4REZA

Crystal structure of the middle-east respiratory syndrome coronavirus papain-like protease
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
320
structure length
311
Chain Sequence
b'TIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTAPDFVAFNVFQGGHYVHARLKLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSDCN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ORF1ab protein
publication title Crystal Structure of the Middle East Respiratory Syndrome Coronavirus (MERS-CoV) Papain-like Protease Bound to Ubiquitin Facilitates Targeted Disruption of Deubiquitinating Activity to Demonstrate Its Role in Innate Immune Suppression.
pubmed doi rcsb
source organism Human betacoronavirus 2c jordan-n3/2012
molecule tags Viral protein
total genus 79
structure length 311
sequence length 320
ec nomenclature
pdb deposition date 2014-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4rezA02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rezA01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4rezA03
3MJ5A 5KO3A 4OW0A 4R3DA 3E9SA 4RF0A 3MP2A 4WURA 4M0WA 2FE8A 4RF1A 4PT5A 4MM3B 4OVZA 4P16A 4REZA 4OVZB 5E6JA 4RNAA
chains in the Genus database with same CATH superfamily
1TDHA 4IP3A 3UQAA 1HJPA 1U9VA 3GLIB 3LW5F 2C5RA 2G1EA 2PVGC 4QOZC 5G5GA 2AQ3B 2MQJA 3I51A 5PADA 2O5RA 2QCUA 2BF8B 4OEMA 1H4RA 1HXYD 1Y08A 4XGIA 1AYUA 3DA1A 4X65M 3P4RB 4HLQA 1YN5A 4RFBA 3RYTA 2LUEA 2JY6A 2JY8A 3DWGC 2EJSA 3FRHA 3OVXA 3VKGA 4X6JA 2FUG1 1P1AA 2G4DB 1FMAD 3TSSA 4FCVA 1XD3B 1Z59A 3ZXRA 4RF0A 2O2VB 4Z8XA 4M00A 2LVQA 1ZGUB 1K3BB 4B08A 2N9EB 2XFSA 1KF6B 1P7FA 4FWDA 3RUIB 4G0NB 1WY8A 2DZZA 4GC5A 1QOAA 2OZ2A 2CIOA 5CX3A 1JWMD 3FUUA 5EDSA 3M3JA 1KLVA 3W5VB 4HPMB 2FH0A 4HDQA 2KMMA 2C9WB 3SEBA 3SR6A 1HQRD 2L76A 3U5ZB 1CB5A 1LV7A 2CJOA 2G8JA 2K47A 4OU7A 1MIRA 2HD5A 1F9JA 1SE9A 2W3SA 1XLQA 1ESFA 3VLFB 3VUYA 4LJOB 4ARIA 1SJHD 1F52A 4NRWA 3AI5A 3W1YA 1YD8U 1XXHE 2BB6A 2X49A 3N4CA 2OP3A 1EO6A 4LCBA 3PBHA 3PO0A 2DZIA 3N1YC 2I1JA 4MEMA 3W2DA 4AKIA 1Q02A 4H2AA 1YNTE 4C7ZA 3A42A 4D82A 1VD2A 1J0GA 5F3WA 1Z5CA 3U61B 3K9PB 4W9KA 4MSQB 4CHTB 3P4QB 2NMQA 2JQGR 2D7GA 2J7OA 3R3MA 1BUIC 1MG4A 1DGJA 3WCQA 4M8NA 4RCOA 2C9OA 4LJPB 1CQVA 3W30A 4PT5A 3GLFB 3AV0A 1WFYA 3W0LB 2WXOA 3CWIA 1PJQA 3MP9A 4HRSA 1WGNA 4W4UA 1OQQA 2EMTA 1YN3A 1K3WA 1TF0B 1GJSA 2N9XA 3F75A 3IG8A 1N78A 3DZDA 4FW9A 5A24A 1T3QA 3C0RA 1HR0M 2R0IA 3IBEA 1SJED 2M1MA 3I3TB 1OEYJ 4AKGA 1ZDXA 2G5GX 3A46A 3U60A 4FCWA 4CIZA 3QA8A 3OQCA 2UXBM 4M9ZA 3K9OA 3AOEA 4IBBA 1CMXB 1A5TA 4MM3B 1XXGA 2REXA 5IREB 2P0RA 2QBYB 2JZ0A 2H5XA 2OJRA 4KO8A 2NR2A 3HVDA 1JALA 3KUCB 4JI6M 2KANA 1KLUD 4QHTA 4NQLB 2LNHC 1D5MC 4DBGB 1SGHA 1UBQA 1QAOA 1HQCA 4JE3B 3IT6B 1SEBD 4YXDB 4URKA 2DAIA 1YVBA 2FCNA 2ZNVC 2DC6A 3AE7B 4GHLA 3FC4A 1X1MA 4OVUA 3TUOA 2IBIA 1BY8A 1DGHB 1L1ZA 2NQAA 2JZ3B 1NLJA 5GKNA 1V1OA 1JQJC 3PDFA 1TY0A 4LF9M 4WJOA 2INDC 3S2AA 1WJ7A 1TKYA 3ZKJC 5EP3A 3DOAA 2MH7A 2PMVA 3DBLI 1L1TA 2JQFR 5MPOA 4IBCA 4F1SA 3Q3JA 3NS8A 3VRBB 4X6HA 2L0FA 5EXTA 5CHWA 4IG7B 2R44A 4S17A 3HZJA 2LVAA 2XGNA 3IVFA 2GHUA 3ZH9B 1WGKA 4BKTA 5C1BA 4II3B 3KSXA 1FIQA 1RYJA 1TZOA 2L2DA 4ACFA 4IBIA 1WXVA 4P6EA 1L4DB 3KOYE 1OFIA 1AN8A 4GEWA 1J5EM 1N61A 3CSFA 4OVVA 4C4VA 2JF5A 4HVBA 4BOSC 4MGKE 3DBSA 2EO2A 5EE9A 1Y8GA 4K7WA 3KS8A 3H4JA 5ITRA 4MACA 5D94A 3H89A 5KPZA 3NBXX 4NZLB 2DAMA 1WM3A 3U6SA 1Z2MA 4BKGA 3B79A 1YT7A 2AYOA 4KDIC 4HEA1 3UJNA 4FXCA 3RNAC 1E8ZA 4ZTBA 4ANRA 1A5RA 1T0YA 4W5CA 1DEUA 3K24A 1I4PA 3IFWB 2AL6A 3QSDA 1WX8A 4QBBA 2KQSA 3CMMB 4GHAA 4BBNF 3KH0A 1QQWA 2HDEA 1ICFA 1HA5A 3AEAB 4ZYSA 1OQYA 2E5LM 1WE6A 3ZCBB 5DPSA 3ERVA 4HL4A 1JWBD 1GL7A 2HE7A 2WX1A 5HFYA 5IOIA 2J7QB 2LGYA 2KX3A 2J0MA 1XC8A 3VKHA 2G3QA 1N34M 1LXDA 3FUTA 2CV0A 2A4ZA 2KDBA 2IO2B 1JR3A 3USVA 1ZV1A 1JB0F 5CTRC 5BPVA 3NZSA 4X64M 3L28A 2OPFA 2HJ1A 3UQBA 1UF0A 5FR3A 4R7GA 1TTNA 4GDKA 1M6DA 2MGWA 4Z6YA 2BPSA 4P6GA 4NY0A 2KD0A 2NVUI 3V61A 2QILA 1IN5A 1P0RA 2PPHA 4GKKM 2D07B 4W5BA 2CHQA 1V1PA 5J18A 4MGZE 1M4VA 1WJ4A 3DBHB 2K1FA 1GB1A 3U7DA 2KQ4X 2KNVA 5T8IA 1VDLA 1FO4A 1NYRA 3K92A 3TMPA 4CDCB 3AH7A 4CISA 3A1QB 3DVNU 1YN4A 1L0YB 1VZ6A 4JI1M 3BK2A 4JWSC 1T0SC 1G41A 2R9NA 2UU7A 2WSEF 1XMQM 3V6CA 3AU4A 2DZYA 2KJ6A 2XEPA 1MFWA 2YJ9A 2QCZA 1QDQA 2I38A 5HKHA 2K9XA 1YQ3B 1U9QX 4RY2A 2UYZB 1ET9A 2KZUA 3BWUD 2A5UA 1GKIA 2BWFA 5EGWA 2R62A 1OGWA 2XFTA 5IT9S 2L7IA 2FO5A 1U4AA 1ENFA 3KOZE 5FTJA 1GNUA 1IN6A 1AW7A 2B3TA 1GLOA 4IUMA 4XE0A 4D8BA 4JV5M 3HK0A 4FJZA 1AUAA 4NPNA 1C4AA 3AE2B 3T1HM 3NG0A 1AU0A 3GLIE 1P3QQ 1HEZE 2KRUA 1L7YA 1WR6E 2PIAA 2KO3A 2GQFA 2WDQB 5EP4A 2MRPA 1G59A 3NS1A 5TR5A 2MROB 4YSXB 2DC7A 1QOLA 2JX5A 3U6OA 2RGOA 3L16A 2MBQA 1YUBA 2N4FA 2HAKA 2YQZA 4MSXA 1IBXB 1ZDVA 1YALA 3C8YA 1DOXA 3L4PA 2DENA 4REZA 2D7HA 3R9XB 4JI3M 4ZHOA 2UUBM 1VDDA 1HNWM 4E74A 3QARA 4EFOA 1H6UA 4BQVA 4OZAA 1OAOC 1HTOA 4G11A 3KFQA 1N6ZA 2D3CA 1VZ8A 2RDHA 1XKGA 5KO3A 4CDFB 1P98A 2HKJA 2INNE 3GPUA 3DVNV 2KXJA 2AWTA 1FFVA 3RGSA 4GXBA 1NYQA 4F1IA 1STEA 3JSVA 2LMCA 1JW9D 2G45B 3LMMA 4I81A 1WXMA 3AULA 2HTHA 2WXGA 4F7ZA 4AZFA 3BY4A 2ZVNA 5F02A 1NO1A 5IA7A 4WW0A 3JVZX 4LK0M 2QC8A 4DHJD 3GLGA 1NEKB 2MJDA 2P86A 2ACTA 2RGFA 2CHGA 3NWLA 1XLNA 4BBNC 4DHZB 2R45A 2V1YA 1FJGM 2OOAA 2IY0B 2PNSA 3MMPA 2JP7A 1NJFA 3PNYA 1PPDA 2BKFA 3FUVA 4DQOC 1TZ1A 4HK2A 2XN9C 5D6JB 2GB1A 1F2BA 2L7HA 4LDTD 2JY6B 4UN2B 4YL8A 2M19A 4I6PA 1QZMA 3PFIA 2N0SB 2LHCA 4L6V6 1JWSD 4FLHA 1AU3A 1KFXL 1R4NI 2LVPC 1ITOA 4KODA 1TBEA 2OHFA 3WAOA 4WWOA 3L27A 3VTVA 1N5WA 1I35A 3GLFE 2R46A 2LVOA 1PGAA 1D0MA 3H8BA 3IECA 3AL0C 3FD9A 2KC1A 1PVJA 3RULA 4BSQA 2TSSA 3VDPA 3HHYA 1OTRA 1X37A 4UDUC 1PM5A 2OJWA 5ITYA 5AUKA 2NTTA 3IT4B 4MGIE 3HM3A 2AX5A 3ZTCA 5IWAM 4A55A 3DBRB 1GMYA 1E7PB 5AEKB 2KWUB 3HWNA 2KNZA 2BKRB 4W9IA 1RRBA 3VQIA 2HD5B 2BW2A 1UWMA 5KHQA 2Y21A 1C79A 4FHJA 5FK9C 1CVZA 1J8CA 2IY1B 2ZW0A 3FTDA 3HHZA 2IO0B 1ATKA 1MPEA 3B0AA 2HWJA 2XK5A 2VF8A 4LNOA 3TE6A 4YY3M 2KN5A 4Q2JA 2KTRA 2LXAA 2BTEA 3WXGA 4BS6A 2YR0A 4WWNA 4IC7B 3I01M 3GPPA 1DGGA 4PI3A 3RNEC 1WYGA 3KYDD 1R5LA 2XH9A 1J7KA 2M4NA 1YOVB 3ZTDA 1Y56A 1T6OA 2ZAOA 1S4VA 1EE8A 2FBWB 3NJTA 2JWUA 3PHXA 4NXMM 1X9YA 4ARCA 4Q8HA 3TNXA 2F5QA 4ANXA 4BOQA 1J7BA 3P63A 1IXZA 2JZZA 2LHEA 3BPMA 1IQPA 4DV3M 4QRVA 1C76A 2DJFB 5BMHA 3AEBB 4CHKA 3PVSA 1EWLA 2F5NA 4HKQA 4WAAA 1VJVA 2BDZA 1SXJD 1Z5BA 3DF0A 1ZKHA 1THEA 4YHHM 1AIPC 4LF6M 1WJNA 4W9EA 3C0RB 2WXPA 3UZUA 3ALBA 3GQ3A 4YYQA 1SG9A 2XBBC 4LF4M 3W67A 2FS1A 3J9CA 1Q5WB 2E3TA 2BJWA 3THGA 1GL6A 4W9LA 3T1YM 2VIIA 1CPJA 1ORYB 2WSFF 3WAPA 2FE8A 3U60B 3B9JA 4FWHA 2LRUA 3TEZA 3BYTB 1LTMA 3JYUA 3Q8FA 1T0RC 3K9OB 2PE9A 5IN7A 4L16A 3C9PA 4GU2A 3B2GA 4XYCA 1EWPA 2N1WA 1PXVA 2M8SA 1LFDA 2WHIA 5DPTA 4ASWC 3URYA 4IBJA 2LI5A 3FKYA 4PCZA 1EUVB 2CHZA 5FSWA 1MU5A 4B3TM 2C7NB 2N1VA 3BIID 2I1KA 2GFOA 1N33M 3NHEA 1L0VB 2DCCA 1JQ4A 3N1XC 1XMOM 1B1ZA 3MHHA 2AQ2B 3Q8GA 1IWDA 2IBIB 5JHAA 4YYRA 1TKGA 4LJ8A 4JI4M 4B0EA 3MC9A 1AIMA 2M56B 2KDFB 3RNVA 4G4QA 5JH3A 2BWBA 2L52A 3AECB 2BBCA 5JH5C 2Y5PA 2KWDA 4LF8M 3ZNZB 1PJJA 4ZRKA 1F1HA 2JTCA 2XEWA 4NJCA 4DDGD 4WIPA 3Q3NC 1TU6A 3BB7A 2L1AA 2ZAMA 3HWSA 5G5HA 4EUTA 1IBLM 3ZNHA 2INCC 4RKXA 4ZUXU 2KMAA 1HZ6A 2NQDB 3BCNA 1I4HA 2DAFA 5EP1A 8CATA 2JUJA 4BOPA 2AVWA 4LFAM 1Z5AA 1ZUD2 2Y5CA 3V60A 4C4VB 1YJJA 3UIOB 2DWLA 2E6XA 3N32A 4XK8F 4YTPB 1Z6TA 3CTWB 3U6DA 1M94A 3SAUA 1TKEA 4N8WA 5LMUM 1VLBA 1V92A 2QENA 1FXIA 3T3NA 3KWZA 4HLEA 2M60A 1IY2A 4DV5M 2AYOB 2NQ8C 5EXXA 1G71A 1V97A 1WXAA 2PBHA 3Q8BA 2ONQA 2KDLA 3RMKC 1GC7A 3TQSA 2LXEA 2UXDM 3Q14C 3TL5A 2OOBA 1MI0A 2ZCBA 4ZRPA 2IGGA 2SEBD 3PRZA 4IM2A 4LJ7A 2KC2A 2XZUA 3DBHI 2C7HA 2JQRB 3RN9C 2CU1A 2L4FA 2Y20A 3I06A 4LJ4A 4QH6A 3S3QA 4OELA 2BVCA 2G4SA 1G6JA 5EQTA 4DDID 2E00A 1T3TA 4RGOS 4G6ZA 2GOWA 5CHFA 1IN4A 3PRMA 2G3QB 2R6FA 1PRBA 2VF7A 2UU9M 2NQIA 3SC3A 1V5OA 3N9YC 2DHYA 1GG3A 2NS5A 3GCBA 3W1SA 2MX2A 2CEAA 4XUIA 3I63C 1R2ZA 3U4EG 1EWOA 1ZCMA 2WXRA 4M9XA 3NY5A 3KUDB 3FYCA 2MCNB 2KLCA 4LG2A 3AE1B 4MELA 2H1RA 4L23A 3WA0A 2WWZA 4GDKB 3QC8B 4ANUA 4LJ9A 2IO1B 2N9PC 1GUAB 2R9OA 2FCMA 5CHTA 3LXFA 1QUSA 4NC6A 2L7RA 1LQBA 3EHVA 3KSEA 1V1PB 1F2RC 2NBWB 3HHMA 3M63B 2OO9A 1TL9A 4ITQA 1SSNA 1YJ1A 2OEDA 1ZE3D 1MG8A 2KRKA 3T3OA 3TMPB 3ZQ4A 4Y28F 2MBHA 3NVZA 4WJQA 2L8JA 3AJIB 4CDDB 1IGCA 4C56C 2G8LA 2R2OA 2PJHA 3AEFB 2PADA 4A90A 2V9HA 4GKJM 2JXTA 3V6CB 2FIFA 1GB4A 1PIPA 3ZW3A 1QKZA 2C9CA 5LXHA 2GMIC 1MHHE 2BYFA 2D2QA 3IHPA 3KP1E 1Q3BA 3C19A 2V3PA 4YTNB 1WE7A 3EFCA 1STFE 1DGBA 1VRAB 4MI7A 2IPPB 1OIPA 5H8YE 2Z4SA 2NTSA 3RVWA 4DV2M 5EXPA 2BWES 2VZKD 3EIHA 4NJ7A 1K8RB 4PDGA 3OAWA 4MZSA 3RFWA 4BLCA 5BYSA 4R71A 4E71A 3OJ4B 1MEGA 2FAZA 2EKEC 2MJ3A 3GP7A 4GC9A 4IUMB 5BMGA 1DV0A 4PS3A 3FUXA 1HNXM 3ZDTA 3FTEA 1QVRA 3I04M 2DX5B 3ZIMA 4D81A 1SE2A 4DHZE 2WZJA 2LVNC 1E8XA 3PPAA 4ZOHC 4NAWB 3AOEC 4GH9A 4QNMA 1Z5SB 4M8MA 2DNAA 3ONSA 3H7SA 3B7ZA 3J7BA 5CHVC 1ET6A 2H89B 1VEJA 2FOIC 3AB5A 3QCAA 4PS8A 3RI7C 2ARYA 1F2CA 5C18A 3C3EA 2ERCA 2CHXA 1NL6A 4GN1A 1ROEA 4AG5A 1KHQA 2NQGA 1ZAEA 4LZJA 5JI2E 4KSKC 5L8RF 4WJNA 1PGXA 1XO3A 2D7EA 3VHTC 2KXEA 3A9KA 5JZEA 4WWPA 2D11A 2D3BA 3V05A 1PUTA 1UELA 1AYWA 3UMMA 3HJQA 2W3RA 2DZMA 1YK7A 3H7PA 2BS3B 3BOSA 4ZRJA 1WJUA 4QRXA 1DGFA 3SATA 3MP2A 2EA0A 2XSZD 1PJIA 2V4IB 3PZDA 4AOFA 3JSVB 3OJ3A 1SF0A 3T15A 1FCCC 5ITTA 3J80S 3BY4B 1A70A 1ZP0B 1Y4HA 2JRIA 1F29A 1KFYB 3NZ3A 3RNGC 3KP0E 3KFUG 1S3SG 1IGDA 2HJ8A 3GLGB 2WXHA 1Q6KA 2PE6B 4FCTA 5D7GA 4KDLB 4OW0A 2JT4B 2QJLA 2DBYA 5ITXA 2KFJA 2YEPB 4S0RA 2LH0A 1V86A 5L83A 3DBRI 4KHPM 3GLHA 3VR9B 2QHOA 3NVVA 3U30A 1EFUB 2ON8A 1MEMA 2O01F 1G3IA 3HY5A 1EWMA 2R9FA 3L08A 1VJKA 4GSWA 2LUMA 2K39A 4PYUA 1IXSA 2FCSA 4DV6M 3UK6A 2L0TA 1HZ5A 2WDRB 2JUOA 2QSDA 3AM9A 3QJ3A 4XGAB 3ZDMC 4GB9A 4US9A 4ANVA 1PGBA 1UFZA 2NBUA 3OLMD 1O0EA 1F2RI 4RGTA 3U52E 4MT5A 4MH0E 4Q7JA 1E8YA 3P4PB 3EIEA 2YEPF 1ZOYB 2DAJA 1OEYA 3N1ZC 2Z8YM 3TJPA 3M99A 3DFZA 4NSOB 3VH3B 1ZQ9A 1HT2E 2MLBA 3N20C 4OHJA 1OTRB 4CQNA 2LWXA 1G4AE 2J5YA 2KK8A 1C77A 4HCPB 1UNSA 4DHJB 3E46A 5DCNA 5E6NA 4ANWA 2KX0A 4X57B 2KWVB 3BBAA 3DVGX 3BXWA 4QOSA 4LCDE 1EF1A 4EZLA 3AKZA 2WNMA 4HXDA 1SXTA 4CDEB 1WGRA 2JU6X 3W31A 1Q1OA 4ZHPA 3O65B 2MBEA 3V3XA 3WXEA 4WAFA 3B9PA 1RWSA 1ZXHA 2C0YA 1N5XA 4FJCA 3TBLD 4N6EB 3HIZA 3SMSA 3TEYA 2G8EA 5HHDG 2L3ZA 2XK5B 5I4DA 4RH6A 2VHSA 3LDZE 2KTRB 1I4WA 4PS7A 4B3RM 4NNJB 4B95A 3HHAA 3F92A 1R2YA 2DAEA 5AUIA 1RFKA 2DWZB 2QIEB 4HPLB 1QDRA 1GAQB 4GLSC 1FPYA 2QEJC 4ICUA 3D8BA 2LXCA 4FN2A 4W9JA 3H8CA 5LXIB 2AIMA 4DK5A 1HTQA 1WJ6A 4JI0M 2PW9A 3MFGA 4DR2M 4FIPA 2VQFM 3A4SC 2LGSA 4HEOA 1G8PA 5EE3A 5C23A 3HHIA 3SU8X 2B1NA 2C5LC 3PHXB 3R2IA 4DUYM 3GO8A 3I4VA 2RD0A 4PDIA 3RNCC 2WDVB 2PREA 2O25A 2Z4RA 1NNJA 3B89A 4B3SM 1KFVA 1YK8A 3APDA 1W5TA 4LZZA 4YSYB 2ACZB 2C96A 3IXSA 4BOSA 3E21A 3MHVC 1AU4A 2JVCA 1SP4B 3KLSX 1E10A 3GPXA 5CVNB 2DAGA 1C4PA 4G50A 3QJZA 4FJVB 3LVVA 2FRQA 1ISNA 1EWCA 2WBFX 3M6AA 2EKKA 4MB7A 3FRIA 2KVZA 3H1UA 3CF0A 1E90A 1Q39A 1V81A 4L1BA 3C9EA 3ZQJA 3M95A 4XWTA 2GNOA 4LY6A 3NUHB 4AQ7A 1QMYA 4GDLA 2FFJA 2Z59B 4JX1C 2LZ6A 3HHWA 1P7EA 3MC8A 3D32A 3B21A 3PZ8A 2HL7A 4C80A 1GC6A 4YYVA 2JNHA 4W9HA 2K8HA 2DAKA 1CV8A 1NBFC 5LMNM 3LCVB 4TUWA 4HJGE 1L0XB 2K0PA 1BMLC 3NHEB 2V0GA 1YLAA 2Y5BA 3UGBB 2CV1A 1FNNA 3ETRA 1R4MB 4HWIB 1QLBB 1GOZA 3AXCA 3ECIA 5BMIA 1WM2A 3B2FA 4YYWA 4AKHA 3PNVA 2KKCA 3EFUA 1UGMA 3VUWA 2GI9A 1MS6A 4M9SA 1TS4A 4XDCA 2FQ9A 1R4GA 3L2AA 3J2PB 3SBJA 4DR5M 4JWUC 2R4JA 2K6BA 2AYNA 1WXQA 2VRRB 3ZNHB 3MHSD 3W68A 2GBRA 1JR3E 3P4SB 2YJBA 3BK1A 2MP2A 2RMMA 3DHIC 1KTKA 4LNFA 4A5UA 2K25A 3CIRB 1YX5B 2KNAA 4IWQA 2DC8A 3CF2A 4NSRA 1KH0A 4M01A 2DLBA 4FBJB 2KLGA 2Q5WD 2KFKA 2L6OA 4HKZE 1KFUL 2B1MA 3I9V1 2JA2A 1IBMM 5E6OA 2C60A 1E9SA 3RZWC 3U7ZA 1AYVA 3TPZA 4IWOA 5JA7A 3J81S 3MTNB 3KS4A 4JYAM 3SHQA 4YYSA 3U8EA 2KW0A 1SE4A 1V5TA 2OOBB 2VH1A 4RF1A 4B7HA 3ZO5B 3DQVA 1TH4A 1BGOA 3D6SA 4K0KM 1WGLA 4IBFA 1WH3A 2LEKA 4I04A 2DC9A 4N4ZA 1KHPA 2MSED 1TH3A 2DNFA 1KXRA 3CGWA 3X23A 3SFDB 2HXZA 3VXWA 3VR8B 3VK7A 2IJ0A 2YJ8A 2AUXA 3MHSA 3TWKA 1TYGB 2QNJA 3RD2A 1BP4A 2HH5A 3VDUA 3PRMB 4CO7A 4CZWA 3VRAB 4IJFA 5FTNA 4DR1M 2DHRA 1D3ZA 1XF5L 1K52A 3AEGB 2R9CA 1VZ7A 3U2SC 5BR8M 1NI2A 3OWEB 3RPFC 1WRIA 4N59A 2K6QA 1YJIA 4FADA 4FK5A 3KWVA 3P5UA 3SYLA 2N7DA 2F5PA 4YV8A 1DO2A 1BXTA 4PD2A 3A45A 1WHCA 2KMCA 3PV1A 2DZJA 4M0DA 2RGHA 3WALA 4IJEA 3ZRCA 3B7NA 3SASA 4I6NB 1U9XA 1DGHA 1DOIA 2WXLA 1E0ZA 1ZMUA 4WQMA 3KYCD 3AEEB 1C4CA 1YZBA 4G4NA 2DHZA 1IY0A 3B7QA 3RFZB 3GP1A 2J7QC 4K3BA 2HCBA 4YT0B 4G3OA 3HJ8A 1L5PA 5FR6A 2KNBA 1WX7A 2KTFA 5DNYA 2WQYB 1IP9A 2DYBA 3NVWA 4MGHA 2DZKA 2ZW1A 3PS6A 2FTDA 4ZDVA 1GVNA 2LFIA 3T38A 3J7AS 5ITQA 2XU5A 3VUXA 1GO5A 4S12A 1EWYC 3GZNB 4JPSA 4HROA 1XCTL 3AE4B 5EE0A 1NSFA 1ZIVA 4AW4A 4DR4M 1WF9A 2W54A 2CB5A 3S3RA 4AI6A 2LGDA 3GLGE 3APFA 4I05A 2WXJA 2PKOA 4AJWA 4I6LB 2AHMA 3HX3A 1WGGA 3RNBC 1VSNA 3Q6BA 1BT0A 1GJZA 1WIVA 4W9FA 2MHJA 3LQQA 2JXXA 4DUZM 3IV2A 3HU1A 1CK1A 1VDVA 4YTMB 2LVPA 4IWPA 4W5WA 1QOBA 4LFCM 4BKSD 2LHGA 4NQKE 1D0LA 2DZNB 3MTVA 5JI3E 2AEHA 1I4XA 2RKOA 3R8FA 3JW0X 4LNKA 2MBBB 1N75A 4KZCA 4DV1M 3WANA 3ZVVA 3U6CA 4RM9A 1NVMA 3A9KB 5JZEB 3KOXE 2MBOA 3DVGY 3QQ8B 4IM0A 3WHKA 2XZFA 1KJTA 1ZMWA 2AL3A 3GS2A 3HUIA 4J3OD 1TIFA 2LRWA 2IZVB 1ZPSA 3A9JA 4HJKA 3H7PB 4D8EA 3SHFA 1TJEA 2GBNA 2BTWA 1V8CA 3PVLA 1XWIA 1Q10A 2WXNA 2APLA 2VZKB 4X66M 2M17A 2GBJA 2P7UA 4GOCA 3BVGA 3HGIA 4E3CA 6PADA 4P7IA 2JRIB 2JXNA 3RE8A 1V34A 2EKFA 3U6QA 4RGNA 3RVXA 1YE9A 1CTEA 3GE3C 1JWAD 1N63A 2MH8A 3QWLA 4YYUA 1KOTA 4QNRA 3TWMA 4DV4M 3CBKA 1YSYA 2BS4B 1NV8A 4ZPXA 2R2QA 4BKSA 1QXPA 1V80A 1OFHA 4DR3M 3E4RA 4XWWA 2D10A 4IKGA 3GRRA 2R65A 1ZMVA 3GLHB 1SBBB 2QHOB 4FVMA 2KZRA 1PJSA 1VG5A 2ZPNA 3ZGZA 4BPVA 3VVWB 4NL4H 2KDMA 3PSEA 1LM8B 1IXSB 3PHWA 1SXJA 4KLBA 3Q3OC 4TV3A 1WIAA 4I5SA 3WIMA 3OF9A 4DMYA 1KM7A 1OQRA 2HHHM 3P1MA 2ZBKB 2XU4A 4A20A 2V1UA 1T43A 3L10B 3K2LA 3L29A 2Y6EA 1CZPA 1QANA 2W82A 2CR5A 1CSBB 4KIKA 5LNK1 4TKNA 4EKUA 4DXAB 4FWGA 1PYWD 1OJLA 4DR7M 3N3GA 4BBAA 1K51A 5DPRA 4C00A 4N58A 4X6IA 2WXKA 1XCQL 4AXLA 2BNKA 4GMVA 4Q8GA 2BGFA 4XDDA 1NB5A 2P5TA 3HU2A 2BYEA 3N30A 4ITKA 4ZYNA 3MJ5A 3Q3FA 1IM2A 1VR9A 1NDDA 2JY7A 2CP8A 3ILKA 3PLVA 4F8CB 4HXDB 3SFZA 1D5ZC 2WU2B 1XQQA 4IBDA 3T6PA 1UZXB 5IP4D 3RNFC 4KGSA 5ITUA 3KUZA 4P16A 3SARA 4WQOB 3N3KA 3HHXA 1IXRC 1HE8A 2KA6B 2KWCA 4KGTA 1L6VA 1F4IA 4N79A 2LHDA 2MR9A 3VH4B 4XR7A 1XHBA 3NVYA 3KOWE 2ATOA 1GABA 3EUB2 1NNUC 4LJ6A 4BOZA 1FM0D 4NAMA 2YLMA 3IAS1 3QYBA 3FTCA 2DCDA 4IBGA 3M62B 2PLPA 4RMAA 4WP2A 2LVQD 2J7NA 3U6MA 3V6EA 1TH2A 2O6VD 3SD5A 3ZYYX 1MHWA 1XXHA 4PP1A 2DYOA 1GLNA 4JGHB 1C1YB 3IUTA 3VTUA 5IO9A 3IHPC 3RZFA 3HVZA 1R4MI 1QAMA 5GMVA 3ZUAA 2CHWA 4QAYA 3K9MA 1L2CA 4XBOA 2ICIA 1CJEA 3KW5B 2WXFA 4DXFA 2J42A 3A98B 3Q8EA 4JIOU 5BYRA 1U9WA 3PRPA 1J19A 3VDZA 1PPNA 2KHHA 5DFLA 5EJCA 1E7UA 2QMTA 2XNAC 3OF8A 4XZ4A 1T6BX 4OVZA 3I5JC 4GDLB 1DO0A 1QZEA 3GB1A 1A6RA 2V4LA 1D4BA 3PT2A 1QT9A 1AU2A 5C3JB 1PE6A 3IFUA 5G55A 4MGYE 2NBVB 4KGRA 1YIWA 1K50A 2G7YA 5C2TB 2UXCM 2L4EA 3ZLZA 1TS3A 2DJGB 5CVMA 4AP4C 2GBKA 2Y5BB 1I4GA 2J4XA 2O6VA 4M0WA 4B3MM 5EF4A 3ZJVA 4L8RC 2WXMA 1WYWB 1UM8A 1W5SA 1WX9A 4DR6M 1WSPA 4I4LA 2CJNA 2J52A 3DHHC 3OVZA 5E26A 2K22A 1ME3A 2KAJA 3RGPA 1GECE 3TEXA 3EA6A 2KDIA 1YX6B 2VQEM 4A8XC 3P5WA 4IBEA 3R2TA 3RT3B 2HHNA 3FILA 3U6LA 4DV0M 3RVVA 2K9DA 3QK0A 3O1GA 4B9KA 3OG5A 1GPXA 1JMLA 4EZJA 1EIJA 2DCAA 3Q8AA 3L17A 2E02A 4A9AA 2MP2B 3H6SA 1R4NB 2R18A 2R61A 3BVZA 2V3NA 5AZFA 3FYDA 2DYMA 4JL9A 2XU3A 2HWKA 2WS3B 1YMHE 2DENB 3WXFA 1V49A 1JROA 3CF6E 1LGRA 2KFKB 2JWZA 3GE8C 2I2YA 1NV9A 2N7EA 4LNIA 3R7QA 2FNAA 1TR8A 1FNWA 2DWNA 1SNKA 2OULA 4L78A 1NPZA 4CYEA 3ENEA 4KX6B 4LF7M 1TTEA 2F7DA 2BU3A 2W9NA 3ABVB 3A4RA 1FFUA 3PREA 2DZOB 1P9DU 2C7MB 3BC3A 1C78A 5LLIA 2RDBC 2UWQA 4TMAB 1V6EA 1Q0WB 2PVOD 2FYEA 4C7YA 2CE7A 5FKAC 2FUDA 1QOGA 2Y0QA 1TY2A 3OISA 2VHFA 4MJSA 4LNNA 1E7VA 3QAUA 2YJ2A 1L2DA 1WZ3A 4AQYM 4LJAA 5BYQA 1K82A 3R7RA 4AS1A 3L26A 1EF7A 2AS8A 3F5VA 4OZCA 2J0JA 3QT4A 1P3QU 4TQ0A 1NI3A 2J53A 5CHVA 2L09A 2KOXA 1V33A 2BDLA 3GZNI 3O0UA 5AZGA 1UWXA 2BT6A 2VH2A 1WXSA 3ML8A 5FLXS 2QP9X 4P1CC 2ZCCA 1OAIA 1OIZA 4W9DA 4KVGB 1JWUD 1FD6A 1TT5B 3CH3X 4GITA 1F77A 1WMHA 1ZXIA 1WR1A 3BPFA 2WX0A 2XSZA 1I7HA 1GJTA 3EGRA 3Q3MC 4TSSA 4KKIA 5KHOA 2BJVA 1R7SA 4PK1A 1IN8A 4NOOB 1L6UA 2QDFA 1IYFA 4HWYA 3C58A 1I94M 2UUAM 3MJWA 1BVSA 1HQYE 4XC2A 2BYTA 4XX5A 1POPA 5C1ZA 4GMQA 5HI1A 2JRHA 5FPWA 3LFYA 4GRIA 3DHGC 1PADA 3CSTA 2N9LA 3IMAA 3DDCB 4JXJA 1AWDA 3P5VA 4HCNB 2SAKA 2I7PA 3GPYA 1E5WA 4EEWA 2NPTA 4D2KA 3SFEB 2YJCA 2AQ1B 1QOFA 1TGUA 3AMZA 1PGYA 2DCBA 1JR3D 1NHWC 2WLBA 3EC8A 3DPDA 4LDTB 3TCAA 1S1QB 1SE3A 1UUPA 2IO3B 4K7SA 3T8MA 1CJLA 3AE3B 1FNUA 3SMPA 4G54A 2Z84A 5ITXE 3SAWA 2M0XA 3E9SA 1N77A 4HDOA 1PPOA 2XLJA 3GLHE 2ZVOA 4X62M 1T5XD 2LJ5A 2NCNA 1WGYA 4DV7M 4AG6A 3KSJA 4LFBM 1UBIA 3AOGA 4BOUA 4QHSA 2ZTCA 2KQ7A 3H6NA 3PLUA 2YFQA 3KWLA 5D3IB 4DWFA 2JSVX 3A33B 2M5ZA 1N36M 1JCKB 2FUHB 4K1RB 3H7DA 2BYVE 5G2NA 2ZJDA 3Q8XA 2AUZA 4NJ6A 3FUWA 2DI0A 2DKLA 2X4AA 1QILA 4L2YA 4US8A 1EF5A 2WDTB 4JQWC 1L4ZB 3B1LX 3QHTA 1SIFA 3AN1A 3H8HA 2K3UA 3E1ZB 2QPAA 1IBKM 3GLIA 4YVAA 1C3TA 4R3DA 3E56A 1QDTA 3M7GA 3A9JB 1UH6A 4K81A 3PHUA 2BTWB 1XLOA 4EE2A 3KKUA 4CGYB 3GQ5A 1YQBA 3M0EA 3GOEA 3ML9A 3LJ3A 1D6EC 3KVFB 5H92C 4XZXA 3GRYA 2B76B 4KLNA 2KACA 3PGEA 2YNMD 2PEAA 2E01A 4IM3A 3PW3A 3SHGB 1I42A 2EUCA 3WHLA 3JAMS 4A3OA 9PAPA 2DWMA 2MJ5B 3B74A 3U6PA 1CS8A 2JZ1A 4RM8A 4LJ5A 2GLSA 3MHZA 1QUTA 2B3AA 1E9MA 3PNRA 1R6BX 1QYRA 2RPQA 3K8ZA 3VFDA 4OZBA 3HRDD 2O2VA 3QWZB 1IFYA 2CV2A 4WURA 4CJ6A 4LLGM 2N9KA 2LWPA 2LGXA 1I4QA 3AU5A 2ZTDA 2JWSA 1D0KA 3SDLC 3NZUA 3PSEB 3UF8A 5HG2A 2K0BX 2Z7JA 4I8OA 3PHWB 3CBJA 1SXJB 1MX0A 2D3AA 3U5ZA 4WH4A 2CWBA 2LBCA 4EIWA 4FA6A 3IOQA 2DWQA 2FNJB 2K5PA 1NQCA 1EU4A 2RDGA 3MORA 1RU3A 1IN7A 2GBMA 3JR5A 2ASQA 1C1KA 3KQ4A 2DVWB 2BB5A 2Z0DB 4LRTA 5EP2A 2LGIA 4KIKB 2W55A 7CATA 3Q2AC 1N62A 4G3XB 3FE3A 3C3DA 2FCQA 2AGAA 4NXNM 3J27B 3UGJA 1QAQA 1L2NA 2KZSA 1E9RA 2WU5B 2F5SA 1L2BA 3L54A 2V3SA 4BAXA 2KVRA 4G4RA 4NAWA 3BBZA 2ZANA 4YWGG 2DZLA 3K9PA 3U61A 2J0KA 3WAMA 2CHVA 3PXGA 4F2LA 1VQ1A 4GIPA 3GQ4A 2M0AA 2JPHA 2INPE 1Y8RC 3PTFC 3AI8A 1IY1A 3IEJA 3GLFA 2N7JA 4EZKA 3H9DA 4USAA 1VCBA 3N3KB 4PP2E 2WYQA 2R4EA 5FTMA 4D80A 4ICVA 2F5OA 4RKUF 3KWBX 1ACCA 1PQSA 1SB3C 2MWSB 4N9F4 3X0WA 3Q8CA 2RSUA 2Z3XA 4BVUC 2LVOC 2V1CA 3I3TA 2Z0EB 4BOZB 2JZPA 1NVID 5A2QS 2IYDB 1UGJA 3ZC7B 5J94A 4BB9A 3HM6X 1PPPA 4WJPA 1HNZM 2DOSA 4AJYB 2G9HD 2A5YB 1AYFA 3KW6A 3AE8B 4A3PA 4MM3A 3V6EB 5KQ8A 2QZ4A 2BS2B 2QBYA 1XXHB 1DOYA 2C98A 1ME4A 3AFHA 1N32M 3HJSA 2LJIA 3MC0B 3U6EA 3P5XA 1N60A 1Q3CA 2I7NA 4DBGA 1HUCB 4K3CA 4LTUA 4FULA 4IW0A 3DWMA 4EOYA 5FTLA 1GCBA 2YVCA 1K53A 3ZNID 1V9JA 1PFDA 3QYEA 3LCUA 2L00B 3KXEC 3FAHA 3AE5B 3PRPB 2X8XX 4BS5A 3L25A 1WWTA 2BQQA 3W5UB 2F4VM 3K1JA 3T9LA 2AU1A 4TQ1A 2QQ8A 3BINA 3GRUA 5BO4B 3P2BA 4OVZB 2WXIA 2X38A 2KJHB 3DOWA 4MSMB 1JQPA 1EM7A 3BWKA 4IBKA 3PT2B 5J17A 3HKPA 2CS4A 2JYEA 1WGDA 2WSCF 2KN4A 4WWMA 1NY6A 2BWEA 4TUUA 1E32A 3QAQA 7PCKA 1KYIA 2MJEA 3TEWA 2HTME 4P6VF 1OKSA 1UD7A 1KSFX 2UZJA 3AE9B 4DXGA 4K7UA 1PBHA 3L0WB 5E6PA 2CFOA 4NRVA 1MJGM 1XEEA 2C99A 2O6VB 4M0WB 1EU3A 3V76A 2MEKA 1BQIA 4MDKE 5IZ7D 3LXSA 2K8BA 2CUZA 1MHXA 4BZAA 4J6IA 4K7CA 2KDEB 2N35A 1RM6C 2D3GA 3MK6A 2QSFX 1RLFA 1DYQA 5DPWA 1VEGA 1NHGC 1WI0A 1FXTB 3FILB 4L4UA 1E8WA 3PZ7A 2CKHB 2Y0TA 5DYIA 5GXGB 5H37D 3ZUNA 4KZ0A 2XF3A 5DYGA 1TS5A 1D5XC 1V2YA 5AZHA 2IGDA 3O65A 1TS2A 4B7FA 2PTLA 3H4MA 3I57A 3DBLB 2R6NA 3BOWA 2KT7A 2H7JA 2LD9A 2KEBA 3AEDB 1HT1E 4JN6A 1F0ZA 1FNVA 4LGYA 2FIDA 3W9CB 2IDYA 5IAAC 2F1GA 1L8QA 2ZPYA 2O6XA 1SIJA 3APCA 1MDWA 3VK8A 1XNQM 1AECA 2DXIA 4LF5M 2KYWA 3DCGA 3ZJTA 2Y3AA 3L13A 1PCIA 1JRUA 3OTOM 4IIWA 3BYYB 2Q2EB 4B0MA 3ZJUA 1J7AA 2WGSA 5D2MB 1FH0A 4RNAA 3RCZA 3VTWA 3BZDB 4W9GA 3IAM1 2LASA 4QRGA 3ZNGC 2J7QA 2L83A 3ZXVA 4AWJA 4MZOA 2D5GA 4JLCA 4DMXA 4B6WA 3VFKA 3LYYA 2RPVA 2K8CA 1YQ4B 1SXJC 1FRDA 1ZW7A 5JXVA 2FT2A 4LGMA 5KPRA 1CUKA 1PDXA 4A6QA 3V62A 2X8AA 1TDZA 2ZEQA 4KV2A 5TSSA 5FTKA 2H88B 4W9CA 1U5IA 2ZZPB 2GRIA 4IOIE 3HU3A 4G4OA 2WXQA 4KSLC 4ZRIA 1MN3A 3GRVA 4MJSB 1WZ0A 3U8ZA 3O13A 4L15A 3KW9A 3HD3A 1QQRA 2FRAA 3BVMA 3AE6B 1RAXA 1T0QC 1WGHA 4AXMA 1CQDA 3FTFA 1B9RA 2JY5A 2V6ZM 5JHBA 3A1QA 1C7YA 1XB2B 3SAVA 4WA6A 1QF6A 3D8LA 5L95C 5E6JA 4P1BC 4JI2M 3LB8C 5KPTA 2K6DB 4AUQC 1J7CA 4HPPA 1E6EB 2MW5A 5EE1A 2RR9A 1FRRA 3I4YA 3TIXA 8PCHA 1E94E 2G6DA 4PADA 4BFRA 1IPGA 1FXAA 4PYZA 1XNRM 2Z8LA 3B08A 1WMHB 5EZSA 3Q69A 3UINB 3EECA 1WR1B 3VAWA 1DF0A 1F2AA 3IG5A 2IGHA 1NY5A 4OX9M 2EELA 1H8CA 3KX1A 3TWLA 1AARA 3QIJA 3JR4A 4MH8A 2VDBB 2CU3A 5EZQA 3KDSE 2L32A 3SYKA 4KT0F 2XU1A 1MVKA 3R8BA 1XLPA 3IG3A 1RFAA 2L05A 3ZRFA 4FHKA 5IKCM 1TLOA 2R9MA 2EMSA 3W1SC 3NRZA 4B7GA 3NBIA 1MJDA 4P17A 3CH2X 3TRKA 4D8IA 4A3VB 1FCLA 3LQRA 4RGMA 1J09A 5KQDA 4GIVA 2UUCM 2NPTB 1NB3A 1IBXA 1VEKA 1OFFA 4FD2A 4YSZB 3UIPB 1DKIA 1JRPA 3LVWA 1LO5D 1R7RA 2ZNVB 4GUAA 4JI5M 2KJRA 3QX1A 2LTUA 5D3DA 4O1NA 5CVOB 4M02A 3P42A 3MTNA 3W0FA 1D2NA 1S3SA 2EKIA 2CRUA 2IPKD 3K8UA 1NJGA 2MA9B 2KHWB 4II2B 2RRUA 3AV8A 5EXSA 4I07A 4II7A 1IUEA 1NENB 1WRDB 4KKJA 3R66C 4JI7M 2OQ4A 4IDIA 4LRSA 1FEHA 4FJYA 3UI3A 1PJTA 4JI8M 1KRHA 4ZRQA 1UKFA 1TGZB 1I4RA 1KLGD 5K16A 3FKEA 3TL4X 3NOBA 1SXJE 5J2RA 3KVWA 1K3XA 2WP9B 1XT9B 4GGQA 2ZM6M 1C9FA 2E03A 2JYTA
chains in the Genus database with same CATH topology
1TDHA 4IP3A 3GLIB 2C5RA 2G1EA 2PVGC 4QOZC 5G5GA 2AQ3B 3I51A 2O5RA 2QCUA 1HXYD 4XGIA 3DA1A 4X65M 3P4RB 4HLQA 1YN5A 4RFBA 3DWGC 3VKGA 2FUG1 1FMAD 3TSSA 4FCVA 1Z59A 4RF0A 4Z8XA 4B08A 2XFSA 1KF6B 1P7FA 4FWDA 4GC5A 1QOAA 1JWMD 3FUUA 3W5VB 2KMMA 3SEBA 3SR6A 1HQRD 3U5ZB 1LV7A 2CJOA 2K47A 4OU7A 2W3SA 1XLQA 1ESFA 3VLFB 4ARIA 1SJHD 4NRWA 2BB6A 2X49A 4LCBA 3PO0A 3W2DA 4AKIA 4H2AA 1YNTE 4C7ZA 3A42A 4D82A 5F3WA 1Z5CA 3U61B 4CHTB 3P4QB 2NMQA 2D7GA 2J7OA 1BUIC 1DGJA 3WCQA 4RCOA 2C9OA 1CQVA 3W30A 4PT5A 3GLFB 3AV0A 3W0LB 2WXOA 3CWIA 3MP9A 4HRSA 1OQQA 1YN3A 1K3WA 3IG8A 1N78A 3DZDA 4FW9A 1T3QA 3C0RA 1HR0M 1SJED 4AKGA 1ZDXA 2G5GX 3A46A 3U60A 4FCWA 3OQCA 2UXBM 4M9ZA 3AOEA 4IBBA 1XXGA 4MM3B 5IREB 2QBYB 4KO8A 3HVDA 1JALA 4JI6M 1KLUD 4QHTA 2LNHC 1D5MC 1QAOA 1HQCA 4JE3B 3IT6B 1SEBD 4YXDB 3AE7B 4GHLA 3FC4A 3TUOA 1DGHB 1L1ZA 5GKNA 1V1OA 1JQJC 1TY0A 4LF9M 1TKYA 5EP3A 3DOAA 2MH7A 2PMVA 1L1TA 5MPOA 4IBCA 3VRBB 5EXTA 2XGNA 3ZH9B 1WGKA 5C1BA 3KSXA 1FIQA 1RYJA 1TZOA 4IBIA 1L4DB 3KOYE 1OFIA 1AN8A 1J5EM 1N61A 4MGKE 2EO2A 5EE9A 3KS8A 5ITRA 4MACA 5KPZA 4NZLB 3U6SA 4HEA1 3UJNA 4FXCA 4ZTBA 1I4PA 4GHAA 1QQWA 2HDEA 1HA5A 3AEAB 4ZYSA 2E5LM 3ZCBB 4HL4A 1JWBD 1GL7A 5HFYA 1XC8A 3VKHA 1N34M 3FUTA 2CV0A 1JR3A 5BPVA 4X64M 3L28A 2OPFA 5FR3A 4R7GA 4Z6YA 2QILA 1IN5A 4GKKM 2CHQA 1V1PA 4MGZE 1M4VA 1GB1A 2KQ4X 5T8IA 1FO4A 1NYRA 3K92A 3TMPA 3AH7A 4CISA 1YN4A 1L0YB 1VZ6A 4JI1M 3BK2A 4JWSC 1G41A 1XMQM 2XEPA 2I38A 2K9XA 1YQ3B 1ET9A 2KZUA 3BWUD 1GKIA 2R62A 2XFTA 5IT9S 2L7IA 1ENFA 3KOZE 5FTJA 1IN6A 1AW7A 4IUMA 4XE0A 4D8BA 4JV5M 1C4AA 3AE2B 3T1HM 1HEZE 2KRUA 2PIAA 2WDQB 5EP4A 1G59A 3NS1A 4YSXB 2JX5A 3U6OA 2RGOA 1YUBA 2YQZA 1IBXB 1ZDVA 3C8YA 1DOXA 3L4PA 4REZA 2D7HA 3R9XB 4JI3M 4ZHOA 2UUBM 1VDDA 1HNWM 1H6UA 4OZAA 1VZ8A 2RDHA 5KO3A 2HKJA 2INNE 3GPUA 1FFVA 3RGSA 1NYQA 1STEA 2LMCA 1JW9D 3LMMA 4I81A 2WXGA 4AZFA 3BY4A 4WW0A 4LK0M 3GLGA 1NEKB 2MJDA 2CHGA 3NWLA 1XLNA 2R45A 1FJGM 1NJFA 3PNYA 3FUVA 4DQOC 2XN9C 2GB1A 2L7HA 2M19A 1QZMA 3PFIA 2N0SB 1JWSD 4KODA 2OHFA 3L27A 1N5WA 2R46A 1PGAA 3AL0C 1PVJA 3FD9A 2TSSA 3VDPA 3HHYA 1X37A 4UDUC 1PM5A 5ITYA 5AUKA 2NTTA 3IT4B 4MGIE 2AX5A 5IWAM 4A55A 1E7PB 3VQIA 2BW2A 1UWMA 2Y21A 1C79A 5FK9C 2ZW0A 3FTDA 3HHZA 1MPEA 3TE6A 4YY3M 4Q2JA 2BTEA 2YR0A 3GPPA 1DGGA 1WYGA 2XH9A 1J7KA 1Y56A 2ZAOA 1EE8A 2FBWB 3PHXA 2JWUA 4NXMM 4ARCA 2F5QA 4BOQA 1J7BA 3P63A 1IXZA 2LHEA 1IQPA 4DV3M 1C76A 5BMHA 3AEBB 3PVSA 2F5NA 4HKQA 1SXJD 1Z5BA 4YHHM 4LF6M 2WXPA 3UZUA 3GQ3A 4LF4M 3J9CA 2E3TA 2BJWA 3THGA 1GL6A 3T1YM 2VIIA 1ORYB 2FE8A 3U60B 3B9JA 4FWHA 3TEZA 3BYTB 3Q8FA 4L16A 3B2GA 3URYA 4IBJA 4PCZA 5FSWA 1MU5A 4B3TM 3BIID 1N33M 1L0VB 1JQ4A 1XMOM 1B1ZA 2AQ2B 1TKGA 4LJ8A 4JI4M 4B0EA 2M56B 3RNVA 4G4QA 2L52A 3AECB 2BBCA 2Y5PA 2KWDA 4LF8M 1PJJA 2JTCA 4NJCA 4WIPA 3BB7A 2L1AA 2ZAMA 3HWSA 5G5HA 3ZNHA 1IBLM 1HZ6A 1I4HA 5EP1A 8CATA 4BOPA 4LFAM 1Z5AA 1ZUD2 2Y5CA 1YJJA 2DWLA 2E6XA 4YTPB 1Z6TA 3CTWB 3U6DA 3SAUA 1TKEA 5LMUM 1VLBA 2QENA 1FXIA 3T3NA 2M60A 1IY2A 4DV5M 2NQ8C 5EXXA 1V97A 3Q8BA 2ONQA 3TQSA 2LXEA 2UXDM 1MI0A 4ZRPA 2IGGA 2SEBD 4LJ7A 2XZUA 2JQRB 2Y20A 4LJ4A 5EQTA 1T3TA 4RGOS 4G6ZA 1IN4A 3PRMA 2UU9M 3SC3A 3N9YC 3W1SA 2CEAA 3U4EG 1R2ZA 2WXRA 4M9XA 3FYCA 4LG2A 3AE1B 2H1RA 4L23A 4GDKB 4LJ9A 3LXFA 1V1PB 1F2RC 4ITQA 1SSNA 2OEDA 1ZE3D 3T3OA 2KRKA 3ZQ4A 3NVZA 3AJIB 1IGCA 4C56C 2G8LA 3AEFB 4A90A 4GKJM 2JXTA 1GB4A 1QKZA 2C9CA 1MHHE 3KP1E 1Q3BA 2V3PA 4YTNB 1DGBA 1VRAB 4MI7A 5H8YE 2Z4SA 2NTSA 4DV2M 5EXPA 2VZKD 3EIHA 4PDGA 3RFWA 4BLCA 5BYSA 3GP7A 2MJ3A 4GC9A 5BMGA 3FUXA 1HNXM 3FTEA 1QVRA 4D81A 1SE2A 4ZOHC 4NAWB 3AOEC 4GH9A 4QNMA 3J7BA 1ET6A 2H89B 2FOIC 3AB5A 5C18A 2ERCA 1ROEA 4AG5A 1ZAEA 4LZJA 5JI2E 1PGXA 1XO3A 2D7EA 2KXEA 5JZEA 3V05A 1PUTA 3UMMA 3HJQA 2W3RA 2BS3B 3BOSA 1DGFA 3SATA 3MP2A 2EA0A 2XSZD 1PJIA 2V4IB 1SF0A 3T15A 1FCCC 5ITTA 3J80S 1A70A 1ZP0B 2JRIA 1KFYB 3NZ3A 3KP0E 3KFUG 1IGDA 3GLGB 2WXHA 4FCTA 5D7GA 4OW0A 2QJLA 2DBYA 5ITXA 2YEPB 2LH0A 4KHPM 3GLHA 3VR9B 3NVVA 2ON8A 1G3IA 1VJKA 2LUMA 4DV6M 3UK6A 1HZ5A 2WDRB 2QSDA 3AM9A 4US9A 1PGBA 1F2RI 4RGTA 3U52E 4MT5A 4MH0E 3P4PB 3EIEA 2YEPF 1ZOYB 3DFZA 4NSOB 1ZQ9A 1HT2E 4OHJA 4CQNA 2LWXA 1G4AE 1C77A 1UNSA 3BBAA 4QOSA 3AKZA 2WNMA 1SXTA 2JU6X 3W31A 4ZHPA 3V3XA 4WAFA 3B9PA 1RWSA 1ZXHA 1N5XA 4N6EB 3SMSA 3TEYA 5HHDG 5I4DA 4RH6A 1I4WA 4B3RM 1R2YA 5AUIA 1RFKA 2DWZB 2QIEB 1GAQB 4GLSC 2QEJC 3D8BA 2PW9A 4JI0M 3MFGA 4DR2M 2VQFM 1G8PA 5EE3A 3R2IA 4DUYM 3GO8A 3I4VA 4PDIA 2WDVB 2Z4RA 1NNJA 4B3SM 1KFVA 1W5TA 4LZZA 4YSYB 2ACZB 2C96A 3IXSA 4BOSA 3MHVC 3KLSX 1E10A 3GPXA 1C4PA 3LVVA 1EWCA 3M6AA 4MB7A 3CF0A 4L1BA 1Q39A 4AQ7A 4XWTA 4LY6A 3NUHB 2FFJA 4JX1C 3HHWA 1P7EA 3B21A 3PZ8A 2HL7A 4C80A 5LMNM 4TUWA 4HJGE 1L0XB 2K0PA 1BMLC 2V0GA 2CV1A 1FNNA 3ETRA 1QLBB 1GOZA 5BMIA 3B2FA 4AKHA 3PNVA 2GI9A 4M9SA 1TS4A 4XDCA 3L2AA 3J2PB 3SBJA 4DR5M 4JWUC 2R4JA 1WXQA 3P4SB 3BK1A 2RMMA 1KTKA 3CIRB 3CF2A 4NSRA 1KH0A 2DLBA 2Q5WD 2L6OA 4HKZE 3I9V1 2JA2A 1IBMM 3U7ZA 1E9SA 3TPZA 3J81S 3KS4A 4JYAM 2KW0A 1SE4A 4RF1A 4B7HA 1TH4A 4K0KM 4IBFA 2LEKA 1TH3A 3SFDB 3VR8B 3VK7A 2IJ0A 3TWKA 1TYGB 3VDUA 3VRAB 4IJFA 5FTNA 4DR1M 2DHRA 1XF5L 1K52A 3AEGB 1VZ7A 3U2SC 5BR8M 3OWEB 3RPFC 1WRIA 4N59A 1YJIA 3KWVA 3SYLA 2F5PA 1DO2A 1BXTA 4PD2A 3A45A 4M0DA 2RGHA 4IJEA 3SASA 1DGHA 1DOIA 2WXLA 1E0ZA 4WQMA 3AEEB 1C4CA 1YZBA 4G4NA 1IY0A 3RFZB 3GP1A 2J7QC 4YT0B 2HCBA 3HJ8A 1L5PA 5DNYA 2WQYB 3NVWA 4MGHA 2ZW1A 1GVNA 2LFIA 3T38A 3J7AS 5ITQA 4S12A 1EWYC 4JPSA 4HROA 1XCTL 3AE4B 5EE0A 1NSFA 4AW4A 4DR4M 2W54A 4AI6A 2WXJA 2PKOA 2AHMA 3LQQA 4DUZM 3HU1A 1CK1A 1VDVA 4YTMB 4W5WA 1QOBA 4LFCM 2DZNB 3MTVA 5JI3E 1I4XA 2RKOA 3R8FA 1N75A 4DV1M 3U6CA 1NVMA 3KOXE 3WHKA 2XZFA 3GS2A 3HUIA 4J3OD 1ZPSA 4D8EA 3SHFA 1TJEA 2BTWA 1V8CA 1XWIA 1Q10A 2WXNA 2VZKB 4X66M 3BVGA 3HGIA 3RE8A 3U6QA 4RGNA 1YE9A 1JWAD 1N63A 3QWLA 4QNRA 3TWMA 4DV4M 1YSYA 2BS4B 4ZPXA 1OFHA 4DR3M 3E4RA 4XWWA 4IKGA 3GRRA 2R65A 3GLHB 1SBBB 4FVMA 3ZGZA 4NL4H 2KDMA 3PSEA 1IXSB 3PHWA 1SXJA 4I5SA 1OQRA 2HHHM 3P1MA 2ZBKB 2V1UA 3K2LA 3L29A 1CZPA 1QANA 2W82A 5LNK1 4FWGA 1PYWD 1OJLA 4DR7M 4BBAA 1K51A 4N58A 2WXKA 1XCQL 2BNKA 4XDDA 2P5TA 3HU2A 4ITKA 3MJ5A 1IM2A 1VR9A 3ILKA 4HXDB 3SFZA 1D5ZC 2WU2B 4IBDA 4KGSA 5ITUA 4P16A 3SARA 3HHXA 1IXRC 2KA6B 4KGTA 1L6VA 2LHDA 1XHBA 3NVYA 3KOWE 3EUB2 1NNUC 4LJ6A 4BOZA 1FM0D 4NAMA 3IAS1 3FTCA 4IBGA 2PLPA 3U6MA 2J7NA 1TH2A 3ZYYX 1XXHA 2DYOA 1GLNA 3HVZA 1QAMA 1L2CA 4XBOA 2ICIA 1CJEA 2WXFA 4DXFA 2J42A 3A98B 3Q8EA 5BYRA 3PRPA 5EJCA 2QMTA 2XNAC 1T6BX 4OVZA 4GDLB 1DO0A 3GB1A 1D4BA 3PT2A 1QT9A 5C3JB 3IFUA 4MGYE 4KGRA 1K50A 5C2TB 2UXCM 1TS3A 1I4GA 2J4XA 4M0WA 4B3MM 3ZJVA 4L8RC 2WXMA 1UM8A 1W5SA 4DR6M 1WSPA 4I4LA 2CJNA 2J52A 5E26A 2K22A 2KAJA 3RGPA 3TEXA 3EA6A 2VQEM 4A8XC 4IBEA 3R2TA 3FILA 3U6LA 4DV0M 1GPXA 1JMLA 3Q8AA 4A9AA 2R18A 2R61A 3BVZA 2V3NA 3FYDA 2DYMA 2HWKA 2WS3B 1YMHE 1JROA 3CF6E 2I2YA 2FNAA 1FNWA 2DWNA 4L78A 4KX6B 4LF7M 2BU3A 3ABVB 1FFUA 2DZOB 1C78A 4TMAB 2PVOD 4C7YA 2CE7A 5FKAC 1QOGA 2Y0QA 1TY2A 3QAUA 1L2DA 4AQYM 4LJAA 5BYQA 1K82A 4AS1A 3L26A 4OZCA 4TQ0A 1NI3A 2J53A 2L09A 2BT6A 1UWXA 5FLXS 2QP9X 1JWUD 1FD6A 4GITA 1F77A 1ZXIA 2XSZA 1I7HA 3EGRA 4TSSA 4KKIA 2BJVA 1R7SA 1IN8A 4NOOB 1L6UA 3C58A 1I94M 2UUAM 1HQYE 2BYTA 4GMQA 5HI1A 4GRIA 2N9LA 4JXJA 1AWDA 2SAKA 2I7PA 3GPYA 4D2KA 3SFEB 2AQ1B 1QOFA 1TGUA 3AMZA 1JR3D 1NHWC 2WLBA 1SE3A 1UUPA 3AE3B 1FNUA 3SMPA 2Z84A 5ITXE 3SAWA 3E9SA 1N77A 2XLJA 4X62M 1T5XD 4DV7M 4AG6A 3KSJA 4LFBM 3AOGA 4BOUA 4QHSA 4A5UA 2YFQA 3KWLA 5D3IB 2JSVX 2M5ZA 1N36M 1JCKB 3Q8XA 3FUWA 4L2YA 2X4AA 1QILA 4US8A 1L4ZB 3AN1A 3H8HA 2K3UA 2QPAA 1IBKM 3GLIA 4R3DA 3E56A 3M7GA 3PHUA 2BTWB 1XLOA 4EE2A 4CGYB 3GQ5A 3M0EA 1D6EC 5H92C 4XZXA 3GRYA 2B76B 4KLNA 2KACA 2YNMD 3SHGB 2EUCA 3WHLA 3JAMS 2DWMA 3U6PA 4LJ5A 3MHZA 1E9MA 1R6BX 1QYRA 3K8ZA 3VFDA 4OZBA 3HRDD 2CV2A 4WURA 4LLGM 2N9KA 1I4QA 5HG2A 2Z7JA 4I8OA 1SXJB 1MX0A 3U5ZA 4WH4A 4EIWA 2DWQA 2K5PA 1EU4A 2RDGA 1IN7A 3JR5A 1C1KA 3KQ4A 2DVWB 2BB5A 4LRTA 5EP2A 2LGIA 2W55A 7CATA 1N62A 2AGAA 4NXNM 3J27B 3UGJA 1QAQA 2KZSA 1E9RA 2WU5B 2F5SA 1L2BA 4G4RA 2ZANA 4YWGG 3U61A 2CHVA 3PXGA 4GIPA 3GQ4A 2M0AA 2INPE 1IY1A 3GLFA 2N7JA 4USAA 2R4EA 5FTMA 4D80A 2F5OA 1ACCA 1SB3C 4RKXA 3Q8CA 2Z3XA 2V1CA 2JZPA 1NVID 5A2QS 1UGJA 3ZC7B 4BB9A 1HNZM 2DOSA 2G9HD 2A5YB 1AYFA 3KW6A 3AE8B 5KQ8A 2QZ4A 2BS2B 2QBYA 1XXHB 1DOYA 2C98A 3AFHA 1N32M 3HJSA 2LJIA 3MC0B 3U6EA 1N60A 1Q3CA 2I7NA 4LTUA 3DWMA 5FTLA 1K53A 1PFDA 3FAHA 3KXEC 3AE5B 3L25A 1WWTA 3W5UB 2F4VM 3K1JA 4TQ1A 3GRUA 4OVZB 2WXIA 2X38A 1EM7A 4IBKA 3HKPA 2JYEA 2KN4A 4WWMA 1NY6A 1E32A 1KYIA 2MJEA 3TEWA 2HTME 4P6VF 1KSFX 2UZJA 3AE9B 4DXGA 2CFOA 4NRVA 1XEEA 2C99A 1EU3A 2MEKA 5IZ7D 2CUZA 1MHXA 1RM6C 3MK6A 1DYQA 1NHGC 3FILB 4L4UA 3PZ7A 2Y0TA 5DYIA 5GXGB 5H37D 2XF3A 5DYGA 1TS5A 1D5XC 2IGDA 3O65A 1TS2A 4B7FA 2PTLA 3H4MA 3I57A 2KEBA 3AEDB 1HT1E 4JN6A 1F0ZA 1FNVA 4LGYA 3W9CB 2IDYA 1L8QA 1SIJA 3VK8A 1XNQM 2DXIA 4LF5M 3ZJTA 2Y3AA 3OTOM 4IIWA 3BYYB 2Q2EB 4B0MA 3ZJUA 1J7AA 4RNAA 3BZDB 3IAM1 2J7QA 2L83A 2D5GA 3LYYA 2RPVA 1YQ4B 1SXJC 1FRDA 5JXVA 4LGMA 5KPRA 1PDXA 4A6QA 2X8AA 1TDZA 5TSSA 5FTKA 2H88B 2GRIA 4IOIE 3HU3A 4G4OA 2WXQA 3GRVA 3O13A 4L15A 1QQRA 3BVMA 3AE6B 3FTFA 1B9RA 2V6ZM 3SAVA 1QF6A 3D8LA 5E6JA 4JI2M 3LB8C 5KPTA 1J7CA 1E6EB 5EE1A 1FRRA 3I4YA 1E94E 1FXAA 1XNRM 2Z8LA 5EZSA 3Q69A 3IG5A 2IGHA 1NY5A 4OX9M 2EELA 3TWLA 4MH8A 3JR4A 2CU3A 5EZQA 3KDSE 2L32A 3SYKA 1MVKA 3R8BA 1XLPA 3NRZA 4B7GA 3NBIA 3TRKA 4D8IA 4A3VB 1FCLA 3LQRA 4RGMA 1J09A 5KQDA 2UUCM 1IBXA 1OFFA 4FD2A 4YSZB 1DKIA 1JRPA 3LVWA 1LO5D 1R7RA 4GUAA 4JI5M 5D3DA 4O1NA 3P42A 3W0FA 1D2NA 1S3SA 2EKIA 2IPKD 1NJGA 3AV8A 5EXSA 4II7A 1IUEA 1NENB 4KKJA 4JI7M 2OQ4A 4IDIA 4LRSA 1FEHA 3UI3A 4JI8M 1KRHA 4ZRQA 1UKFA 1I4RA 1KLGD 3FKEA 3TL4X 1SXJE 3KVWA 1K3XA 2WP9B 2ZM6M 1C9FA 2JYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MJ5 A;  5KO3 A;  4OW0 A;  4R3D A;  3E9S A;  4RF0 A;  3MP2 A;  4WUR A;  4M0W A;  2FE8 A;  4RF1 A;  4PT5 A;  4MM3 B;  4OVZ A;  4P16 A;  4REZ A;  4OVZ B;  5E6J A;  4RNA A; 
#chains in the Genus database with same CATH topology
 1TDH A;  4IP3 A;  3UQA A;  1HJP A;  1U9V A;  3GLI B;  3LW5 F;  2C5R A;  2G1E A;  2PVG C;  4QOZ C;  5G5G A;  2AQ3 B;  2MQJ A;  3I51 A;  5PAD A;  2O5R A;  2QCU A;  2BF8 B;  4OEM A;  1H4R A;  1HXY D;  1Y08 A;  4XGI A;  1AYU A;  3DA1 A;  4X65 M;  3P4R B;  4HLQ A;  1YN5 A;  4RFB A;  3RYT A;  2LUE A;  2JY6 A;  2JY8 A;  3DWG C;  2EJS A;  3FRH A;  3OVX A;  3VKG A;  4X6J A;  2FUG 1;  1P1A A;  2G4D B;  1FMA D;  3TSS A;  4FCV A;  1XD3 B;  1Z59 A;  3ZXR A;  4RF0 A;  2O2V B;  4Z8X A;  4M00 A;  2LVQ A;  1ZGU B;  1K3B B;  4B08 A;  2N9E B;  2XFS A;  1KF6 B;  1P7F A;  4FWD A;  3RUI B;  4G0N B;  1WY8 A;  2DZZ A;  4GC5 A;  1QOA A;  2OZ2 A;  2CIO A;  5CX3 A;  1JWM D;  3FUU A;  5EDS A;  3M3J A;  1KLV A;  3W5V B;  4HPM B;  2FH0 A;  4HDQ A;  2KMM A;  2C9W B;  3SEB A;  3SR6 A;  1HQR D;  2L76 A;  3U5Z B;  1CB5 A;  1LV7 A;  2CJO A;  2G8J A;  2K47 A;  4OU7 A;  1MIR A;  2HD5 A;  1F9J A;  1SE9 A;  2W3S A;  1XLQ A;  1ESF A;  3VLF B;  3VUY A;  4LJO B;  4ARI A;  1SJH D;  1F52 A;  4NRW A;  3AI5 A;  3W1Y A;  1YD8 U;  1XXH E;  2BB6 A;  2X49 A;  3N4C A;  2OP3 A;  1EO6 A;  4LCB A;  3PBH A;  3PO0 A;  2DZI A;  3N1Y C;  2I1J A;  4MEM A;  3W2D A;  4AKI A;  1Q02 A;  4H2A A;  1YNT E;  4C7Z A;  3A42 A;  4D82 A;  1VD2 A;  1J0G A;  5F3W A;  1Z5C A;  3U61 B;  3K9P B;  4W9K A;  4MSQ B;  4CHT B;  3P4Q B;  2NMQ A;  2JQG R;  2D7G A;  2J7O A;  3R3M A;  1BUI C;  1MG4 A;  1DGJ A;  3WCQ A;  4M8N A;  4RCO A;  2C9O A;  4LJP B;  1CQV A;  3W30 A;  4PT5 A;  3GLF B;  3AV0 A;  1WFY A;  3W0L B;  2WXO A;  3CWI A;  1PJQ A;  3MP9 A;  4HRS A;  1WGN A;  4W4U A;  1OQQ A;  2EMT A;  1YN3 A;  1K3W A;  1TF0 B;  1GJS A;  2N9X A;  3F75 A;  3IG8 A;  1N78 A;  3DZD A;  4FW9 A;  5A24 A;  1T3Q A;  3C0R A;  1HR0 M;  2R0I A;  3IBE A;  1SJE D;  2M1M A;  3I3T B;  1OEY J;  4AKG A;  1ZDX A;  2G5G X;  3A46 A;  3U60 A;  4FCW A;  4CIZ A;  3QA8 A;  3OQC A;  2UXB M;  4M9Z A;  3K9O A;  3AOE A;  4IBB A;  1CMX B;  1A5T A;  4MM3 B;  1XXG A;  2REX A;  5IRE B;  2P0R A;  2QBY B;  2JZ0 A;  2H5X A;  2OJR A;  4KO8 A;  2NR2 A;  3HVD A;  1JAL A;  3KUC B;  4JI6 M;  2KAN A;  1KLU D;  4QHT A;  4NQL B;  2LNH C;  1D5M C;  4DBG B;  1SGH A;  1UBQ A;  1QAO A;  1HQC A;  4JE3 B;  3IT6 B;  1SEB D;  4YXD B;  4URK A;  2DAI A;  1YVB A;  2FCN A;  2ZNV C;  2DC6 A;  3AE7 B;  4GHL A;  3FC4 A;  1X1M A;  4OVU A;  3TUO A;  2IBI A;  1BY8 A;  1DGH B;  1L1Z A;  2NQA A;  2JZ3 B;  1NLJ A;  5GKN A;  1V1O A;  1JQJ C;  3PDF A;  1TY0 A;  4LF9 M;  4WJO A;  2IND C;  3S2A A;  1WJ7 A;  1TKY A;  3ZKJ C;  5EP3 A;  3DOA A;  2MH7 A;  2PMV A;  3DBL I;  1L1T A;  2JQF R;  5MPO A;  4IBC A;  4F1S A;  3Q3J A;  3NS8 A;  3VRB B;  4X6H A;  2L0F A;  5EXT A;  5CHW A;  4IG7 B;  2R44 A;  4S17 A;  3HZJ A;  2LVA A;  2XGN A;  3IVF A;  2GHU A;  3ZH9 B;  1WGK A;  4BKT A;  5C1B A;  4II3 B;  3KSX A;  1FIQ A;  1RYJ A;  1TZO A;  2L2D A;  4ACF A;  4IBI A;  1WXV A;  4P6E A;  1L4D B;  3KOY E;  1OFI A;  1AN8 A;  4GEW A;  1J5E M;  1N61 A;  3CSF A;  4OVV A;  4C4V A;  2JF5 A;  4HVB A;  4BOS C;  4MGK E;  3DBS A;  2EO2 A;  5EE9 A;  1Y8G A;  4K7W A;  3KS8 A;  3H4J A;  5ITR A;  4MAC A;  5D94 A;  3H89 A;  5KPZ A;  3NBX X;  4NZL B;  2DAM A;  1WM3 A;  3U6S A;  1Z2M A;  4BKG A;  3B79 A;  1YT7 A;  2AYO A;  4KDI C;  4HEA 1;  3UJN A;  4FXC A;  3RNA C;  1E8Z A;  4ZTB A;  4ANR A;  1A5R A;  1T0Y A;  4W5C A;  1DEU A;  3K24 A;  1I4P A;  3IFW B;  2AL6 A;  3QSD A;  1WX8 A;  4QBB A;  2KQS A;  3CMM B;  4GHA A;  4BBN F;  3KH0 A;  1QQW A;  2HDE A;  1ICF A;  1HA5 A;  3AEA B;  4ZYS A;  1OQY A;  2E5L M;  1WE6 A;  3ZCB B;  5DPS A;  3ERV A;  4HL4 A;  1JWB D;  1GL7 A;  2HE7 A;  2WX1 A;  5HFY A;  5IOI A;  2J7Q B;  2LGY A;  2KX3 A;  2J0M A;  1XC8 A;  3VKH A;  2G3Q A;  1N34 M;  1LXD A;  3FUT A;  2CV0 A;  2A4Z A;  2KDB A;  2IO2 B;  1JR3 A;  3USV A;  1ZV1 A;  1JB0 F;  5CTR C;  5BPV A;  3NZS A;  4X64 M;  3L28 A;  2OPF A;  2HJ1 A;  3UQB A;  1UF0 A;  5FR3 A;  4R7G A;  1TTN A;  4GDK A;  1M6D A;  2MGW A;  4Z6Y A;  2BPS A;  4P6G A;  4NY0 A;  2KD0 A;  2NVU I;  3V61 A;  2QIL A;  1IN5 A;  1P0R A;  2PPH A;  4GKK M;  2D07 B;  4W5B A;  2CHQ A;  1V1P A;  5J18 A;  4MGZ E;  1M4V A;  1WJ4 A;  3DBH B;  2K1F A;  1GB1 A;  3U7D A;  2KQ4 X;  2KNV A;  5T8I A;  1VDL A;  1FO4 A;  1NYR A;  3K92 A;  3TMP A;  4CDC B;  3AH7 A;  4CIS A;  3A1Q B;  3DVN U;  1YN4 A;  1L0Y B;  1VZ6 A;  4JI1 M;  3BK2 A;  4JWS C;  1T0S C;  1G41 A;  2R9N A;  2UU7 A;  2WSE F;  1XMQ M;  3V6C A;  3AU4 A;  2DZY A;  2KJ6 A;  2XEP A;  1MFW A;  2YJ9 A;  2QCZ A;  1QDQ A;  2I38 A;  5HKH A;  2K9X A;  1YQ3 B;  1U9Q X;  4RY2 A;  2UYZ B;  1ET9 A;  2KZU A;  3BWU D;  2A5U A;  1GKI A;  2BWF A;  5EGW A;  2R62 A;  1OGW A;  2XFT A;  5IT9 S;  2L7I A;  2FO5 A;  1U4A A;  1ENF A;  3KOZ E;  5FTJ A;  1GNU A;  1IN6 A;  1AW7 A;  2B3T A;  1GLO A;  4IUM A;  4XE0 A;  4D8B A;  4JV5 M;  3HK0 A;  4FJZ A;  1AUA A;  4NPN A;  1C4A A;  3AE2 B;  3T1H M;  3NG0 A;  1AU0 A;  3GLI E;  1P3Q Q;  1HEZ E;  2KRU A;  1L7Y A;  1WR6 E;  2PIA A;  2KO3 A;  2GQF A;  2WDQ B;  5EP4 A;  2MRP A;  1G59 A;  3NS1 A;  5TR5 A;  2MRO B;  4YSX B;  2DC7 A;  1QOL A;  2JX5 A;  3U6O A;  2RGO A;  3L16 A;  2MBQ A;  1YUB A;  2N4F A;  2HAK A;  2YQZ A;  4MSX A;  1IBX B;  1ZDV A;  1YAL A;  3C8Y A;  1DOX A;  3L4P A;  2DEN A;  4REZ A;  2D7H A;  3R9X B;  4JI3 M;  4ZHO A;  2UUB M;  1VDD A;  1HNW M;  4E74 A;  3QAR A;  4EFO A;  1H6U A;  4BQV A;  4OZA A;  1OAO C;  1HTO A;  4G11 A;  3KFQ A;  1N6Z A;  2D3C A;  1VZ8 A;  2RDH A;  1XKG A;  5KO3 A;  4CDF B;  1P98 A;  2HKJ A;  2INN E;  3GPU A;  3DVN V;  2KXJ A;  2AWT A;  1FFV A;  3RGS A;  4GXB A;  1NYQ A;  4F1I A;  1STE A;  3JSV A;  2LMC A;  1JW9 D;  2G45 B;  3LMM A;  4I81 A;  1WXM A;  3AUL A;  2HTH A;  2WXG A;  4F7Z A;  4AZF A;  3BY4 A;  2ZVN A;  5F02 A;  1NO1 A;  5IA7 A;  4WW0 A;  3JVZ X;  4LK0 M;  2QC8 A;  4DHJ D;  3GLG A;  1NEK B;  2MJD A;  2P86 A;  2ACT A;  2RGF A;  2CHG A;  3NWL A;  1XLN A;  4BBN C;  4DHZ B;  2R45 A;  2V1Y A;  1FJG M;  2OOA A;  2IY0 B;  2PNS A;  3MMP A;  2JP7 A;  1NJF A;  3PNY A;  1PPD A;  2BKF A;  3FUV A;  4DQO C;  1TZ1 A;  4HK2 A;  2XN9 C;  5D6J B;  2GB1 A;  1F2B A;  2L7H A;  4LDT D;  2JY6 B;  4UN2 B;  4YL8 A;  2M19 A;  4I6P A;  1QZM A;  3PFI A;  2N0S B;  2LHC A;  4L6V 6;  1JWS D;  4FLH A;  1AU3 A;  1KFX L;  1R4N I;  2LVP C;  1ITO A;  4KOD A;  1TBE A;  2OHF A;  3WAO A;  4WWO A;  3L27 A;  3VTV A;  1N5W A;  1I35 A;  3GLF E;  2R46 A;  2LVO A;  1PGA A;  1D0M A;  3H8B A;  3IEC A;  3AL0 C;  3FD9 A;  2KC1 A;  1PVJ A;  3RUL A;  4BSQ A;  2TSS A;  3VDP A;  3HHY A;  1OTR A;  1X37 A;  4UDU C;  1PM5 A;  2OJW A;  5ITY A;  5AUK A;  2NTT A;  3IT4 B;  4MGI E;  3HM3 A;  2AX5 A;  3ZTC A;  5IWA M;  4A55 A;  3DBR B;  1GMY A;  1E7P B;  5AEK B;  2KWU B;  3HWN A;  2KNZ A;  2BKR B;  4W9I A;  1RRB A;  3VQI A;  2HD5 B;  2BW2 A;  1UWM A;  5KHQ A;  2Y21 A;  1C79 A;  4FHJ A;  5FK9 C;  1CVZ A;  1J8C A;  2IY1 B;  2ZW0 A;  3FTD A;  3HHZ A;  2IO0 B;  1ATK A;  1MPE A;  3B0A A;  2HWJ A;  2XK5 A;  2VF8 A;  4LNO A;  3TE6 A;  4YY3 M;  2KN5 A;  4Q2J A;  2KTR A;  2LXA A;  2BTE A;  3WXG A;  4BS6 A;  2YR0 A;  4WWN A;  4IC7 B;  3I01 M;  3GPP A;  1DGG A;  4PI3 A;  3RNE C;  1WYG A;  3KYD D;  1R5L A;  2XH9 A;  1J7K A;  2M4N A;  1YOV B;  3ZTD A;  1Y56 A;  1T6O A;  2ZAO A;  1S4V A;  1EE8 A;  2FBW B;  3NJT A;  2JWU A;  3PHX A;  4NXM M;  1X9Y A;  4ARC A;  4Q8H A;  3TNX A;  2F5Q A;  4ANX A;  4BOQ A;  1J7B A;  3P63 A;  1IXZ A;  2JZZ A;  2LHE A;  3BPM A;  1IQP A;  4DV3 M;  4QRV A;  1C76 A;  2DJF B;  5BMH A;  3AEB B;  4CHK A;  3PVS A;  1EWL A;  2F5N A;  4HKQ A;  4WAA A;  1VJV A;  2BDZ A;  1SXJ D;  1Z5B A;  3DF0 A;  1ZKH A;  1THE A;  4YHH M;  1AIP C;  4LF6 M;  1WJN A;  4W9E A;  3C0R B;  2WXP A;  3UZU A;  3ALB A;  3GQ3 A;  4YYQ A;  1SG9 A;  2XBB C;  4LF4 M;  3W67 A;  2FS1 A;  3J9C A;  1Q5W B;  2E3T A;  2BJW A;  3THG A;  1GL6 A;  4W9L A;  3T1Y M;  2VII A;  1CPJ A;  1ORY B;  2WSF F;  3WAP A;  2FE8 A;  3U60 B;  3B9J A;  4FWH A;  2LRU A;  3TEZ A;  3BYT B;  1LTM A;  3JYU A;  3Q8F A;  1T0R C;  3K9O B;  2PE9 A;  5IN7 A;  4L16 A;  3C9P A;  4GU2 A;  3B2G A;  4XYC A;  1EWP A;  2N1W A;  1PXV A;  2M8S A;  1LFD A;  2WHI A;  5DPT A;  4ASW C;  3URY A;  4IBJ A;  2LI5 A;  3FKY A;  4PCZ A;  1EUV B;  2CHZ A;  5FSW A;  1MU5 A;  4B3T M;  2C7N B;  2N1V A;  3BII D;  2I1K A;  2GFO A;  1N33 M;  3NHE A;  1L0V B;  2DCC A;  1JQ4 A;  3N1X C;  1XMO M;  1B1Z A;  3MHH A;  2AQ2 B;  3Q8G A;  1IWD A;  2IBI B;  5JHA A;  4YYR A;  1TKG A;  4LJ8 A;  4JI4 M;  4B0E A;  3MC9 A;  1AIM A;  2M56 B;  2KDF B;  3RNV A;  4G4Q A;  5JH3 A;  2BWB A;  2L52 A;  3AEC B;  2BBC A;  5JH5 C;  2Y5P A;  2KWD A;  4LF8 M;  3ZNZ B;  1PJJ A;  4ZRK A;  1F1H A;  2JTC A;  2XEW A;  4NJC A;  4DDG D;  4WIP A;  3Q3N C;  1TU6 A;  3BB7 A;  2L1A A;  2ZAM A;  3HWS A;  5G5H A;  4EUT A;  1IBL M;  3ZNH A;  2INC C;  4RKX A;  4ZUX U;  2KMA A;  1HZ6 A;  2NQD B;  3BCN A;  1I4H A;  2DAF A;  5EP1 A;  8CAT A;  2JUJ A;  4BOP A;  2AVW A;  4LFA M;  1Z5A A;  1ZUD 2;  2Y5C A;  3V60 A;  4C4V B;  1YJJ A;  3UIO B;  2DWL A;  2E6X A;  3N32 A;  4XK8 F;  4YTP B;  1Z6T A;  3CTW B;  3U6D A;  1M94 A;  3SAU A;  1TKE A;  4N8W A;  5LMU M;  1VLB A;  1V92 A;  2QEN A;  1FXI A;  3T3N A;  3KWZ A;  4HLE A;  2M60 A;  1IY2 A;  4DV5 M;  2AYO B;  2NQ8 C;  5EXX A;  1G71 A;  1V97 A;  1WXA A;  2PBH A;  3Q8B A;  2ONQ A;  2KDL A;  3RMK C;  1GC7 A;  3TQS A;  2LXE A;  2UXD M;  3Q14 C;  3TL5 A;  2OOB A;  1MI0 A;  2ZCB A;  4ZRP A;  2IGG A;  2SEB D;  3PRZ A;  4IM2 A;  4LJ7 A;  2KC2 A;  2XZU A;  3DBH I;  2C7H A;  2JQR B;  3RN9 C;  2CU1 A;  2L4F A;  2Y20 A;  3I06 A;  4LJ4 A;  4QH6 A;  3S3Q A;  4OEL A;  2BVC A;  2G4S A;  1G6J A;  5EQT A;  4DDI D;  2E00 A;  1T3T A;  4RGO S;  4G6Z A;  2GOW A;  5CHF A;  1IN4 A;  3PRM A;  2G3Q B;  2R6F A;  1PRB A;  2VF7 A;  2UU9 M;  2NQI A;  3SC3 A;  1V5O A;  3N9Y C;  2DHY A;  1GG3 A;  2NS5 A;  3GCB A;  3W1S A;  2MX2 A;  2CEA A;  4XUI A;  3I63 C;  1R2Z A;  3U4E G;  1EWO A;  1ZCM A;  2WXR A;  4M9X A;  3NY5 A;  3KUD B;  3FYC A;  2MCN B;  2KLC A;  4LG2 A;  3AE1 B;  4MEL A;  2H1R A;  4L23 A;  3WA0 A;  2WWZ A;  4GDK B;  3QC8 B;  4ANU A;  4LJ9 A;  2IO1 B;  2N9P C;  1GUA B;  2R9O A;  2FCM A;  5CHT A;  3LXF A;  1QUS A;  4NC6 A;  2L7R A;  1LQB A;  3EHV A;  3KSE A;  1V1P B;  1F2R C;  2NBW B;  3HHM A;  3M63 B;  2OO9 A;  1TL9 A;  4ITQ A;  1SSN A;  1YJ1 A;  2OED A;  1ZE3 D;  1MG8 A;  2KRK A;  3T3O A;  3TMP B;  3ZQ4 A;  4Y28 F;  2MBH A;  3NVZ A;  4WJQ A;  2L8J A;  3AJI B;  4CDD B;  1IGC A;  4C56 C;  2G8L A;  2R2O A;  2PJH A;  3AEF B;  2PAD A;  4A90 A;  2V9H A;  4GKJ M;  2JXT A;  3V6C B;  2FIF A;  1GB4 A;  1PIP A;  3ZW3 A;  1QKZ A;  2C9C A;  5LXH A;  2GMI C;  1MHH E;  2BYF A;  2D2Q A;  3IHP A;  3KP1 E;  1Q3B A;  3C19 A;  2V3P A;  4YTN B;  1WE7 A;  3EFC A;  1STF E;  1DGB A;  1VRA B;  4MI7 A;  2IPP B;  1OIP A;  5H8Y E;  2Z4S A;  2NTS A;  3RVW A;  4DV2 M;  5EXP A;  2BWE S;  2VZK D;  3EIH A;  4NJ7 A;  1K8R B;  4PDG A;  3OAW A;  4MZS A;  3RFW A;  4BLC A;  5BYS A;  4R71 A;  4E71 A;  3OJ4 B;  1MEG A;  2FAZ A;  2EKE C;  2MJ3 A;  3GP7 A;  4GC9 A;  4IUM B;  5BMG A;  1DV0 A;  4PS3 A;  3FUX A;  1HNX M;  3ZDT A;  3FTE A;  1QVR A;  3I04 M;  2DX5 B;  3ZIM A;  4D81 A;  1SE2 A;  4DHZ E;  2WZJ A;  2LVN C;  1E8X A;  3PPA A;  4ZOH C;  4NAW B;  3AOE C;  4GH9 A;  4QNM A;  1Z5S B;  4M8M A;  2DNA A;  3ONS A;  3H7S A;  3B7Z A;  3J7B A;  5CHV C;  1ET6 A;  2H89 B;  1VEJ A;  2FOI C;  3AB5 A;  3QCA A;  4PS8 A;  3RI7 C;  2ARY A;  1F2C A;  5C18 A;  3C3E A;  2ERC A;  2CHX A;  1NL6 A;  4GN1 A;  1ROE A;  4AG5 A;  1KHQ A;  2NQG A;  1ZAE A;  4LZJ A;  5JI2 E;  4KSK C;  5L8R F;  4WJN A;  1PGX A;  1XO3 A;  2D7E A;  3VHT C;  2KXE A;  3A9K A;  5JZE A;  4WWP A;  2D11 A;  2D3B A;  3V05 A;  1PUT A;  1UEL A;  1AYW A;  3UMM A;  3HJQ A;  2W3R A;  2DZM A;  1YK7 A;  3H7P A;  2BS3 B;  3BOS A;  4ZRJ A;  1WJU A;  4QRX A;  1DGF A;  3SAT A;  3MP2 A;  2EA0 A;  2XSZ D;  1PJI A;  2V4I B;  3PZD A;  4AOF A;  3JSV B;  3OJ3 A;  1SF0 A;  3T15 A;  1FCC C;  5ITT A;  3J80 S;  3BY4 B;  1A70 A;  1ZP0 B;  1Y4H A;  2JRI A;  1F29 A;  1KFY B;  3NZ3 A;  3RNG C;  3KP0 E;  3KFU G;  1S3S G;  1IGD A;  2HJ8 A;  3GLG B;  2WXH A;  1Q6K A;  2PE6 B;  4FCT A;  5D7G A;  4KDL B;  4OW0 A;  2JT4 B;  2QJL A;  2DBY A;  5ITX A;  2KFJ A;  2YEP B;  4S0R A;  2LH0 A;  1V86 A;  5L83 A;  3DBR I;  4KHP M;  3GLH A;  3VR9 B;  2QHO A;  3NVV A;  3U30 A;  1EFU B;  2ON8 A;  1MEM A;  2O01 F;  1G3I A;  3HY5 A;  1EWM A;  2R9F A;  3L08 A;  1VJK A;  4GSW A;  2LUM A;  2K39 A;  4PYU A;  1IXS A;  2FCS A;  4DV6 M;  3UK6 A;  2L0T A;  1HZ5 A;  2WDR B;  2JUO A;  2QSD A;  3AM9 A;  3QJ3 A;  4XGA B;  3ZDM C;  4GB9 A;  4US9 A;  4ANV A;  1PGB A;  1UFZ A;  2NBU A;  3OLM D;  1O0E A;  1F2R I;  4RGT A;  3U52 E;  4MT5 A;  4MH0 E;  4Q7J A;  1E8Y A;  3P4P B;  3EIE A;  2YEP F;  1ZOY B;  2DAJ A;  1OEY A;  3N1Z C;  2Z8Y M;  3TJP A;  3M99 A;  3DFZ A;  4NSO B;  3VH3 B;  1ZQ9 A;  1HT2 E;  2MLB A;  3N20 C;  4OHJ A;  1OTR B;  4CQN A;  2LWX A;  1G4A E;  2J5Y A;  2KK8 A;  1C77 A;  4HCP B;  1UNS A;  4DHJ B;  3E46 A;  5DCN A;  5E6N A;  4ANW A;  2KX0 A;  4X57 B;  2KWV B;  3BBA A;  3DVG X;  3BXW A;  4QOS A;  4LCD E;  1EF1 A;  4EZL A;  3AKZ A;  2WNM A;  4HXD A;  1SXT A;  4CDE B;  1WGR A;  2JU6 X;  3W31 A;  1Q1O A;  4ZHP A;  3O65 B;  2MBE A;  3V3X A;  3WXE A;  4WAF A;  3B9P A;  1RWS A;  1ZXH A;  2C0Y A;  1N5X A;  4FJC A;  3TBL D;  4N6E B;  3HIZ A;  3SMS A;  3TEY A;  2G8E A;  5HHD G;  2L3Z A;  2XK5 B;  5I4D A;  4RH6 A;  2VHS A;  3LDZ E;  2KTR B;  1I4W A;  4PS7 A;  4B3R M;  4NNJ B;  4B95 A;  3HHA A;  3F92 A;  1R2Y A;  2DAE A;  5AUI A;  1RFK A;  2DWZ B;  2QIE B;  4HPL B;  1QDR A;  1GAQ B;  4GLS C;  1FPY A;  2QEJ C;  4ICU A;  3D8B A;  2LXC A;  4FN2 A;  4W9J A;  3H8C A;  5LXI B;  2AIM A;  4DK5 A;  1HTQ A;  1WJ6 A;  4JI0 M;  2PW9 A;  3MFG A;  4DR2 M;  4FIP A;  2VQF M;  3A4S C;  2LGS A;  4HEO A;  1G8P A;  5EE3 A;  5C23 A;  3HHI A;  3SU8 X;  2B1N A;  2C5L C;  3PHX B;  3R2I A;  4DUY M;  3GO8 A;  3I4V A;  2RD0 A;  4PDI A;  3RNC C;  2WDV B;  2PRE A;  2O25 A;  2Z4R A;  1NNJ A;  3B89 A;  4B3S M;  1KFV A;  1YK8 A;  3APD A;  1W5T A;  4LZZ A;  4YSY B;  2ACZ B;  2C96 A;  3IXS A;  4BOS A;  3E21 A;  3MHV C;  1AU4 A;  2JVC A;  1SP4 B;  3KLS X;  1E10 A;  3GPX A;  5CVN B;  2DAG A;  1C4P A;  4G50 A;  3QJZ A;  4FJV B;  3LVV A;  2FRQ A;  1ISN A;  1EWC A;  2WBF X;  3M6A A;  2EKK A;  4MB7 A;  3FRI A;  2KVZ A;  3H1U A;  3CF0 A;  1E90 A;  1Q39 A;  1V81 A;  4L1B A;  3C9E A;  3ZQJ A;  3M95 A;  4XWT A;  2GNO A;  4LY6 A;  3NUH B;  4AQ7 A;  1QMY A;  4GDL A;  2FFJ A;  2Z59 B;  4JX1 C;  2LZ6 A;  3HHW A;  1P7E A;  3MC8 A;  3D32 A;  3B21 A;  3PZ8 A;  2HL7 A;  4C80 A;  1GC6 A;  4YYV A;  2JNH A;  4W9H A;  2K8H A;  2DAK A;  1CV8 A;  1NBF C;  5LMN M;  3LCV B;  4TUW A;  4HJG E;  1L0X B;  2K0P A;  1BML C;  3NHE B;  2V0G A;  1YLA A;  2Y5B A;  3UGB B;  2CV1 A;  1FNN A;  3ETR A;  1R4M B;  4HWI B;  1QLB B;  1GOZ A;  3AXC A;  3ECI A;  5BMI A;  1WM2 A;  3B2F A;  4YYW A;  4AKH A;  3PNV A;  2KKC A;  3EFU A;  1UGM A;  3VUW A;  2GI9 A;  1MS6 A;  4M9S A;  1TS4 A;  4XDC A;  2FQ9 A;  1R4G A;  3L2A A;  3J2P B;  3SBJ A;  4DR5 M;  4JWU C;  2R4J A;  2K6B A;  2AYN A;  1WXQ A;  2VRR B;  3ZNH B;  3MHS D;  3W68 A;  2GBR A;  1JR3 E;  3P4S B;  2YJB A;  3BK1 A;  2MP2 A;  2RMM A;  3DHI C;  1KTK A;  4LNF A;  4A5U A;  2K25 A;  3CIR B;  1YX5 B;  2KNA A;  4IWQ A;  2DC8 A;  3CF2 A;  4NSR A;  1KH0 A;  4M01 A;  2DLB A;  4FBJ B;  2KLG A;  2Q5W D;  2KFK A;  2L6O A;  4HKZ E;  1KFU L;  2B1M A;  3I9V 1;  2JA2 A;  1IBM M;  5E6O A;  2C60 A;  1E9S A;  3RZW C;  3U7Z A;  1AYV A;  3TPZ A;  4IWO A;  5JA7 A;  3J81 S;  3MTN B;  3KS4 A;  4JYA M;  3SHQ A;  4YYS A;  3U8E A;  2KW0 A;  1SE4 A;  1V5T A;  2OOB B;  2VH1 A;  4RF1 A;  4B7H A;  3ZO5 B;  3DQV A;  1TH4 A;  1BGO A;  3D6S A;  4K0K M;  1WGL A;  4IBF A;  1WH3 A;  2LEK A;  4I04 A;  2DC9 A;  4N4Z A;  1KHP A;  2MSE D;  1TH3 A;  2DNF A;  1KXR A;  3CGW A;  3X23 A;  3SFD B;  2HXZ A;  3VXW A;  3VR8 B;  3VK7 A;  2IJ0 A;  2YJ8 A;  2AUX A;  3MHS A;  3TWK A;  1TYG B;  2QNJ A;  3RD2 A;  1BP4 A;  2HH5 A;  3VDU A;  3PRM B;  4CO7 A;  4CZW A;  3VRA B;  4IJF A;  5FTN A;  4DR1 M;  2DHR A;  1D3Z A;  1XF5 L;  1K52 A;  3AEG B;  2R9C A;  1VZ7 A;  3U2S C;  5BR8 M;  1NI2 A;  3OWE B;  3RPF C;  1WRI A;  4N59 A;  2K6Q A;  1YJI A;  4FAD A;  4FK5 A;  3KWV A;  3P5U A;  3SYL A;  2N7D A;  2F5P A;  4YV8 A;  1DO2 A;  1BXT A;  4PD2 A;  3A45 A;  1WHC A;  2KMC A;  3PV1 A;  2DZJ A;  4M0D A;  2RGH A;  3WAL A;  4IJE A;  3ZRC A;  3B7N A;  3SAS A;  4I6N B;  1U9X A;  1DGH A;  1DOI A;  2WXL A;  1E0Z A;  1ZMU A;  4WQM A;  3KYC D;  3AEE B;  1C4C A;  1YZB A;  4G4N A;  2DHZ A;  1IY0 A;  3B7Q A;  3RFZ B;  3GP1 A;  2J7Q C;  4K3B A;  2HCB A;  4YT0 B;  4G3O A;  3HJ8 A;  1L5P A;  5FR6 A;  2KNB A;  1WX7 A;  2KTF A;  5DNY A;  2WQY B;  1IP9 A;  2DYB A;  3NVW A;  4MGH A;  2DZK A;  2ZW1 A;  3PS6 A;  2FTD A;  4ZDV A;  1GVN A;  2LFI A;  3T38 A;  3J7A S;  5ITQ A;  2XU5 A;  3VUX A;  1GO5 A;  4S12 A;  1EWY C;  3GZN B;  4JPS A;  4HRO A;  1XCT L;  3AE4 B;  5EE0 A;  1NSF A;  1ZIV A;  4AW4 A;  4DR4 M;  1WF9 A;  2W54 A;  2CB5 A;  3S3R A;  4AI6 A;  2LGD A;  3GLG E;  3APF A;  4I05 A;  2WXJ A;  2PKO A;  4AJW A;  4I6L B;  2AHM A;  3HX3 A;  1WGG A;  3RNB C;  1VSN A;  3Q6B A;  1BT0 A;  1GJZ A;  1WIV A;  4W9F A;  2MHJ A;  3LQQ A;  2JXX A;  4DUZ M;  3IV2 A;  3HU1 A;  1CK1 A;  1VDV A;  4YTM B;  2LVP A;  4IWP A;  4W5W A;  1QOB A;  4LFC M;  4BKS D;  2LHG A;  4NQK E;  1D0L A;  2DZN B;  3MTV A;  5JI3 E;  2AEH A;  1I4X A;  2RKO A;  3R8F A;  3JW0 X;  4LNK A;  2MBB B;  1N75 A;  4KZC A;  4DV1 M;  3WAN A;  3ZVV A;  3U6C A;  4RM9 A;  1NVM A;  3A9K B;  5JZE B;  3KOX E;  2MBO A;  3DVG Y;  3QQ8 B;  4IM0 A;  3WHK A;  2XZF A;  1KJT A;  1ZMW A;  2AL3 A;  3GS2 A;  3HUI A;  4J3O D;  1TIF A;  2LRW A;  2IZV B;  1ZPS A;  3A9J A;  4HJK A;  3H7P B;  4D8E A;  3SHF A;  1TJE A;  2GBN A;  2BTW A;  1V8C A;  3PVL A;  1XWI A;  1Q10 A;  2WXN A;  2APL A;  2VZK B;  4X66 M;  2M17 A;  2GBJ A;  2P7U A;  4GOC A;  3BVG A;  3HGI A;  4E3C A;  6PAD A;  4P7I A;  2JRI B;  2JXN A;  3RE8 A;  1V34 A;  2EKF A;  3U6Q A;  4RGN A;  3RVX A;  1YE9 A;  1CTE A;  3GE3 C;  1JWA D;  1N63 A;  2MH8 A;  3QWL A;  4YYU A;  1KOT A;  4QNR A;  3TWM A;  4DV4 M;  3CBK A;  1YSY A;  2BS4 B;  1NV8 A;  4ZPX A;  2R2Q A;  4BKS A;  1QXP A;  1V80 A;  1OFH A;  4DR3 M;  3E4R A;  4XWW A;  2D10 A;  4IKG A;  3GRR A;  2R65 A;  1ZMV A;  3GLH B;  1SBB B;  2QHO B;  4FVM A;  2KZR A;  1PJS A;  1VG5 A;  2ZPN A;  3ZGZ A;  4BPV A;  3VVW B;  4NL4 H;  2KDM A;  3PSE A;  1LM8 B;  1IXS B;  3PHW A;  1SXJ A;  4KLB A;  3Q3O C;  4TV3 A;  1WIA A;  4I5S A;  3WIM A;  3OF9 A;  4DMY A;  1KM7 A;  1OQR A;  2HHH M;  3P1M A;  2ZBK B;  2XU4 A;  4A20 A;  2V1U A;  1T43 A;  3L10 B;  3K2L A;  3L29 A;  2Y6E A;  1CZP A;  1QAN A;  2W82 A;  2CR5 A;  1CSB B;  4KIK A;  5LNK 1;  4TKN A;  4EKU A;  4DXA B;  4FWG A;  1PYW D;  1OJL A;  4DR7 M;  3N3G A;  4BBA A;  1K51 A;  5DPR A;  4C00 A;  4N58 A;  4X6I A;  2WXK A;  1XCQ L;  4AXL A;  2BNK A;  4GMV A;  4Q8G A;  2BGF A;  4XDD A;  1NB5 A;  2P5T A;  3HU2 A;  2BYE A;  3N30 A;  4ITK A;  4ZYN A;  3MJ5 A;  3Q3F A;  1IM2 A;  1VR9 A;  1NDD A;  2JY7 A;  2CP8 A;  3ILK A;  3PLV A;  4F8C B;  4HXD B;  3SFZ A;  1D5Z C;  2WU2 B;  1XQQ A;  4IBD A;  3T6P A;  1UZX B;  5IP4 D;  3RNF C;  4KGS A;  5ITU A;  3KUZ A;  4P16 A;  3SAR A;  4WQO B;  3N3K A;  3HHX A;  1IXR C;  1HE8 A;  2KA6 B;  2KWC A;  4KGT A;  1L6V A;  1F4I A;  4N79 A;  2LHD A;  2MR9 A;  3VH4 B;  4XR7 A;  1XHB A;  3NVY A;  3KOW E;  2ATO A;  1GAB A;  3EUB 2;  1NNU C;  4LJ6 A;  4BOZ A;  1FM0 D;  4NAM A;  2YLM A;  3IAS 1;  3QYB A;  3FTC A;  2DCD A;  4IBG A;  3M62 B;  2PLP A;  4RMA A;  4WP2 A;  2LVQ D;  2J7N A;  3U6M A;  3V6E A;  1TH2 A;  2O6V D;  3SD5 A;  3ZYY X;  1MHW A;  1XXH A;  4PP1 A;  2DYO A;  1GLN A;  4JGH B;  1C1Y B;  3IUT A;  3VTU A;  5IO9 A;  3IHP C;  3RZF A;  3HVZ A;  1R4M I;  1QAM A;  5GMV A;  3ZUA A;  2CHW A;  4QAY A;  3K9M A;  1L2C A;  4XBO A;  2ICI A;  1CJE A;  3KW5 B;  2WXF A;  4DXF A;  2J42 A;  3A98 B;  3Q8E A;  4JIO U;  5BYR A;  1U9W A;  3PRP A;  1J19 A;  3VDZ A;  1PPN A;  2KHH A;  5DFL A;  5EJC A;  1E7U A;  2QMT A;  2XNA C;  3OF8 A;  4XZ4 A;  1T6B X;  4OVZ A;  3I5J C;  4GDL B;  1DO0 A;  1QZE A;  3GB1 A;  1A6R A;  2V4L A;  1D4B A;  3PT2 A;  1QT9 A;  1AU2 A;  5C3J B;  1PE6 A;  3IFU A;  5G55 A;  4MGY E;  2NBV B;  4KGR A;  1YIW A;  1K50 A;  2G7Y A;  5C2T B;  2UXC M;  2L4E A;  3ZLZ A;  1TS3 A;  2DJG B;  5CVM A;  4AP4 C;  2GBK A;  2Y5B B;  1I4G A;  2J4X A;  2O6V A;  4M0W A;  4B3M M;  5EF4 A;  3ZJV A;  4L8R C;  2WXM A;  1WYW B;  1UM8 A;  1W5S A;  1WX9 A;  4DR6 M;  1WSP A;  4I4L A;  2CJN A;  2J52 A;  3DHH C;  3OVZ A;  5E26 A;  2K22 A;  1ME3 A;  2KAJ A;  3RGP A;  1GEC E;  3TEX A;  3EA6 A;  2KDI A;  1YX6 B;  2VQE M;  4A8X C;  3P5W A;  4IBE A;  3R2T A;  3RT3 B;  2HHN A;  3FIL A;  3U6L A;  4DV0 M;  3RVV A;  2K9D A;  3QK0 A;  3O1G A;  4B9K A;  3OG5 A;  1GPX A;  1JML A;  4EZJ A;  1EIJ A;  2DCA A;  3Q8A A;  3L17 A;  2E02 A;  4A9A A;  2MP2 B;  3H6S A;  1R4N B;  2R18 A;  2R61 A;  3BVZ A;  2V3N A;  5AZF A;  3FYD A;  2DYM A;  4JL9 A;  2XU3 A;  2HWK A;  2WS3 B;  1YMH E;  2DEN B;  3WXF A;  1V49 A;  1JRO A;  3CF6 E;  1LGR A;  2KFK B;  2JWZ A;  3GE8 C;  2I2Y A;  1NV9 A;  2N7E A;  4LNI A;  3R7Q A;  2FNA A;  1TR8 A;  1FNW A;  2DWN A;  1SNK A;  2OUL A;  4L78 A;  1NPZ A;  4CYE A;  3ENE A;  4KX6 B;  4LF7 M;  1TTE A;  2F7D A;  2BU3 A;  2W9N A;  3ABV B;  3A4R A;  1FFU A;  3PRE A;  2DZO B;  1P9D U;  2C7M B;  3BC3 A;  1C78 A;  5LLI A;  2RDB C;  2UWQ A;  4TMA B;  1V6E A;  1Q0W B;  2PVO D;  2FYE A;  4C7Y A;  2CE7 A;  5FKA C;  2FUD A;  1QOG A;  2Y0Q A;  1TY2 A;  3OIS A;  2VHF A;  4MJS A;  4LNN A;  1E7V A;  3QAU A;  2YJ2 A;  1L2D A;  1WZ3 A;  4AQY M;  4LJA A;  5BYQ A;  1K82 A;  3R7R A;  4AS1 A;  3L26 A;  1EF7 A;  2AS8 A;  3F5V A;  4OZC A;  2J0J A;  3QT4 A;  1P3Q U;  4TQ0 A;  1NI3 A;  2J53 A;  5CHV A;  2L09 A;  2KOX A;  1V33 A;  2BDL A;  3GZN I;  3O0U A;  5AZG A;  1UWX A;  2BT6 A;  2VH2 A;  1WXS A;  3ML8 A;  5FLX S;  2QP9 X;  4P1C C;  2ZCC A;  1OAI A;  1OIZ A;  4W9D A;  4KVG B;  1JWU D;  1FD6 A;  1TT5 B;  3CH3 X;  4GIT A;  1F77 A;  1WMH A;  1ZXI A;  1WR1 A;  3BPF A;  2WX0 A;  2XSZ A;  1I7H A;  1GJT A;  3EGR A;  3Q3M C;  4TSS A;  4KKI A;  5KHO A;  2BJV A;  1R7S A;  4PK1 A;  1IN8 A;  4NOO B;  1L6U A;  2QDF A;  1IYF A;  4HWY A;  3C58 A;  1I94 M;  2UUA M;  3MJW A;  1BVS A;  1HQY E;  4XC2 A;  2BYT A;  4XX5 A;  1POP A;  5C1Z A;  4GMQ A;  5HI1 A;  2JRH A;  5FPW A;  3LFY A;  4GRI A;  3DHG C;  1PAD A;  3CST A;  2N9L A;  3IMA A;  3DDC B;  4JXJ A;  1AWD A;  3P5V A;  4HCN B;  2SAK A;  2I7P A;  3GPY A;  1E5W A;  4EEW A;  2NPT A;  4D2K A;  3SFE B;  2YJC A;  2AQ1 B;  1QOF A;  1TGU A;  3AMZ A;  1PGY A;  2DCB A;  1JR3 D;  1NHW C;  2WLB A;  3EC8 A;  3DPD A;  4LDT B;  3TCA A;  1S1Q B;  1SE3 A;  1UUP A;  2IO3 B;  4K7S A;  3T8M A;  1CJL A;  3AE3 B;  1FNU A;  3SMP A;  4G54 A;  2Z84 A;  5ITX E;  3SAW A;  2M0X A;  3E9S A;  1N77 A;  4HDO A;  1PPO A;  2XLJ A;  3GLH E;  2ZVO A;  4X62 M;  1T5X D;  2LJ5 A;  2NCN A;  1WGY A;  4DV7 M;  4AG6 A;  3KSJ A;  4LFB M;  1UBI A;  3AOG A;  4BOU A;  4QHS A;  2ZTC A;  2KQ7 A;  3H6N A;  3PLU A;  2YFQ A;  3KWL A;  5D3I B;  4DWF A;  2JSV X;  3A33 B;  2M5Z A;  1N36 M;  1JCK B;  2FUH B;  4K1R B;  3H7D A;  2BYV E;  5G2N A;  2ZJD A;  3Q8X A;  2AUZ A;  4NJ6 A;  3FUW A;  2DI0 A;  2DKL A;  2X4A A;  1QIL A;  4L2Y A;  4US8 A;  1EF5 A;  2WDT B;  4JQW C;  1L4Z B;  3B1L X;  3QHT A;  1SIF A;  3AN1 A;  3H8H A;  2K3U A;  3E1Z B;  2QPA A;  1IBK M;  3GLI A;  4YVA A;  1C3T A;  4R3D A;  3E56 A;  1QDT A;  3M7G A;  3A9J B;  1UH6 A;  4K81 A;  3PHU A;  2BTW B;  1XLO A;  4EE2 A;  3KKU A;  4CGY B;  3GQ5 A;  1YQB A;  3M0E A;  3GOE A;  3ML9 A;  3LJ3 A;  1D6E C;  3KVF B;  5H92 C;  4XZX A;  3GRY A;  2B76 B;  4KLN A;  2KAC A;  3PGE A;  2YNM D;  2PEA A;  2E01 A;  4IM3 A;  3PW3 A;  3SHG B;  1I42 A;  2EUC A;  3WHL A;  3JAM S;  4A3O A;  9PAP A;  2DWM A;  2MJ5 B;  3B74 A;  3U6P A;  1CS8 A;  2JZ1 A;  4RM8 A;  4LJ5 A;  2GLS A;  3MHZ A;  1QUT A;  2B3A A;  1E9M A;  3PNR A;  1R6B X;  1QYR A;  2RPQ A;  3K8Z A;  3VFD A;  4OZB A;  3HRD D;  2O2V A;  3QWZ B;  1IFY A;  2CV2 A;  4WUR A;  4CJ6 A;  4LLG M;  2N9K A;  2LWP A;  2LGX A;  1I4Q A;  3AU5 A;  2ZTD A;  2JWS A;  1D0K A;  3SDL C;  3NZU A;  3PSE B;  3UF8 A;  5HG2 A;  2K0B X;  2Z7J A;  4I8O A;  3PHW B;  3CBJ A;  1SXJ B;  1MX0 A;  2D3A A;  3U5Z A;  4WH4 A;  2CWB A;  2LBC A;  4EIW A;  4FA6 A;  3IOQ A;  2DWQ A;  2FNJ B;  2K5P A;  1NQC A;  1EU4 A;  2RDG A;  3MOR A;  1RU3 A;  1IN7 A;  2GBM A;  3JR5 A;  2ASQ A;  1C1K A;  3KQ4 A;  2DVW B;  2BB5 A;  2Z0D B;  4LRT A;  5EP2 A;  2LGI A;  4KIK B;  2W55 A;  7CAT A;  3Q2A C;  1N62 A;  4G3X B;  3FE3 A;  3C3D A;  2FCQ A;  2AGA A;  4NXN M;  3J27 B;  3UGJ A;  1QAQ A;  1L2N A;  2KZS A;  1E9R A;  2WU5 B;  2F5S A;  1L2B A;  3L54 A;  2V3S A;  4BAX A;  2KVR A;  4G4R A;  4NAW A;  3BBZ A;  2ZAN A;  4YWG G;  2DZL A;  3K9P A;  3U61 A;  2J0K A;  3WAM A;  2CHV A;  3PXG A;  4F2L A;  1VQ1 A;  4GIP A;  3GQ4 A;  2M0A A;  2JPH A;  2INP E;  1Y8R C;  3PTF C;  3AI8 A;  1IY1 A;  3IEJ A;  3GLF A;  2N7J A;  4EZK A;  3H9D A;  4USA A;  1VCB A;  3N3K B;  4PP2 E;  2WYQ A;  2R4E A;  5FTM A;  4D80 A;  4ICV A;  2F5O A;  4RKU F;  3KWB X;  1ACC A;  1PQS A;  1SB3 C;  2MWS B;  4N9F 4;  3X0W A;  3Q8C A;  2RSU A;  2Z3X A;  4BVU C;  2LVO C;  2V1C A;  3I3T A;  2Z0E B;  4BOZ B;  2JZP A;  1NVI D;  5A2Q S;  2IYD B;  1UGJ A;  3ZC7 B;  5J94 A;  4BB9 A;  3HM6 X;  1PPP A;  4WJP A;  1HNZ M;  2DOS A;  4AJY B;  2G9H D;  2A5Y B;  1AYF A;  3KW6 A;  3AE8 B;  4A3P A;  4MM3 A;  3V6E B;  5KQ8 A;  2QZ4 A;  2BS2 B;  2QBY A;  1XXH B;  1DOY A;  2C98 A;  1ME4 A;  3AFH A;  1N32 M;  3HJS A;  2LJI A;  3MC0 B;  3U6E A;  3P5X A;  1N60 A;  1Q3C A;  2I7N A;  4DBG A;  1HUC B;  4K3C A;  4LTU A;  4FUL A;  4IW0 A;  3DWM A;  4EOY A;  5FTL A;  1GCB A;  2YVC A;  1K53 A;  3ZNI D;  1V9J A;  1PFD A;  3QYE A;  3LCU A;  2L00 B;  3KXE C;  3FAH A;  3AE5 B;  3PRP B;  2X8X X;  4BS5 A;  3L25 A;  1WWT A;  2BQQ A;  3W5U B;  2F4V M;  3K1J A;  3T9L A;  2AU1 A;  4TQ1 A;  2QQ8 A;  3BIN A;  3GRU A;  5BO4 B;  3P2B A;  4OVZ B;  2WXI A;  2X38 A;  2KJH B;  3DOW A;  4MSM B;  1JQP A;  1EM7 A;  3BWK A;  4IBK A;  3PT2 B;  5J17 A;  3HKP A;  2CS4 A;  2JYE A;  1WGD A;  2WSC F;  2KN4 A;  4WWM A;  1NY6 A;  2BWE A;  4TUU A;  1E32 A;  3QAQ A;  7PCK A;  1KYI A;  2MJE A;  3TEW A;  2HTM E;  4P6V F;  1OKS A;  1UD7 A;  1KSF X;  2UZJ A;  3AE9 B;  4DXG A;  4K7U A;  1PBH A;  3L0W B;  5E6P A;  2CFO A;  4NRV A;  1MJG M;  1XEE A;  2C99 A;  2O6V B;  4M0W B;  1EU3 A;  3V76 A;  2MEK A;  1BQI A;  4MDK E;  5IZ7 D;  3LXS A;  2K8B A;  2CUZ A;  1MHX A;  4BZA A;  4J6I A;  4K7C A;  2KDE B;  2N35 A;  1RM6 C;  2D3G A;  3MK6 A;  2QSF X;  1RLF A;  1DYQ A;  5DPW A;  1VEG A;  1NHG C;  1WI0 A;  1FXT B;  3FIL B;  4L4U A;  1E8W A;  3PZ7 A;  2CKH B;  2Y0T A;  5DYI A;  5GXG B;  5H37 D;  3ZUN A;  4KZ0 A;  2XF3 A;  5DYG A;  1TS5 A;  1D5X C;  1V2Y A;  5AZH A;  2IGD A;  3O65 A;  1TS2 A;  4B7F A;  2PTL A;  3H4M A;  3I57 A;  3DBL B;  2R6N A;  3BOW A;  2KT7 A;  2H7J A;  2LD9 A;  2KEB A;  3AED B;  1HT1 E;  4JN6 A;  1F0Z A;  1FNV A;  4LGY A;  2FID A;  3W9C B;  2IDY A;  5IAA C;  2F1G A;  1L8Q A;  2ZPY A;  2O6X A;  1SIJ A;  3APC A;  1MDW A;  3VK8 A;  1XNQ M;  1AEC A;  2DXI A;  4LF5 M;  2KYW A;  3DCG A;  3ZJT A;  2Y3A A;  3L13 A;  1PCI A;  1JRU A;  3OTO M;  4IIW A;  3BYY B;  2Q2E B;  4B0M A;  3ZJU A;  1J7A A;  2WGS A;  5D2M B;  1FH0 A;  4RNA A;  3RCZ A;  3VTW A;  3BZD B;  4W9G A;  3IAM 1;  2LAS A;  4QRG A;  3ZNG C;  2J7Q A;  2L83 A;  3ZXV A;  4AWJ A;  4MZO A;  2D5G A;  4JLC A;  4DMX A;  4B6W A;  3VFK A;  3LYY A;  2RPV A;  2K8C A;  1YQ4 B;  1SXJ C;  1FRD A;  1ZW7 A;  5JXV A;  2FT2 A;  4LGM A;  5KPR A;  1CUK A;  1PDX A;  4A6Q A;  3V62 A;  2X8A A;  1TDZ A;  2ZEQ A;  4KV2 A;  5TSS A;  5FTK A;  2H88 B;  4W9C A;  1U5I A;  2ZZP B;  2GRI A;  4IOI E;  3HU3 A;  4G4O A;  2WXQ A;  4KSL C;  4ZRI A;  1MN3 A;  3GRV A;  4MJS B;  1WZ0 A;  3U8Z A;  3O13 A;  4L15 A;  3KW9 A;  3HD3 A;  1QQR A;  2FRA A;  3BVM A;  3AE6 B;  1RAX A;  1T0Q C;  1WGH A;  4AXM A;  1CQD A;  3FTF A;  1B9R A;  2JY5 A;  2V6Z M;  5JHB A;  3A1Q A;  1C7Y A;  1XB2 B;  3SAV A;  4WA6 A;  1QF6 A;  3D8L A;  5L95 C;  5E6J A;  4P1B C;  4JI2 M;  3LB8 C;  5KPT A;  2K6D B;  4AUQ C;  1J7C A;  4HPP A;  1E6E B;  2MW5 A;  5EE1 A;  2RR9 A;  1FRR A;  3I4Y A;  3TIX A;  8PCH A;  1E94 E;  2G6D A;  4PAD A;  4BFR A;  1IPG A;  1FXA A;  4PYZ A;  1XNR M;  2Z8L A;  3B08 A;  1WMH B;  5EZS A;  3Q69 A;  3UIN B;  3EEC A;  1WR1 B;  3VAW A;  1DF0 A;  1F2A A;  3IG5 A;  2IGH A;  1NY5 A;  4OX9 M;  2EEL A;  1H8C A;  3KX1 A;  3TWL A;  1AAR A;  3QIJ A;  3JR4 A;  4MH8 A;  2VDB B;  2CU3 A;  5EZQ A;  3KDS E;  2L32 A;  3SYK A;  4KT0 F;  2XU1 A;  1MVK A;  3R8B A;  1XLP A;  3IG3 A;  1RFA A;  2L05 A;  3ZRF A;  4FHK A;  5IKC M;  1TLO A;  2R9M A;  2EMS A;  3W1S C;  3NRZ A;  4B7G A;  3NBI A;  1MJD A;  4P17 A;  3CH2 X;  3TRK A;  4D8I A;  4A3V B;  1FCL A;  3LQR A;  4RGM A;  1J09 A;  5KQD A;  4GIV A;  2UUC M;  2NPT B;  1NB3 A;  1IBX A;  1VEK A;  1OFF A;  4FD2 A;  4YSZ B;  3UIP B;  1DKI A;  1JRP A;  3LVW A;  1LO5 D;  1R7R A;  2ZNV B;  4GUA A;  4JI5 M;  2KJR A;  3QX1 A;  2LTU A;  5D3D A;  4O1N A;  5CVO B;  4M02 A;  3P42 A;  3MTN A;  3W0F A;  1D2N A;  1S3S A;  2EKI A;  2CRU A;  2IPK D;  3K8U A;  1NJG A;  2MA9 B;  2KHW B;  4II2 B;  2RRU A;  3AV8 A;  5EXS A;  4I07 A;  4II7 A;  1IUE A;  1NEN B;  1WRD B;  4KKJ A;  3R66 C;  4JI7 M;  2OQ4 A;  4IDI A;  4LRS A;  1FEH A;  4FJY A;  3UI3 A;  1PJT A;  4JI8 M;  1KRH A;  4ZRQ A;  1UKF A;  1TGZ B;  1I4R A;  1KLG D;  5K16 A;  3FKE A;  3TL4 X;  3NOB A;  1SXJ E;  5J2R A;  3KVW A;  1K3X A;  2WP9 B;  1XT9 B;  4GGQ A;  2ZM6 M;  1C9F A;  2E03 A;  2JYT A; 
#chains in the Genus database with same CATH homology
 1TDH A;  4IP3 A;  3GLI B;  2C5R A;  2G1E A;  2PVG C;  4QOZ C;  5G5G A;  2AQ3 B;  3I51 A;  2O5R A;  2QCU A;  1HXY D;  4XGI A;  3DA1 A;  4X65 M;  3P4R B;  4HLQ A;  1YN5 A;  4RFB A;  3DWG C;  3VKG A;  2FUG 1;  1FMA D;  3TSS A;  4FCV A;  1Z59 A;  4RF0 A;  4Z8X A;  4B08 A;  2XFS A;  1KF6 B;  1P7F A;  4FWD A;  4GC5 A;  1QOA A;  1JWM D;  3FUU A;  3W5V B;  2KMM A;  3SEB A;  3SR6 A;  1HQR D;  3U5Z B;  1LV7 A;  2CJO A;  2K47 A;  4OU7 A;  2W3S A;  1XLQ A;  1ESF A;  3VLF B;  4ARI A;  1SJH D;  4NRW A;  2BB6 A;  2X49 A;  4LCB A;  3PO0 A;  3W2D A;  4AKI A;  4H2A A;  1YNT E;  4C7Z A;  3A42 A;  4D82 A;  5F3W A;  1Z5C A;  3U61 B;  4CHT B;  3P4Q B;  2NMQ A;  2D7G A;  2J7O A;  1BUI C;  1DGJ A;  3WCQ A;  4RCO A;  2C9O A;  1CQV A;  3W30 A;  4PT5 A;  3GLF B;  3AV0 A;  3W0L B;  2WXO A;  3CWI A;  3MP9 A;  4HRS A;  1OQQ A;  1YN3 A;  1K3W A;  3IG8 A;  1N78 A;  3DZD A;  4FW9 A;  1T3Q A;  3C0R A;  1HR0 M;  1SJE D;  4AKG A;  1ZDX A;  2G5G X;  3A46 A;  3U60 A;  4FCW A;  3OQC A;  2UXB M;  4M9Z A;  3AOE A;  4IBB A;  1XXG A;  4MM3 B;  5IRE B;  2QBY B;  4KO8 A;  3HVD A;  1JAL A;  4JI6 M;  1KLU D;  4QHT A;  2LNH C;  1D5M C;  1QAO A;  1HQC A;  4JE3 B;  3IT6 B;  1SEB D;  4YXD B;  3AE7 B;  4GHL A;  3FC4 A;  3TUO A;  1DGH B;  1L1Z A;  5GKN A;  1V1O A;  1JQJ C;  1TY0 A;  4LF9 M;  1TKY A;  5EP3 A;  3DOA A;  2MH7 A;  2PMV A;  1L1T A;  5MPO A;  4IBC A;  3VRB B;  5EXT A;  2XGN A;  3ZH9 B;  1WGK A;  5C1B A;  3KSX A;  1FIQ A;  1RYJ A;  1TZO A;  4IBI A;  1L4D B;  3KOY E;  1OFI A;  1AN8 A;  1J5E M;  1N61 A;  4MGK E;  2EO2 A;  5EE9 A;  3KS8 A;  5ITR A;  4MAC A;  5KPZ A;  4NZL B;  3U6S A;  4HEA 1;  3UJN A;  4FXC A;  4ZTB A;  1I4P A;  4GHA A;  1QQW A;  2HDE A;  1HA5 A;  3AEA B;  4ZYS A;  2E5L M;  3ZCB B;  4HL4 A;  1JWB D;  1GL7 A;  5HFY A;  1XC8 A;  3VKH A;  1N34 M;  3FUT A;  2CV0 A;  1JR3 A;  5BPV A;  4X64 M;  3L28 A;  2OPF A;  5FR3 A;  4R7G A;  4Z6Y A;  2QIL A;  1IN5 A;  4GKK M;  2CHQ A;  1V1P A;  4MGZ E;  1M4V A;  1GB1 A;  2KQ4 X;  5T8I A;  1FO4 A;  1NYR A;  3K92 A;  3TMP A;  3AH7 A;  4CIS A;  1YN4 A;  1L0Y B;  1VZ6 A;  4JI1 M;  3BK2 A;  4JWS C;  1G41 A;  1XMQ M;  2XEP A;  2I38 A;  2K9X A;  1YQ3 B;  1ET9 A;  2KZU A;  3BWU D;  1GKI A;  2R62 A;  2XFT A;  5IT9 S;  2L7I A;  1ENF A;  3KOZ E;  5FTJ A;  1IN6 A;  1AW7 A;  4IUM A;  4XE0 A;  4D8B A;  4JV5 M;  1C4A A;  3AE2 B;  3T1H M;  1HEZ E;  2KRU A;  2PIA A;  2WDQ B;  5EP4 A;  1G59 A;  3NS1 A;  4YSX B;  2JX5 A;  3U6O A;  2RGO A;  1YUB A;  2YQZ A;  1IBX B;  1ZDV A;  3C8Y A;  1DOX A;  3L4P A;  4REZ A;  2D7H A;  3R9X B;  4JI3 M;  4ZHO A;  2UUB M;  1VDD A;  1HNW M;  1H6U A;  4OZA A;  1VZ8 A;  2RDH A;  5KO3 A;  2HKJ A;  2INN E;  3GPU A;  1FFV A;  3RGS A;  1NYQ A;  1STE A;  2LMC A;  1JW9 D;  3LMM A;  4I81 A;  2WXG A;  4AZF A;  3BY4 A;  4WW0 A;  4LK0 M;  3GLG A;  1NEK B;  2MJD A;  2CHG A;  3NWL A;  1XLN A;  2R45 A;  1FJG M;  1NJF A;  3PNY A;  3FUV A;  4DQO C;  2XN9 C;  2GB1 A;  2L7H A;  2M19 A;  1QZM A;  3PFI A;  2N0S B;  1JWS D;  4KOD A;  2OHF A;  3L27 A;  1N5W A;  2R46 A;  1PGA A;  3AL0 C;  1PVJ A;  3FD9 A;  2TSS A;  3VDP A;  3HHY A;  1X37 A;  4UDU C;  1PM5 A;  5ITY A;  5AUK A;  2NTT A;  3IT4 B;  4MGI E;  2AX5 A;  5IWA M;  4A55 A;  1E7P B;  3VQI A;  2BW2 A;  1UWM A;  2Y21 A;  1C79 A;  5FK9 C;  2ZW0 A;  3FTD A;  3HHZ A;  1MPE A;  3TE6 A;  4YY3 M;  4Q2J A;  2BTE A;  2YR0 A;  3GPP A;  1DGG A;  1WYG A;  2XH9 A;  1J7K A;  1Y56 A;  2ZAO A;  1EE8 A;  2FBW B;  3PHX A;  2JWU A;  4NXM M;  4ARC A;  2F5Q A;  4BOQ A;  1J7B A;  3P63 A;  1IXZ A;  2LHE A;  1IQP A;  4DV3 M;  1C76 A;  5BMH A;  3AEB B;  3PVS A;  2F5N A;  4HKQ A;  1SXJ D;  1Z5B A;  4YHH M;  4LF6 M;  2WXP A;  3UZU A;  3GQ3 A;  4LF4 M;  3J9C A;  2E3T A;  2BJW A;  3THG A;  1GL6 A;  3T1Y M;  2VII A;  1ORY B;  2FE8 A;  3U60 B;  3B9J A;  4FWH A;  3TEZ A;  3BYT B;  3Q8F A;  4L16 A;  3B2G A;  3URY A;  4IBJ A;  4PCZ A;  5FSW A;  1MU5 A;  4B3T M;  3BII D;  1N33 M;  1L0V B;  1JQ4 A;  1XMO M;  1B1Z A;  2AQ2 B;  1TKG A;  4LJ8 A;  4JI4 M;  4B0E A;  2M56 B;  3RNV A;  4G4Q A;  2L52 A;  3AEC B;  2BBC A;  2Y5P A;  2KWD A;  4LF8 M;  1PJJ A;  2JTC A;  4NJC A;  4WIP A;  3BB7 A;  2L1A A;  2ZAM A;  3HWS A;  5G5H A;  3ZNH A;  1IBL M;  1HZ6 A;  1I4H A;  5EP1 A;  8CAT A;  4BOP A;  4LFA M;  1Z5A A;  1ZUD 2;  2Y5C A;  1YJJ A;  2DWL A;  2E6X A;  4YTP B;  1Z6T A;  3CTW B;  3U6D A;  3SAU A;  1TKE A;  5LMU M;  1VLB A;  2QEN A;  1FXI A;  3T3N A;  2M60 A;  1IY2 A;  4DV5 M;  2NQ8 C;  5EXX A;  1V97 A;  3Q8B A;  2ONQ A;  3TQS A;  2LXE A;  2UXD M;  1MI0 A;  4ZRP A;  2IGG A;  2SEB D;  4LJ7 A;  2XZU A;  2JQR B;  2Y20 A;  4LJ4 A;  5EQT A;  1T3T A;  4RGO S;  4G6Z A;  1IN4 A;  3PRM A;  2UU9 M;  3SC3 A;  3N9Y C;  3W1S A;  2CEA A;  3U4E G;  1R2Z A;  2WXR A;  4M9X A;  3FYC A;  4LG2 A;  3AE1 B;  2H1R A;  4L23 A;  4GDK B;  4LJ9 A;  3LXF A;  1V1P B;  1F2R C;  4ITQ A;  1SSN A;  2OED A;  1ZE3 D;  3T3O A;  2KRK A;  3ZQ4 A;  3NVZ A;  3AJI B;  1IGC A;  4C56 C;  2G8L A;  3AEF B;  4A90 A;  4GKJ M;  2JXT A;  1GB4 A;  1QKZ A;  2C9C A;  1MHH E;  3KP1 E;  1Q3B A;  2V3P A;  4YTN B;  1DGB A;  1VRA B;  4MI7 A;  5H8Y E;  2Z4S A;  2NTS A;  4DV2 M;  5EXP A;  2VZK D;  3EIH A;  4PDG A;  3RFW A;  4BLC A;  5BYS A;  3GP7 A;  2MJ3 A;  4GC9 A;  5BMG A;  3FUX A;  1HNX M;  3FTE A;  1QVR A;  4D81 A;  1SE2 A;  4ZOH C;  4NAW B;  3AOE C;  4GH9 A;  4QNM A;  3J7B A;  1ET6 A;  2H89 B;  2FOI C;  3AB5 A;  5C18 A;  2ERC A;  1ROE A;  4AG5 A;  1ZAE A;  4LZJ A;  5JI2 E;  1PGX A;  1XO3 A;  2D7E A;  2KXE A;  5JZE A;  3V05 A;  1PUT A;  3UMM A;  3HJQ A;  2W3R A;  2BS3 B;  3BOS A;  1DGF A;  3SAT A;  3MP2 A;  2EA0 A;  2XSZ D;  1PJI A;  2V4I B;  1SF0 A;  3T15 A;  1FCC C;  5ITT A;  3J80 S;  1A70 A;  1ZP0 B;  2JRI A;  1KFY B;  3NZ3 A;  3KP0 E;  3KFU G;  1IGD A;  3GLG B;  2WXH A;  4FCT A;  5D7G A;  4OW0 A;  2QJL A;  2DBY A;  5ITX A;  2YEP B;  2LH0 A;  4KHP M;  3GLH A;  3VR9 B;  3NVV A;  2ON8 A;  1G3I A;  1VJK A;  2LUM A;  4DV6 M;  3UK6 A;  1HZ5 A;  2WDR B;  2QSD A;  3AM9 A;  4US9 A;  1PGB A;  1F2R I;  4RGT A;  3U52 E;  4MT5 A;  4MH0 E;  3P4P B;  3EIE A;  2YEP F;  1ZOY B;  3DFZ A;  4NSO B;  1ZQ9 A;  1HT2 E;  4OHJ A;  4CQN A;  2LWX A;  1G4A E;  1C77 A;  1UNS A;  3BBA A;  4QOS A;  3AKZ A;  2WNM A;  1SXT A;  2JU6 X;  3W31 A;  4ZHP A;  3V3X A;  4WAF A;  3B9P A;  1RWS A;  1ZXH A;  1N5X A;  4N6E B;  3SMS A;  3TEY A;  5HHD G;  5I4D A;  4RH6 A;  1I4W A;  4B3R M;  1R2Y A;  5AUI A;  1RFK A;  2DWZ B;  2QIE B;  1GAQ B;  4GLS C;  2QEJ C;  3D8B A;  2PW9 A;  4JI0 M;  3MFG A;  4DR2 M;  2VQF M;  1G8P A;  5EE3 A;  3R2I A;  4DUY M;  3GO8 A;  3I4V A;  4PDI A;  2WDV B;  2Z4R A;  1NNJ A;  4B3S M;  1KFV A;  1W5T A;  4LZZ A;  4YSY B;  2ACZ B;  2C96 A;  3IXS A;  4BOS A;  3MHV C;  3KLS X;  1E10 A;  3GPX A;  1C4P A;  3LVV A;  1EWC A;  3M6A A;  4MB7 A;  3CF0 A;  4L1B A;  1Q39 A;  4AQ7 A;  4XWT A;  4LY6 A;  3NUH B;  2FFJ A;  4JX1 C;  3HHW A;  1P7E A;  3B21 A;  3PZ8 A;  2HL7 A;  4C80 A;  5LMN M;  4TUW A;  4HJG E;  1L0X B;  2K0P A;  1BML C;  2V0G A;  2CV1 A;  1FNN A;  3ETR A;  1QLB B;  1GOZ A;  5BMI A;  3B2F A;  4AKH A;  3PNV A;  2GI9 A;  4M9S A;  1TS4 A;  4XDC A;  3L2A A;  3J2P B;  3SBJ A;  4DR5 M;  4JWU C;  2R4J A;  1WXQ A;  3P4S B;  3BK1 A;  2RMM A;  1KTK A;  3CIR B;  3CF2 A;  4NSR A;  1KH0 A;  2DLB A;  2Q5W D;  2L6O A;  4HKZ E;  3I9V 1;  2JA2 A;  1IBM M;  3U7Z A;  1E9S A;  3TPZ A;  3J81 S;  3KS4 A;  4JYA M;  2KW0 A;  1SE4 A;  4RF1 A;  4B7H A;  1TH4 A;  4K0K M;  4IBF A;  2LEK A;  1TH3 A;  3SFD B;  3VR8 B;  3VK7 A;  2IJ0 A;  3TWK A;  1TYG B;  3VDU A;  3VRA B;  4IJF A;  5FTN A;  4DR1 M;  2DHR A;  1XF5 L;  1K52 A;  3AEG B;  1VZ7 A;  3U2S C;  5BR8 M;  3OWE B;  3RPF C;  1WRI A;  4N59 A;  1YJI A;  3KWV A;  3SYL A;  2F5P A;  1DO2 A;  1BXT A;  4PD2 A;  3A45 A;  4M0D A;  2RGH A;  4IJE A;  3SAS A;  1DGH A;  1DOI A;  2WXL A;  1E0Z A;  4WQM A;  3AEE B;  1C4C A;  1YZB A;  4G4N A;  1IY0 A;  3RFZ B;  3GP1 A;  2J7Q C;  4YT0 B;  2HCB A;  3HJ8 A;  1L5P A;  5DNY A;  2WQY B;  3NVW A;  4MGH A;  2ZW1 A;  1GVN A;  2LFI A;  3T38 A;  3J7A S;  5ITQ A;  4S12 A;  1EWY C;  4JPS A;  4HRO A;  1XCT L;  3AE4 B;  5EE0 A;  1NSF A;  4AW4 A;  4DR4 M;  2W54 A;  4AI6 A;  2WXJ A;  2PKO A;  2AHM A;  3LQQ A;  4DUZ M;  3HU1 A;  1CK1 A;  1VDV A;  4YTM B;  4W5W A;  1QOB A;  4LFC M;  2DZN B;  3MTV A;  5JI3 E;  1I4X A;  2RKO A;  3R8F A;  1N75 A;  4DV1 M;  3U6C A;  1NVM A;  3KOX E;  3WHK A;  2XZF A;  3GS2 A;  3HUI A;  4J3O D;  1ZPS A;  4D8E A;  3SHF A;  1TJE A;  2BTW A;  1V8C A;  1XWI A;  1Q10 A;  2WXN A;  2VZK B;  4X66 M;  3BVG A;  3HGI A;  3RE8 A;  3U6Q A;  4RGN A;  1YE9 A;  1JWA D;  1N63 A;  3QWL A;  4QNR A;  3TWM A;  4DV4 M;  1YSY A;  2BS4 B;  4ZPX A;  1OFH A;  4DR3 M;  3E4R A;  4XWW A;  4IKG A;  3GRR A;  2R65 A;  3GLH B;  1SBB B;  4FVM A;  3ZGZ A;  4NL4 H;  2KDM A;  3PSE A;  1IXS B;  3PHW A;  1SXJ A;  4I5S A;  1OQR A;  2HHH M;  3P1M A;  2ZBK B;  2V1U A;  3K2L A;  3L29 A;  1CZP A;  1QAN A;  2W82 A;  5LNK 1;  4FWG A;  1PYW D;  1OJL A;  4DR7 M;  4BBA A;  1K51 A;  4N58 A;  2WXK A;  1XCQ L;  2BNK A;  4XDD A;  2P5T A;  3HU2 A;  4ITK A;  3MJ5 A;  1IM2 A;  1VR9 A;  3ILK A;  4HXD B;  3SFZ A;  1D5Z C;  2WU2 B;  4IBD A;  4KGS A;  5ITU A;  4P16 A;  3SAR A;  3HHX A;  1IXR C;  2KA6 B;  4KGT A;  1L6V A;  2LHD A;  1XHB A;  3NVY A;  3KOW E;  3EUB 2;  1NNU C;  4LJ6 A;  4BOZ A;  1FM0 D;  4NAM A;  3IAS 1;  3FTC A;  4IBG A;  2PLP A;  3U6M A;  2J7N A;  1TH2 A;  3ZYY X;  1XXH A;  2DYO A;  1GLN A;  3HVZ A;  1QAM A;  1L2C A;  4XBO A;  2ICI A;  1CJE A;  2WXF A;  4DXF A;  2J42 A;  3A98 B;  3Q8E A;  5BYR A;  3PRP A;  5EJC A;  2QMT A;  2XNA C;  1T6B X;  4OVZ A;  4GDL B;  1DO0 A;  3GB1 A;  1D4B A;  3PT2 A;  1QT9 A;  5C3J B;  3IFU A;  4MGY E;  4KGR A;  1K50 A;  5C2T B;  2UXC M;  1TS3 A;  1I4G A;  2J4X A;  4M0W A;  4B3M M;  3ZJV A;  4L8R C;  2WXM A;  1UM8 A;  1W5S A;  4DR6 M;  1WSP A;  4I4L A;  2CJN A;  2J52 A;  5E26 A;  2K22 A;  2KAJ A;  3RGP A;  3TEX A;  3EA6 A;  2VQE M;  4A8X C;  4IBE A;  3R2T A;  3FIL A;  3U6L A;  4DV0 M;  1GPX A;  1JML A;  3Q8A A;  4A9A A;  2R18 A;  2R61 A;  3BVZ A;  2V3N A;  3FYD A;  2DYM A;  2HWK A;  2WS3 B;  1YMH E;  1JRO A;  3CF6 E;  2I2Y A;  2FNA A;  1FNW A;  2DWN A;  4L78 A;  4KX6 B;  4LF7 M;  2BU3 A;  3ABV B;  1FFU A;  2DZO B;  1C78 A;  4TMA B;  2PVO D;  4C7Y A;  2CE7 A;  5FKA C;  1QOG A;  2Y0Q A;  1TY2 A;  3QAU A;  1L2D A;  4AQY M;  4LJA A;  5BYQ A;  1K82 A;  4AS1 A;  3L26 A;  4OZC A;  4TQ0 A;  1NI3 A;  2J53 A;  2L09 A;  2BT6 A;  1UWX A;  5FLX S;  2QP9 X;  1JWU D;  1FD6 A;  4GIT A;  1F77 A;  1ZXI A;  2XSZ A;  1I7H A;  3EGR A;  4TSS A;  4KKI A;  2BJV A;  1R7S A;  1IN8 A;  4NOO B;  1L6U A;  3C58 A;  1I94 M;  2UUA M;  1HQY E;  2BYT A;  4GMQ A;  5HI1 A;  4GRI A;  2N9L A;  4JXJ A;  1AWD A;  2SAK A;  2I7P A;  3GPY A;  4D2K A;  3SFE B;  2AQ1 B;  1QOF A;  1TGU A;  3AMZ A;  1JR3 D;  1NHW C;  2WLB A;  1SE3 A;  1UUP A;  3AE3 B;  1FNU A;  3SMP A;  2Z84 A;  5ITX E;  3SAW A;  3E9S A;  1N77 A;  2XLJ A;  4X62 M;  1T5X D;  4DV7 M;  4AG6 A;  3KSJ A;  4LFB M;  3AOG A;  4BOU A;  4QHS A;  4A5U A;  2YFQ A;  3KWL A;  5D3I B;  2JSV X;  2M5Z A;  1N36 M;  1JCK B;  3Q8X A;  3FUW A;  4L2Y A;  2X4A A;  1QIL A;  4US8 A;  1L4Z B;  3AN1 A;  3H8H A;  2K3U A;  2QPA A;  1IBK M;  3GLI A;  4R3D A;  3E56 A;  3M7G A;  3PHU A;  2BTW B;  1XLO A;  4EE2 A;  4CGY B;  3GQ5 A;  3M0E A;  1D6E C;  5H92 C;  4XZX A;  3GRY A;  2B76 B;  4KLN A;  2KAC A;  2YNM D;  3SHG B;  2EUC A;  3WHL A;  3JAM S;  2DWM A;  3U6P A;  4LJ5 A;  3MHZ A;  1E9M A;  1R6B X;  1QYR A;  3K8Z A;  3VFD A;  4OZB A;  3HRD D;  2CV2 A;  4WUR A;  4LLG M;  2N9K A;  1I4Q A;  5HG2 A;  2Z7J A;  4I8O A;  1SXJ B;  1MX0 A;  3U5Z A;  4WH4 A;  4EIW A;  2DWQ A;  2K5P A;  1EU4 A;  2RDG A;  1IN7 A;  3JR5 A;  1C1K A;  3KQ4 A;  2DVW B;  2BB5 A;  4LRT A;  5EP2 A;  2LGI A;  2W55 A;  7CAT A;  1N62 A;  2AGA A;  4NXN M;  3J27 B;  3UGJ A;  1QAQ A;  2KZS A;  1E9R A;  2WU5 B;  2F5S A;  1L2B A;  4G4R A;  2ZAN A;  4YWG G;  3U61 A;  2CHV A;  3PXG A;  4GIP A;  3GQ4 A;  2M0A A;  2INP E;  1IY1 A;  3GLF A;  2N7J A;  4USA A;  2R4E A;  5FTM A;  4D80 A;  2F5O A;  1ACC A;  1SB3 C;  4RKX A;  3Q8C A;  2Z3X A;  2V1C A;  2JZP A;  1NVI D;  5A2Q S;  1UGJ A;  3ZC7 B;  4BB9 A;  1HNZ M;  2DOS A;  2G9H D;  2A5Y B;  1AYF A;  3KW6 A;  3AE8 B;  5KQ8 A;  2QZ4 A;  2BS2 B;  2QBY A;  1XXH B;  1DOY A;  2C98 A;  3AFH A;  1N32 M;  3HJS A;  2LJI A;  3MC0 B;  3U6E A;  1N60 A;  1Q3C A;  2I7N A;  4LTU A;  3DWM A;  5FTL A;  1K53 A;  1PFD A;  3FAH A;  3KXE C;  3AE5 B;  3L25 A;  1WWT A;  3W5U B;  2F4V M;  3K1J A;  4TQ1 A;  3GRU A;  4OVZ B;  2WXI A;  2X38 A;  1EM7 A;  4IBK A;  3HKP A;  2JYE A;  2KN4 A;  4WWM A;  1NY6 A;  1E32 A;  1KYI A;  2MJE A;  3TEW A;  2HTM E;  4P6V F;  1KSF X;  2UZJ A;  3AE9 B;  4DXG A;  2CFO A;  4NRV A;  1XEE A;  2C99 A;  1EU3 A;  2MEK A;  5IZ7 D;  2CUZ A;  1MHX A;  1RM6 C;  3MK6 A;  1DYQ A;  1NHG C;  3FIL B;  4L4U A;  3PZ7 A;  2Y0T A;  5DYI A;  5GXG B;  5H37 D;  2XF3 A;  5DYG A;  1TS5 A;  1D5X C;  2IGD A;  3O65 A;  1TS2 A;  4B7F A;  2PTL A;  3H4M A;  3I57 A;  2KEB A;  3AED B;  1HT1 E;  4JN6 A;  1F0Z A;  1FNV A;  4LGY A;  3W9C B;  2IDY A;  1L8Q A;  1SIJ A;  3VK8 A;  1XNQ M;  2DXI A;  4LF5 M;  3ZJT A;  2Y3A A;  3OTO M;  4IIW A;  3BYY B;  2Q2E B;  4B0M A;  3ZJU A;  1J7A A;  4RNA A;  3BZD B;  3IAM 1;  2J7Q A;  2L83 A;  2D5G A;  3LYY A;  2RPV A;  1YQ4 B;  1SXJ C;  1FRD A;  5JXV A;  4LGM A;  5KPR A;  1PDX A;  4A6Q A;  2X8A A;  1TDZ A;  5TSS A;  5FTK A;  2H88 B;  2GRI A;  4IOI E;  3HU3 A;  4G4O A;  2WXQ A;  3GRV A;  3O13 A;  4L15 A;  1QQR A;  3BVM A;  3AE6 B;  3FTF A;  1B9R A;  2V6Z M;  3SAV A;  1QF6 A;  3D8L A;  5E6J A;  4JI2 M;  3LB8 C;  5KPT A;  1J7C A;  1E6E B;  5EE1 A;  1FRR A;  3I4Y A;  1E94 E;  1FXA A;  1XNR M;  2Z8L A;  5EZS A;  3Q69 A;  3IG5 A;  2IGH A;  1NY5 A;  4OX9 M;  2EEL A;  3TWL A;  4MH8 A;  3JR4 A;  2CU3 A;  5EZQ A;  3KDS E;  2L32 A;  3SYK A;  1MVK A;  3R8B A;  1XLP A;  3NRZ A;  4B7G A;  3NBI A;  3TRK A;  4D8I A;  4A3V B;  1FCL A;  3LQR A;  4RGM A;  1J09 A;  5KQD A;  2UUC M;  1IBX A;  1OFF A;  4FD2 A;  4YSZ B;  1DKI A;  1JRP A;  3LVW A;  1LO5 D;  1R7R A;  4GUA A;  4JI5 M;  5D3D A;  4O1N A;  3P42 A;  3W0F A;  1D2N A;  1S3S A;  2EKI A;  2IPK D;  1NJG A;  3AV8 A;  5EXS A;  4II7 A;  1IUE A;  1NEN B;  4KKJ A;  4JI7 M;  2OQ4 A;  4IDI A;  4LRS A;  1FEH A;  3UI3 A;  4JI8 M;  1KRH A;  4ZRQ A;  1UKF A;  1I4R A;  1KLG D;  3FKE A;  3TL4 X;  1SXJ E;  3KVW A;  1K3X A;  2WP9 B;  2ZM6 M;  1C9F A;  2JYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...