J7Q C;  3QX1 A;  1HTO A;  2JQG R;  3AEC B;  3L16 A;  2C96 A;  4RMA A;  1AYF A;  1VCB A;  3K9O A;  2KX3 A;  4WWN A;  3KOY E;  4K81 A;  4AW4 A;  3EIE A;  1TS5 A;  1P7F A;  3HJS A;  3T3N A;  5IOI A;  4MGI E;  1LM8 B;  3ML8 A;  2DX5 B;  4OVU A;  3FUU A;  1YD8 U;  2C5L C;  3VDP A;  2JZ3 B;  3AE3 B;  2GRI A;  2WGS A;  4W9G A;  2Y21 A;  2DWQ A;  1GVN A;  1KTK A;  1WI0 A;  4IOI E;  4D8I A;  3F5V A;  3IHP A;  4MB7 A;  2REX A;  4USA A;  2LZ6 A;  5BO4 B;  2CJN A;  2QCZ A;  3P5X A;  4JI4 M;  4LZZ A;  3CBJ A;  2LGY A;  2XEP A;  4GDL B;  2C0Y A;  3NHE A;  2DAI A;  2IO0 B;  2QIE B;  1NJG A;  3GO8 A;  4LCB A;  3LB8 C;  2KNZ A;  3OJ4 B;  4DV3 M;  3H7D A;  1ZDX A;  2JY6 A;  2NQA A;  3AJI B;  4N4Z A;  4ZYN A;  2PKO A;  2UU9 M;  4B0E A;  4DR7 M;  4G4N A;  5D94 A;  1U5I A;  4YYV A;  2N7E A;  2YFQ A;  5G5H A;  1PE6 A;  2ZAO A;  1WZ0 A;  2MX2 A;  1MFW A;  4W9K A;  3PHU A;  2UUA M;  1WGD A;  3C0R B;  4DMY A;  2WX0 A;  1QIL A;  1E8W A;  3FRI A;  3L25 A;  5EE1 A;  2BDZ A;  3NVW A;  2OOB B;  2C7N B;  4GDK B;  2P86 A;  1J7C A;  3T38 A;  4D80 A;  3L08 A;  1ET6 A;  2QEJ C;  4HXD A;  2Q5W D;  3BBZ A;  3KP0 E;  4WJN A;  2E3T A;  2XH9 A;  1LO5 D;  2Z59 B;  1CB5 A;  3TRK A;  1C4A A;  2O6V D;  3NUH B;  1HNZ M;  2XK5 B;  3UI3 A;  2NMQ A;  3Q3F A;  4FHJ A;  4LJP B;  5CX3 A;  5I4D A;  1E8Y A;  1UBI A;  4FUL A;  3RNV A;  2WXN A;  3GZN I;  1QOA A;  2KZR A;  2ZPN A;  3V6C B;  1EF1 A;  2I38 A;  1JR3 D;  1VDV A;  2C7M B;  3VKG A;  3DBR I;  4JLC A;  2J7Q B;  4NL4 H;  1WGY A;  2R44 A;  4FN2 A;  2LWX A;  2E03 A;  4UN2 B;  2V1C A;  2R9F A;  2J53 A;  4PK1 A;  1NJF A;  5EXS A;  3U5Z B;  2EKI A;  2OZ2 A;  1ZW7 A;  3A42 A;  3ZGZ A;  1WM2 A;  2CHV A;  3BWU D;  1FH0 A;  1TH4 A;  3W1Y A;  4L8R C;  3C3E A;  2HHH M;  3H89 A;  4XZX A;  1JQ4 A;  1PGX A;  2JQR B;  2JQF R;  1RYJ A;  2LVO A;  4XC2 A;  2Z7J A;  4MT5 A;  4A3V B;  1UWM A;  3QYE A;  2R6F A;  3HIZ A;  3J7B A;  2XNA C;  1KFY B;  1X9Y A;  2V3S A;  3HHW A;  2AQ1 B;  2KVZ A;  5DYG A;  1HNW M;  1R4N B;  2KNA A;  2V1Y A;  2CIO A;  4PD2 A;  2LGX A;  3U52 E;  4HCP B;  1JWB D;  1SIF A;  3AV8 A;  2IO2 B;  4ICV A;  1PGB A;  3V05 A;  4BKS A;  1ZMV A;  3CMM B;  5BR8 M;  3B74 A;  2KO3 A;  2KWD A;  2AS8 A;  1FNV A;  3FTD A;  5DPW A;  3GQ5 A;  2PTL A;  3TCA A;  3P5U A;  3PRM A;  3ZUA A;  1PUT A;  3PS6 A;  4W9I A;  3NVY A;  1TU6 A;  2MJ3 A;  3H6N A;  2EKK A;  3UGB B;  4A3P A;  2KOX A;  4NQL B;  1N36 M;  3S2A A;  2UYZ B;  4C80 A;  2K8B A;  3A1Q A;  2HCB A;  3L28 A;  2BDL A;  5JI2 E;  1WGL A;  1TR8 A;  3GP7 A;  2MR9 A;  2KQ7 A;  4FJV B;  4F7Z A;  2Z0E B;  5K16 A;  3HHI A;  3VH3 B;  4FJC A;  1NHW C;  1WX9 A;  1O0E A;  1L7Y A;  1RLF A;  2RGH A;  3V6E A;  2WU5 B;  2XSZ D;  2CHZ A;  4OZB A;  3KLS X;  2PE9 A;  2INC C;  4FWH A;  5FKA C;  4MEM A;  2BYT A;  1IQP A;  4PS7 A;  3L54 A;  2CUZ A;  1UEL A;  2DC6 A;  1J19 A;  2LGI A;  2L32 A;  2J0K A;  2O5R A;  3DWG C;  3U60 A;  2R9O A;  2CFO A;  5D3D A;  4RGM A;  1N63 A;  1QOG A;  3GE8 C;  1MG8 A;  2WZJ A;  1UGJ A;  4NPN A;  2UZJ A;  3I57 A;  3ONS A;  1XQQ A;  3WXE A;  4A5U A;  2KAN A;  1HZ6 A;  1IPG A;  1HE8 A;  4DBG B;  4WJP A;  1ZMW A;  5TR5 A;  4LF7 M;  1SF0 A;  5D7G A;  3UIO B;  4ANV A;  1WR1 B;  3PGE A;  4EZK A;  1ITO A;  2AVW A;  2L7I A;  1TS2 A;  3V62 A;  2Z4R A;  1KOT A;  1OIZ A;  2FYE A;  1YX5 B;  3KUD B;  3TSS A;  5EXX A;  4X6I A;  2QBY A;  2IY0 B;  4R3D A;  2BB6 A;  3GLI B;  4YSY B;  3T3O A;  1FJG M;  1CK1 A;  2K25 A;  4CDD B;  5JH3 A;  1FPY A;  4DMX A;  2F4V M;  2D5G A;  1HNX M;  3K9P A;  2J42 A;  1NI2 A;  1SEB D;  1GB1 A;  4XGA B;  3A9K B;  4G4R A;  4KV2 A;  2H1R A;  1K3W A;  4DXA B;  3ZH9 B;  2R2O A;  5LXI B;  3QT4 A;  5A24 A;  2SEB D;  2B3T A;  3QJZ A;  4A90 A;  3K92 A;  3VXW A;  4QNM A;  2DWZ B;  2JWS A;  1NBF C;  4MSQ B;  2LEK A;  4Q8G A;  3JVZ X;  2KLC A;  4JI7 M;  1ATK A;  1N6Z A;  2MH8 A;  1V9J A;  1UF0 A;  2Z0D B;  5IA7 A;  1ME3 A;  1XNR M;  4LJA A;  5CVN B;  1PVJ A;  4HRS A;  1IXS B;  2KWU B;  2ACZ B;  2RGO A;  4GKK M;  4G54 A;  2DAE A;  2HDE A;  5HHD G;  1X1M A;  2LD9 A;  1Z5C A;  2DLB A;  4IC7 B;  4LNF A;  1QVR A;  4ZDV A;  1GUA B;  4C4V B;  3N1Y C;  3BK1 A;  3A9J A;  3ZDT A;  4IBF A;  4LF8 M;  2GBK A;  1NV9 A;  2GBM A;  1ZXH A;  3RNC C;  1NHG C;  2MBQ A;  2WXI A;  2JNH A;  3DF0 A;  2WXG A;  2BWB A;  1PJJ A;  1DYQ A;  3ZNH A;  5DCN A;  2JXX A;  2G6D A;  5FTN A;  1FXT B;  3PHX A;  1GAQ B;  4R71 A;  4MAC A;  3K24 A;  2ZAM A;  4EFO A;  4DUY M;  1WMH B;  2RDG A;  1IN4 A;  4F2L A;  3M95 A;  2WSC F;  1OAO C;  3M7G A;  3BII D;  3MHZ A;  4YL8 A;  4YTM B;  1CV8 A;  4CJ6 A;  1CSB B;  2PVO D;  4REZ A;  1KXR A;  4PYZ A;  2KN4 A;  4MI7 A;  4RFB A;  2G3Q B;  3W1S C;  2ICI A;  3SAU A;  4S12 A;  3MOR A;  2FNA A;  3ZXV A;  1S3S A;  4FA6 A;  2GOW A;  3U8E A;  3DA1 A;  3W31 A;  3OAW A;  4L78 A;  3NZ3 A;  4GIT A;  5PAD A;  2CHG A;  2EEL A;  1OGW A;  2M19 A;  3IT6 B;  3U7D A;  4IBB A;  2BW2 A;  2KDM A;  1I7H A;  3PHW B;  2AUZ A;  3QSD A;  3HU1 A;  1YQ4 B;  1Z5B A;  3B79 A;  3TL5 A;  3ZO5 B;  4L6V 6;  4Z6Y A;  1WJN A;  3VFD A;  1C1K A;  1ZGU B;  2M0X A;  3SC3 A;  4DV6 M;  1QF6 A;  3CF0 A;  2MBE A;  4XUI A;  2Y5B B;  4QRV A;  4IWQ A;  2C98 A;  3AU4 A;  2FOI C;  1ACC A;  2CJO A;  3GB1 A;  4LDT B;  1VEJ A;  1IYF A;  2P0R A;  4DV2 M;  1MX0 A;  1PJQ A;  3K8U A;  3JW0 X;  4RNA A;  4TV3 A;  4QHT A;  3Q3N C;  1JQJ C;  2ONQ A;  2NBW B;  5CHW A;  3L4P A;  1WXQ A;  2NQ8 C;  2QNJ A;  4K1R B;  2MSE D;  4NXN M;  4LY6 A;  3J27 B;  1WF9 A;  2JUO A;  1PJS A;  3U6C A;  2R61 A;  1WXM A;  2V9H A;  4K3B A;  3IAM 1;  1G41 A;  2KMA A;  3KP1 E;  4NSO B;  2J4X A;  2P7U A;  2WLB A;  3HJQ A;  5HKH A;  1HA5 A;  2JSV X;  2FBW B;  1XCT L;  3W9C B;  1N5W A;  1HUC B;  2LMC A;  1NEK B;  4UDU C;  4KGT A;  3MC0 B;  3FIL B;  3RCZ A;  5EJC A;  1ZE3 D;  2DCA A;  4GMQ A;  3KWB X;  4NAW B;  3VHT C;  4IUM B;  3VVW B;  3A45 A;  1YLA A;  1YAL A;  1VZ8 A;  2NTS A;  4JV5 M;  1YOV B;  2R6N A;  3V3X A;  2AGA A;  5FK9 C;  2WDT B;  2WNM A;  1KSF X;  2DBY A;  2G4S A;  7PCK A;  2OQ4 A;  5DFL A;  2QP9 X;  2DYO A;  3N3K B;  4P16 A;  4DHZ B;  2LTU A;  2O25 A;  3AE1 B;  5L83 A;  4GU2 A;  4LCD E;  2O2V B;  4YV8 A;  3WHL A;  2JZP A;  2KKC A;  4G11 A;  1Z5A A;  1V86 A;  2LNH C;  1R6B X;  1E9S A;  1FCC C;  1WJ7 A;  1JRP A;  3PXG A;  4RKX A;  2LGS A;  2DHY A;  4KOD A;  2NBV B;  2MWS B;  1YJ1 A;  3E9S A;  2X38 A;  1Q6K A;  3FUX A;  4MGY E;  4HJK A;  1Y56 A;  2IBI B;  3URY A;  3KS4 A;  3Q8B A;  2X8X X;  1XHB A;  2ASQ A;  2N1W A;  2GI9 A;  1DGH A;  3QIJ A;  1P98 A;  2FAZ A;  3MTN B;  2BKR B;  4IWO A;  5AZF A;  3N4C A;  4GC5 A;  2H7J A;  1IY0 A;  3N9Y C;  4W4U A;  1NY5 A;  2D3C A;  3GLH B;  1QT9 A;  3B08 A;  4RGT A;  5EP2 A;  1EIJ A;  4J3O D;  1DOY A;  1F2R I;  2D7E A;  3KUC B;  3VR9 B;  2G8J A;  3K1J A;  3AE6 B;  1WXV A;  3O1G A;  3KUZ A;  2GNO A;  3GPU A;  2GBN A;  4FBJ B;  2O6V B;  1T0Y A;  1KRH A;  1IGD A;  4CYE A;  1MEM A;  2IO1 B;  5EP1 A;  2FQ9 A;  4FAD A;  3ETR A;  3WIM A;  4BVU C;  3TL4 X;  3WA0 A;  1C3T A;  1ENF A;  2KRK A;  2L7R A;  3FUT A;  2MP2 B;  1C76 A;  1G71 A;  2RKO A;  1OQY A;  4WQO B;  4HDQ A;  3GQ4 A;  2KTF A;  1WIA A;  2DNF A;  3FTE A;  4I8O A;  5CVO B;  2MQJ A;  2WU2 B;  5E26 A;  3UIP B;  2JYE A;  2TSS A;  3P4S B;  3WAP A;  3C3D A;  4LNK A;  1D5Z C;  4NOO B;  4W5W A;  3HVD A;  8PCH A;  3M3J A;  4Q2J A;  2PIA A;  3E1Z B;  2F5Q A;  3JSV A;  3SBJ A;  2NR2 A;  2OOA A;  4BS6 A;  3TPZ A;  5KQ8 A;  4CIS A;  1XLO A;  4LJO B;  3BBA A;  1VR9 A;  1E8Z A;  1IN7 A;  2DZY A;  3MHS A;  3D8L A;  3T15 A;  3OF9 A;  2I1J A;  2JRH A;  3J80 S;  3AXC A;  3FUW A;  2BYF A;  2CE7 A;  2QDF A;  2X4A A;  3W0F A;  2BJV A;  3QQ8 B;  3N1X C;  3KWL A;  1GO5 A;  4HRO A;  2LHG A;  2HAK A;  2MA9 B;  1YE9 A;  3VRA B;  4FLH A;  2XGN A;  2F1G A;  3N32 A;  3SFZ A;  1OAI A;  1ZQ9 A;  2WXH A;  3LJ3 A;  3N3G A;  1Y08 A;  1EWY C;  4JWS C;  3RNG C;  2KJH B;  2DJG B;  2UWQ A;  1FRR A;  3NJT A;  2DWL A;  3R8F A;  3U6L A;  1A6R A;  2L00 B;  4YXD B;  2KRU A;  1IGC A;  3OWE B;  2IZV B;  2J0J A;  2ZM6 M;  1SNK A;  2LJ5 A;  4IBK A;  3L0W B;  2OJW A;  4KX6 B;  3U6S A;  4LF6 M;  1U9Q X;  4OX9 M;  1WYW B;  3RT3 B;  3CGW A;  5ITX E;  1P7E A;  3QJ3 A;  1XD3 B;  4M9S A;  3GPX A;  1JB0 F;  4JN6 A;  4MH0 E;  4LGY A;  3H7S A;  4TKN A;  1G59 A;  3ABV B;  4ZHP A;  1JWA D;  2DAJ A;  3EEC A;  3CF2 A;  4GDL A;  1NB5 A;  4IW0 A;  1KLU D;  3LW5 F;  3QAQ A;  2KVR A;  3ZYY X;  3PRE A;  5MPO A;  2CRU A;  1Q39 A;  1JCK B;  5ITX A;  1I94 M;  3RFZ B;  4KVG B;  2K8C A;  4DV5 M;  2LRU A;  2SAK A;  4PDI A;  2DC8 A;  3C19 A;  5IRE B;  2YEP F;  2YR0 A;  2MBB B;  3CWI A;  1ESF A;  2CS4 A;  2LUM A;  1HQR D;  3PT2 B;  3OF8 A;  4ANU A;  3KS8 A;  5CTR C;  5ITQ A;  2UXB M;  1PAD A;  4DR5 M;  3PLU A;  2HXZ A;  2QZ4 A;  4LF5 M;  2WXK A;  2L76 A;  3LVW A;  3B9P A;  3VTV A;  2D7G A;  5FTK A;  5FLX S;  2LVA A;  3PVS A;  3EA6 A;  3RPF C;  1QDR A;  2K6B A;  3IG8 A;  3C0R A;  3L13 A;  5HG2 A;  1HQC A;  4ZPX A;  3WCQ A;  3HU3 A;  2BGF A;  1F9J A;  1GC6 A;  4IKG A;  5BMG A;  3N1Z C;  2OOB A;  4CGY B;  2NBU A;  1YK8 A;  3AE2 B;  2XFT A;  1V6E A;  3OLM D;  5G2N A;  1LV7 A;  4B7F A;  4GXB A;  3MJ5 A;  2C9C A;  3PV1 A;  3VDZ A;  4JX1 C;  2H88 B;  4GMV A;  2XK5 A;  2QCU A;  1SGH A;  2JTC A;  2BTE A;  1WGG A;  1PIP A;  3LCU A;  1QXP A;  2R45 A;  4C00 A;  2PW9 A;  3MJW A;  2V3N A;  1FIQ A;  3X23 A;  9PAP A;  3SFD B;  4JQW C;  3KXE C;  4M0W B;  1IY1 A;  3V6C A;  4HKQ A;  1YJI A;  2J7Q A;  1KF6 B;  5HFY A;  1H8C A;  7CAT A;  4OZC A;  2DEN B;  3QCA A;  2JZ0 A;  3AB5 A;  3U5Z A;  1EO6 A;  3THG A;  2LGD A;  2CHQ A;  2DC9 A;  2KEB A;  2Y5P A;  3LQQ A;  2I1K A;  3TEZ A;  1L8Q A;  3Q8E A;  4LNI A;  3HHZ A;  3BPF A;  5TSS A;  2WQY B;  3VLF B;  4X62 M;  3TWM A;  3LVV A;  3EFC A;  1N62 A;  4CHK A;  4ANR A;  4DHJ D;  4AQY M;  3LDZ E;  2ATO A;  2OP3 A;  3UIN B;  2ZW0 A;  2QHO B;  2KA6 B;  3AI5 A;  2BWE S;  2INN E;  3AE9 B;  2EUC A;  4FWG A;  3B7Z A;  1IN8 A;  4ITK A;  4FIP A;  2UUB M;  3GRU A;  2N0S B;  4QAY A;  1TT5 B;  3KSE A;  3UK6 A;  4YY3 M;  5AZH A;  1MN3 A;  5H92 C;  4NAM A;  1WY8 A;  1Q3B A;  3H7P B;  1MHH E;  2OED A;  5ITT A;  3OQC A;  1WX7 A;  1YQB A;  3SAS A;  4FVM A;  2K8H A;  1MG4 A;  3W30 A;  1YUB A;  2N7D A;  1E90 A;  1VD2 A;  4L16 A;  3QYB A;  4RF1 A;  1GKI A;  3QWZ B;  3NBI A;  4DV4 M;  4BPV A;  1UUP A;  1WM3 A;  4RGN A;  2XU5 A;  2FT2 A;  3PBH A;  4DQO C;  4JWU C;  1NVM A;  2M4N A;  5JI3 E;  5JA7 A;  3ZCB B;  1I4X A;  3I63 C;  2P5T A;  3KH0 A;  4B08 A;  3P42 A;  4AXM A;  2BWE A;  3CH3 X;  2CR5 A;  2I2Y A;  4DWF A;  3TWL A;  3MK6 A;  2YJ2 A;  4WAA A;  4LRT A;  1PGA A;  4IBJ A;  4WIP A;  3BY4 B;  3AM9 A;  4B3S M;  1B9R A;  4E3C A;  1F2C A;  1P0R A;  2WXF A;  3ZXR A;  4AG5 A;  3X0W A;  1U9X A;  1WGH A;  4XGI A;  2DC7 A;  4MM3 B;  1P3Q U;  1RM6 C;  3AED B;  2KK8 A;  3GLI E;  4LFA M;  4DBG A;  1IBX B;  4XR7 A;  2WSF F;  1VJK A;  4LJ9 A;  4FW9 A;  5KQD A;  1WR1 A;  3BVM A;  1WXS A;  3CST A;  1YIW A;  1QMY A;  1AYV A;  3FE3 A;  1AW7 A;  2WBF X;  2R4E A;  3GRY A;  4XDD A; 
#chains in the Genus database with same CATH homology
 1VLB A;  1CQV A;  1IN6 A;  5LMN M;  3LXF A;  3GLI A;  5BYQ A;  5BMH A;  4NRV A;  3SYL A;  1D2N A;  4ZOH C;  4ITQ A;  2AQ3 B;  1EU3 A;  1VDD A;  1VRA B;  2WDR B;  1V1O A;  3NRZ A;  2EA0 A;  3SAR A;  4XDC A;  2W82 A;  4II7 A;  3K8Z A;  1SXJ D;  5FTM A;  4ZRQ A;  3SHG B;  4NSR A;  3GP1 A;  3EGR A;  4CQN A;  3FD9 A;  2R46 A;  3LQR A;  5EQT A;  4AI6 A;  2Y0Q A;  3J9C A;  3U4E G;  2EO2 A;  1JRO A;  1NNJ A;  5EE9 A;  3B21 A;  3BVZ A;  1E32 A;  3GLG B;  5AUI A;  3PO0 A;  4LFC M;  1DOX A;  2KZS A;  1TH2 A;  1IN5 A;  4EE2 A;  3VKH A;  4D8B A;  3AOE C;  4IJF A;  3T1Y M;  2DVW B;  1XXH B;  3KOZ E;  1RFK A;  1IBM M;  1PJI A;  2UXC M;  1F77 A;  4X64 M;  1BXT A;  2G9H D;  3CF6 E;  3BVG A;  4X65 M;  4DR6 M;  3PHW A;  3I4V A;  1QOF A;  4DXG A;  3DWM A;  3HWS A;  4OW0 A;  1DGJ A;  2IPK D;  5C1B A;  4IIW A;  1SE4 A;  3U2S C;  2ZBK B;  3AOG A;  1MI0 A;  4L2Y A;  1TJE A;  3KOW E;  3RGS A;  1XCQ L;  4LJ5 A;  5JXV A;  2I7P A;  2JU6 X;  3BYT B;  1PYW D;  5G5G A;  2X8A A;  1NVI D;  3FIL A;  1E9R A;  3U6P A;  2JYT A;  2Y3A A;  4OU7 A;  2J52 A;  4DR2 M;  4IUM A;  3GLF B;  4D8E A;  3AEA B;  4CHT B;  2Z84 A;  1IM2 A;  3FTC A;  3H8H A;  3GPY A;  1XMQ M;  1R2Y A;  3W5U B;  3P4R B;  1QAO A;  1E7P B;  2CV0 A;  1TDZ A;  4X66 M;  1XLQ A;  1HQY E;  2RMM A;  1G3I A;  5BPV A;  3W1S A;  3SEB A;  1C77 A;  4DV7 M;  3AMZ A;  4KHP M;  4LGM A;  4FCW A;  2JX5 A;  1TH3 A;  4FCV A;  1L2D A;  5FTL A;  4AKH A;  2E6X A;  4BOU A;  3GLH A;  3VQI A;  2ZAN A;  2L7H A;  2DZO B;  4DR4 M;  4YSZ B;  2DOS A;  3OTO M;  4D2K A;  3QAU A;  3W2D A;  3B2F A;  1XF5 L;  2VQE M;  3SMS A;  3PNV A;  3HKP A;  3I4Y A;  2VQF M;  3NVV A;  1G8P A;  2V6Z M;  4RGO S;  1SE2 A;  1N5X A;  3MTV A;  4JI1 M;  1GOZ A;  5EP4 A;  2IGH A;  2QJL A;  4NRW A;  4B7H A;  2VZK D;  3WHK A;  5IWA M;  5T8I A;  1JWS D;  3UGJ A;  1TS4 A;  1EU4 A;  2DYM A;  4EIW A;  4DUZ M;  2LXE A;  1I4G A;  1SXJ C;  3M0E A;  2Y0T A;  5DNY A;  4YTP B;  3AL0 C;  3AEB B;  1AN8 A;  2CU3 A;  1C9F A;  3PFI A;  1XNQ M;  4KGS A;  4MGK E;  2IGD A;  3J2P B;  1YN4 A;  5C3J B;  2C9O A;  1EWC A;  1ZDV A;  5EP3 A;  3E56 A;  3ZJV A;  3AH7 A;  4MGH A;  4IBG A;  3RFW A;  2FE8 A;  2C5R A;  3HHY A;  3AKZ A;  1TGU A;  3I51 A;  1L0V B;  4BBA A;  3FYC A;  3U60 B;  2OHF A;  4G4O A;  2XSZ A;  1YSY A;  3DOA A;  2BB5 A;  2KW0 A;  5KPT A;  1FD6 A;  3PT2 A;  2QPA A;  2WXO A;  3JR5 A;  2G1E A;  3C58 A;  1DOI A;  5FR3 A;  2J7N A;  1B1Z A;  1NYQ A;  3KSX A;  1FRD A;  1J7B A;  1X37 A;  3TUO A;  2YQZ A;  4OVZ A;  3SAW A;  2Z3X A;  1I4W A;  1J09 A;  1KYI A;  1DGB A;  1QZM A;  4FXC A;  4JXJ A;  3HRD D;  4N6E B;  4BB9 A;  1KH0 A;  4D81 A;  4M0W A;  4WQM A;  1AWD A;  3AE5 B;  1NYR A;  1SXJ B;  3E4R A;  3W0L B;  1ZXI A;  4LJ4 A;  5HI1 A;  1HR0 M;  1L4Z B;  2QIL A;  5A2Q S;  1L0X B;  1N77 A;  4G4Q A;  3AE7 B;  4BOS A;  4GUA A;  1EE8 A;  1QYR A;  4HEA 1;  2R62 A;  3IXS A;  1NY6 A;  1L5P A;  4A8X C;  1SJH D;  4KO8 A;  3Q8X A;  2L83 A;  4RCO A;  4TMA B;  1TYG B;  2KAJ A;  1IXZ A;  3TQS A;  4XE0 A;  2V4I B;  5EE0 A;  4PCZ A;  1N78 A;  2MEK A;  4LJ6 A;  1TZO A;  4M9X A;  3BYY B;  1XXG A;  2ZW1 A;  1VZ6 A;  3AV0 A;  3GPP A;  4FD2 A;  4PT5 A;  1N33 M;  1N32 M;  1IBL M;  3PZ7 A;  3J7A S;  3BY4 A;  3VR8 B;  5KO3 A;  2L6O A;  1ZP0 B;  1XWI A;  4AZF A;  1K50 A;  2Q2E B;  4L4U A;  1V1P B;  1XC8 A;  3MP2 A;  1FFV A;  3VK8 A;  3GRV A;  2M5Z A;  2KMM A;  2JXT A;  1IBX A;  5C18 A;  5BYR A;  3LYY A;  2F5O A;  4OHJ A;  1FNN A;  1SIJ A;  2CEA A;  1K82 A;  2YEP B;  4L23 A;  2M0A A;  1UKF A;  1E6E B;  1D6E C;  2UXD M;  1E94 E;  1OQR A;  1Q10 A;  1D5X C;  4ARC A;  2BTW B;  2KXE A;  1TKY A;  1K53 A;  2BBC A;  1WYG A;  1DO2 A;  3Q8F A;  1QQW A;  4JI2 M;  4B3R M;  2M56 B;  5FSW A;  2J7O A;  5LMU M;  3VK7 A;  3DZD A;  4IDI A;  3AE8 B;  4DXF A;  1HT2 E;  2F5S A;  4XWW A;  1T3T A;  4HKZ E;  3GLG A;  2IJ0 A;  4NXM M;  4KLN A;  3UZU A;  2H89 B;  4GH9 A;  1DGF A;  2N9L A;  4G6Z A;  2HL7 A;  4YT0 B;  1XEE A;  1SBB B;  3DFZ A;  3KVW A;  4GKJ M;  1XXH A;  2K9X A;  1R7S A;  2QEN A;  5DYI A;  1L1T A;  1TDH A;  2L09 A;  4R7G A;  1N60 A;  3P4P B;  5EZS A;  1PM5 A;  2WS3 B;  2PMV A;  2AX5 A;  4O1N A;  2IDY A;  4WWM A;  5AUK A;  3KQ4 A;  3H4M A;  1QAN A;  5EXT A;  3MFG A;  3MHV C;  3U61 B;  3SMP A;  2XLJ A;  3C8Y A;  2VZK B;  4JYA M;  1CZP A;  1OFI A;  2L52 A;  2E5L M;  3PSE A;  1STE A;  2W3S A;  2WP9 B;  4MH8 A;  1JWM D;  1OJL A;  1JML A;  3P1M A;  3KW6 A;  1W5T A;  5H37 D;  4GLS C;  1F2R C;  4B7G A;  1N34 M;  5BMI A;  4M9Z A;  4B3T M;  3RGP A;  3U6M A;  3B9J A;  3RE8 A;  2CV1 A;  4B3M M;  1QLB B;  1NNU C;  3NS1 A;  3GLF A;  5E6J A;  1I4Q A;  1GLN A;  5EE3 A;  4PDG A;  4GRI A;  1L2C A;  4A6Q A;  1VZ7 A;  5EZQ A;  1OQQ A;  3ILK A;  1K52 A;  3AOE A;  1D4B A;  4LF9 M;  4AKG A;  2K3U A;  4LG2 A;  3AE4 B;  3BK2 A;  1T3Q A;  4YTN B;  3M6A A;  1NEN B;  1JWU D;  2DWN A;  5KPR A;  1XLN A;  4JPS A;  4BOQ A;  1L6V A;  2AQ2 B;  3Q8C A;  2MJD A;  2BS3 B;  3W5V B;  4D82 A;  3EIH A;  4DR3 M;  3JR4 A;  3R9X B;  1JAL A;  4WW0 A;  4M0D A;  3HU2 A;  2Y20 A;  1UM8 A;  3A98 B;  2DZN B;  2V3P A;  1W5S A;  4JI3 M;  1R7R A;  1T5X D;  1KFV A;  3SR6 A;  2N9K A;  4I81 A;  2C99 A;  4Z8X A;  3PRP A;  4WUR A;  1R2Z A;  1ZPS A;  1G4A E;  3CTW B;  4NJC A;  4P6V F;  3SAV A;  2WXJ A;  3BB7 A;  3ZC7 B;  2LFI A;  4IBC A;  2XN9 C;  5IT9 S;  1XMO M;  4KKJ A;  3JAM S;  4GIP A;  1FXA A;  1MHX A;  4LF4 M;  1XLP A;  1H6U A;  1WWT A;  1NI3 A;  1I4R A;  3NWL A;  3R2T A;  3SFE B;  1UNS A;  2HWK A;  3T1H M;  5C2T B;  1PFD A;  4JI0 M;  5FTJ A;  1NSF A;  4AS1 A;  3B2G A;  3QWL A;  2KQ4 X;  1JW9 D;  2BS4 B;  4BLC A;  1SB3 C;  4KKI A;  4FCT A;  1IBK M;  1A70 A;  1J7A A;  4US8 A;  2MH7 A;  3HUI A;  1UWX A;  5IZ7 D;  3FUV A;  3SHF A;  1ZUD 2;  4NZL B;  1RWS A;  2DXI A;  1E9M A;  4K0K M;  1M4V A;  4A9A A;  1IUE A;  3KDS E;  1Z6T A;  1FMA D;  1BUI C;  2DHR A;  4A55 A;  1K3X A;  3TEY A;  3SYK A;  4HJG E;  3AEE B;  3FYD A;  1HXY D;  5H8Y E;  4MGZ E;  4BOP A;  1MVK A;  2IGG A;  3FKE A;  5D3I B;  1QKZ A;  1F0Z A;  4HXD B;  3AEF B;  1DKI A;  3UMM A;  1N61 A;  1HT1 E;  1SXJ E;  1DGG A;  4N58 A;  2BU3 A;  1OFH A;  3KSJ A;  4KGR A;  3BOS A;  3K2L A;  1FFU A;  2R18 A;  1C79 A;  3AN1 A;  2XFS A;  4GHL A;  2LHD A;  3P63 A;  1E10 A;  1SXJ A;  2KZU A;  3KWV A;  2K0P A;  2QMT A;  1C4P A;  1YN5 A;  1D5M C;  3R8B A;  3U6Q A;  2BNK A;  1JR3 A;  2A5Y B;  2XF3 A;  1XO3 A;  2Z8L A;  1EM7 A;  1QQR A;  3TMP A;  2Y5C A;  3PZ8 A;  2FFJ A;  4LTU A;  2HTM E;  3UJN A;  1C4C A;  3KFU G;  2WXR A;  2CV2 A;  4I4L A;  2X49 A;  4L15 A;  3VDU A;  4WH4 A;  4C56 C;  2N7J A;  3O13 A;  4H2A A;  2F5N A;  4IBD A;  1MU5 A;  3NVZ A;  2LHE A;  3TEX A;  3R2I A;  3ZQ4 A;  2R4J A;  3EUB 2;  1FCL A;  3GQ3 A;  5JZE A;  5F3W A;  3TEW A;  1TKE A;  2G8L A;  1WSP A;  1V8C A;  1ZOY B;  2VII A;  4AG6 A;  4I5S A;  3IT4 B;  1QAM A;  2HKJ A;  2WDQ B;  1IXR C;  3L27 A;  1QOB A;  4IBI A;  3D8B A;  4B0M A;  3GRR A;  1V1P A;  4N59 A;  4GC9 A;  3BZD B;  2DWM A;  5LNK 1;  1E0Z A;  3U7Z A;  2WXL A;  1I4P A;  2Z4S A;  4JI5 M;  2W3R A;  4HLQ A;  1SXT A;  4IBE A;  2RPV A;  2INP E;  3P4Q B;  2QBY B;  2GB1 A;  1TS3 A;  2BTW A;  3VRB B;  4IJE A;  1SSN A;  3GS2 A;  3Q8A A;  2V1U A;  4WAF A;  4QHS A;  4C7Y A;  5BYS A;  2F5P A;  1C78 A;  5ITY A;  2K5P A;  4LFB M;  4ZHO A;  2PLP A;  3FAH A;  3IFU A;  3U6E A;  3O65 A;  3L26 A;  2KAC A;  3LMM A;  1T6B X;  2ON8 A;  4JE3 B;  4HL4 A;  1I4H A;  5GXG B;  1MPE A;  3TE6 A;  1TY2 A;  3SAT A;  3IAS 1;  4ZYS A;  3PNY A;  2WXQ A;  8CAT A;  1BML C;  1FO4 A;  1ORY B;  2LH0 A;  3J81 S;  1IY2 A;  1FNU A;  4US9 A;  4YWG G;  2PVG C;  4AQ7 A;  2B76 B;  3AFH A;  3HGI A;  1Q3C A;  4AKI A;  4L1B A;  4LRS A;  4LK0 M;  2K47 A;  2UUC M;  1ZAE A;  4OZA A;  1FXI A;  1KLG D;  2JRI A;  4BOZ A;  3HVZ A;  1QAQ A;  2YNM D;  2FUG 1;  2K22 A;  2MJE A;  1L4D B;  3L29 A;  4YSX B;  4ZRP A;  2W55 A;  1YZB A;  3U61 A;  1SE3 A;  2WDV B;  3U6O A;  4LJ8 A;  1GL7 A;  2LJI A;  2BJW A;  2BT6 A;  3MP9 A;  5GKN A;  1K51 A;  4LLG M;  1SJE D;  4QOS A;  5ITR A;  4QOZ C;  4YHH M;  5EXP A;  1WRI A;  3TWK A;  4FWD A;  2R65 A;  4TUW A;  1ET9 A;  2ERC A;  1HZ5 A;  2RDH A;  1GB4 A;  2WXM A;  5KPZ A;  4DV1 M;  4XWT A;  4DR1 M;  4GHA A;  3IG5 A;  2QSD A;  1DO0 A;  1OFF A;  3A46 A;  2D7H A;  4RH6 A;  2L1A A;  4TQ0 A;  4JI6 M;  4ZTB A;  1J7K A;  1FM0 D;  3ZJT A;  3L2A A;  1L0Y B;  2XZF A;  4IP3 A;  1L2B A;  4RF0 A;  3FC4 A;  2W54 A;  1PDX A;  1DGH B;  1GPX A;  3HJ8 A;  1HEZ E;  4OVZ B;  3I9V 1;  1TKG A;  1YJJ A;  2I7N A;  4C7Z A;  4DV0 M;  2JWU A;  1YNT E;  2XZU A;  1FNW A;  1L6U A;  3FTF A;  3ZJU A;  3AEG B;  2M60 A;  2JA2 A;  1Z59 A;  1N75 A;  1TY0 A;  1L1Z A;  1YMH E;  2NTT A;  3HHX A;  1ROE A;  1FEH A;  4JI8 M;  4LJ7 A;  1YN3 A;  2V0G A;  1V97 A;  3CIR B;  1WGK A;  1CJE A;  2BS2 B;  2OPF A;  4LZJ A;  2WXP A;  3KOX E;  4ARI A;  4XBO A;  2AHM A;  5ITU A;  2G5G X;  4TQ1 A;  1J5E M;  3U6D A;  3Q69 A;  4QNR A;  1YQ3 B;  4TSS A;  1GL6 A;  2J7Q C;  3AEC B;  2C96 A;  1AYF A;  3KOY E;  4AW4 A;  3EIE A;  1TS5 A;  1P7F A;  3HJS A;  3T3N A;  4MGI E;  3FUU A;  3VDP A;  3AE3 B;  2GRI A;  2Y21 A;  2DWQ A;  1GVN A;  1KTK A;  4IOI E;  4D8I A;  4MB7 A;  4USA A;  2CJN A;  4JI4 M;  4LZZ A;  2XEP A;  4GDL B;  2QIE B;  1NJG A;  3GO8 A;  4LCB A;  3LB8 C;  4DV3 M;  1ZDX A;  3AJI B;  2PKO A;  2UU9 M;  4B0E A;  4DR7 M;  4G4N A;  2YFQ A;  5G5H A;  2ZAO A;  3PHU A;  2UUA M;  1QIL A;  5EE1 A;  3L25 A;  3NVW A;  4GDK B;  1J7C A;  3T38 A;  4D80 A;  1ET6 A;  2QEJ C;  2Q5W D;  3KP0 E;  2E3T A;  2XH9 A;  1LO5 D;  3TRK A;  1C4A A;  3NUH B;  1HNZ M;  3UI3 A;  2NMQ A;  5I4D A;  3RNV A;  2WXN A;  1QOA A;  2I38 A;  1JR3 D;  1VDV A;  3VKG A;  4NL4 H;  2LWX A;  2V1C A;  2J53 A;  1NJF A;  5EXS A;  3U5Z B;  2EKI A;  3A42 A;  3ZGZ A;  2CHV A;  3BWU D;  1TH4 A;  4L8R C;  2HHH M;  4XZX A;  1JQ4 A;  1PGX A;  2JQR B;  1RYJ A;  2Z7J A;  4MT5 A;  4A3V B;  1UWM A;  2XNA C;  3J7B A;  1KFY B;  3HHW A;  2AQ1 B;  5DYG A;  1HNW M;  4PD2 A;  3U52 E;  1JWB D;  3AV8 A;  1PGB A;  3V05 A;  5BR8 M;  2KWD A;  1FNV A;  3FTD A;  3GQ5 A;  2PTL A;  3PRM A;  1PUT A;  3NVY A;  2MJ3 A;  1N36 M;  4C80 A;  2HCB A;  3L28 A;  5JI2 E;  3GP7 A;  1NHW C;  2RGH A;  2WU5 B;  2XSZ D;  4OZB A;  3KLS X;  4FWH A;  5FKA C;  2BYT A;  1IQP A;  2CUZ A;  2LGI A;  2L32 A;  2O5R A;  3DWG C;  3U60 A;  2CFO A;  5D3D A;  4RGM A;  1N63 A;  1QOG A;  1UGJ A;  2UZJ A;  3I57 A;  4A5U A;  1HZ6 A;  4LF7 M;  1SF0 A;  5D7G A;  1TS2 A;  2L7I A;  2Z4R A;  3TSS A;  5EXX A;  2QBY A;  4R3D A;  2BB6 A;  3GLI B;  4YSY B;  3T3O A;  1FJG M;  1CK1 A;  2F4V M;  2D5G A;  1HNX M;  2J42 A;  1SEB D;  1GB1 A;  4G4R A;  2H1R A;  1K3W A;  3ZH9 B;  2SEB D;  4A90 A;  3K92 A;  4QNM A;  2DWZ B;  2LEK A;  4JI7 M;  1XNR M;  4LJA A;  1PVJ A;  4HRS A;  1IXS B;  2ACZ B;  2RGO A;  4GKK M;  2HDE A;  5HHD G;  1Z5C A;  2DLB A;  1QVR A;  3BK1 A;  4IBF A;  4LF8 M;  1ZXH A;  1NHG C;  2WXI A;  2WXG A;  1PJJ A;  1DYQ A;  3ZNH A;  5FTN A;  3PHX A;  1GAQ B;  4MAC A;  2ZAM A;  4DUY M;  2RDG A;  1IN4 A;  3M7G A;  3BII D;  3MHZ A;  4YTM B;  2PVO D;  4REZ A;  2KN4 A;  4MI7 A;  4RFB A;  2ICI A;  3SAU A;  4S12 A;  2FNA A;  1S3S A;  3DA1 A;  3W31 A;  4L78 A;  3NZ3 A;  4GIT A;  2CHG A;  2EEL A;  2M19 A;  3IT6 B;  4IBB A;  2BW2 A;  2KDM A;  1I7H A;  3HU1 A;  1YQ4 B;  1Z5B A;  4Z6Y A;  3VFD A;  1C1K A;  3SC3 A;  4DV6 M;  1QF6 A;  3CF0 A;  2C98 A;  2FOI C;  1ACC A;  2CJO A;  3GB1 A;  4DV2 M;  1MX0 A;  4RNA A;  4QHT A;  1JQJ C;  2ONQ A;  3L4P A;  1WXQ A;  2NQ8 C;  4NXN M;  4LY6 A;  3J27 B;  3U6C A;  2R61 A;  3IAM 1;  1G41 A;  3KP1 E;  4NSO B;  2J4X A;  2WLB A;  3HJQ A;  1HA5 A;  2JSV X;  2FBW B;  1XCT L;  3W9C B;  1N5W A;  2LMC A;  1NEK B;  4UDU C;  4KGT A;  3MC0 B;  3FIL B;  5EJC A;  1ZE3 D;  4GMQ A;  4NAW B;  3A45 A;  1VZ8 A;  2NTS A;  4JV5 M;  3V3X A;  2AGA A;  5FK9 C;  2WNM A;  1KSF X;  2DBY A;  2OQ4 A;  2QP9 X;  2DYO A;  4P16 A;  3AE1 B;  3WHL A;  2JZP A;  1Z5A A;  2LNH C;  1R6B X;  1E9S A;  1FCC C;  1JRP A;  3PXG A;  4RKX A;  4KOD A;  3E9S A;  2X38 A;  3FUX A;  4MGY E;  1Y56 A;  3URY A;  3KS4 A;  3Q8B A;  1XHB A;  2GI9 A;  1DGH A;  4GC5 A;  1IY0 A;  3N9Y C;  1NY5 A;  3GLH B;  1QT9 A;  4RGT A;  5EP2 A;  4J3O D;  1DOY A;  1F2R I;  2D7E A;  3VR9 B;  3K1J A;  3AE6 B;  3GPU A;  1KRH A;  1IGD A;  5EP1 A;  3ETR A;  3TL4 X;  1ENF A;  2KRK A;  3FUT A;  1C76 A;  2RKO A;  3GQ4 A;  3FTE A;  4I8O A;  2WU2 B;  5E26 A;  2JYE A;  2TSS A;  3P4S B;  1D5Z C;  4NOO B;  4W5W A;  3HVD A;  4Q2J A;  2PIA A;  2F5Q A;  3SBJ A;  3TPZ A;  5KQ8 A;  4CIS A;  1XLO A;  3BBA A;  1VR9 A;  1IN7 A;  3D8L A;  3T15 A;  3J80 S;  3FUW A;  2CE7 A;  2X4A A;  3W0F A;  2BJV A;  3KWL A;  4HRO A;  1YE9 A;  3VRA B;  2XGN A;  3SFZ A;  1ZQ9 A;  2WXH A;  1EWY C;  4JWS C;  1FRR A;  2DWL A;  3R8F A;  3U6L A;  4YXD B;  2KRU A;  1IGC A;  3OWE B;  2ZM6 M;  4IBK A;  4KX6 B;  3U6S A;  4LF6 M;  4OX9 M;  5ITX E;  1P7E A;  4M9S A;  3GPX A;  4JN6 A;  4MH0 E;  4LGY A;  4ZHP A;  1G59 A;  3ABV B;  1JWA D;  3CF2 A;  1KLU D;  3ZYY X;  5MPO A;  1Q39 A;  1JCK B;  5ITX A;  1I94 M;  3RFZ B;  4DV5 M;  2SAK A;  4PDI A;  5IRE B;  2YEP F;  2YR0 A;  3CWI A;  1ESF A;  2LUM A;  1HQR D;  3KS8 A;  5ITQ A;  2UXB M;  4DR5 M;  2QZ4 A;  4LF5 M;  2WXK A;  3LVW A;  3B9P A;  2D7G A;  5FTK A;  5FLX S;  3PVS A;  3RPF C;  3EA6 A;  3IG8 A;  3C0R A;  5HG2 A;  1HQC A;  4ZPX A;  3WCQ A;  3HU3 A;  5BMG A;  4IKG A;  4CGY B;  3AE2 B;  2XFT A;  1LV7 A;  4B7F A;  3MJ5 A;  2C9C A;  4JX1 C;  2H88 B;  2QCU A;  2JTC A;  2BTE A;  2R45 A;  2PW9 A;  2V3N A;  1FIQ A;  3SFD B;  3KXE C;  1IY1 A;  4HKQ A;  1YJI A;  2J7Q A;  1KF6 B;  5HFY A;  7CAT A;  4OZC A;  3AB5 A;  3U5Z A;  3THG A;  2CHQ A;  2KEB A;  2Y5P A;  3LQQ A;  3TEZ A;  1L8Q A;  3Q8E A;  3HHZ A;  5TSS A;  2WQY B;  3VLF B;  4X62 M;  3TWM A;  3LVV A;  1N62 A;  4AQY M;  2ZW0 A;  2KA6 B;  2INN E;  3AE9 B;  2EUC A;  4FWG A;  1IN8 A;  4ITK A;  2UUB M;  3GRU A;  2N0S B;  3UK6 A;  4YY3 M;  5H92 C;  4NAM A;  1Q3B A;  1MHH E;  2OED A;  5ITT A;  3OQC A;  3SAS A;  4FVM A;  3W30 A;  1YUB A;  4L16 A;  4RF1 A;  1GKI A;  3NBI A;  4DV4 M;  1UUP A;  4RGN A;  4DQO C;  4JWU C;  1NVM A;  5JI3 E;  3ZCB B;  1I4X A;  2P5T A;  4B08 A;  3P42 A;  2I2Y A;  3TWL A;  3MK6 A;  4LRT A;  1PGA A;  4IBJ A;  4WIP A;  3AM9 A;  4B3S M;  1B9R A;  2WXF A;  4AG5 A;  4XGI A;  4MM3 B;  1RM6 C;  3AED B;  4LFA M;  1IBX B;  1VJK A;  3BVM A;  4LJ9 A;  4FW9 A;  5KQD A;  1AW7 A;  2R4E A;  3GRY A;  4XDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...