3PHWA

Otu domain of crimean congo hemorrhagic fever virus in complex with ubiquitin
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
160
structure length
156
Chain Sequence
FLRSLDWTQVIAGQYVSNPRFNISDYFEIVRQPGDGNCFYHSIAELTMPNKTDHSYHYIKRLTESAARKYYQEEPEARLVGLSLEDYLKRMLSDNEWGSTLEASMLAKEMGITIIIWTVEVEAGIKFGDGDVFTAVNLLHSGQTHFDALRILPQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for ubiquitin and ISG15 cross-reactivity in viral ovarian tumor domains.
pubmed doi rcsb
source organism Crimean-congo hemorrhagic fever virus strain ibar10200
molecule tags Hydrolase/ribosomal protein
molecule keywords RNA-directed RNA polymerase L
total genus 48
structure length 156
sequence length 160
chains with identical sequence C, E, G
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3phwA00
3PHXA 4HXDB 3BY4A 3PRMA 3ZNHA 4BOSA 3C0RA 3TMPA 3PHWA 4BOUA 4BOPA 4BOZA 3PHUA 3PSEA 4BOQA 3PRPA 5JZEA 3PT2A
chains in the Genus database with same CATH superfamily
8PCHA 5J94A 2IBIA 4OVZA 4DMYA 3PBHA 2CIOA 2BTWB 2Z84A 1U5IA 1HUCB 1EWMA 4ZTBA 1K3BB 2JQFR 3P5WA 1GMYA 1CJLA 1MEGA 2P0RA 3B21A 2XU4A 3BY4A 3C0RA 4QRVA 4MI7A 2PNSA 1AECA 3TRKA 9PAPA 3BCNA 4HWYA 2BDLA 1YALA 2PBHA 1AU0A 1PPDA 4MZOA 2DCDA 4FK5A 2R9FA 4XZXA 4MSXA 3IOQA 1PVJA 1VJVA 4I07A 4XUIA 1S4VA 3WXEA 1PPNA 4BOPA 3BC3A 3OQCA 3H6SA 3IUTA 1U9WA 1AYWA 3QSDA 4R3DA 2HWKA 4YYUA 2E02A 1YK8A 3P5VA 3F5VA 2HD5A 4P6EA 3LFYA 2DZYA 1KFXL 4PP1A 3BPMA 3KWBX 1ATKA 3P5UA 2R9OA 2BU3A 4BQVA 2NQAA 5FPWA 2G6DA 3N3GA 1NPZA 3PRPA 3USVA 4Q8GA 1GCBA 1EWLA 1PBHA 2PREA 4PP2E 2ACTA 4FJCA 3RVVA 1MIRA 2ATOA 3HHIA 4QH6A 4CDEB 1DEUA 2OP3A 3B79A 1XKGA 2HXZA 3ZNHA 1PXVA 3I3TA 4P6GA 4P16A 1AU3A 2GHUA 1CS8A 4BOSA 3H8BA 3C9EA 1PIPA 2AYNA 4OW0A 3PHUA 3MORA 4PT5A 2F1GA 1Q6KA 2XU1A 1SNKA 4A5UA 4IUMA 3OVXA 1FH0A 1CSBB 3LXSA 1KHQA 1UKFA 3RVXA 1SP4B 4YV8A 2E01A 4X6IA 1F2BA 3PT2A 1THEA 2J7QA 3IHPA 2OULA 4K7CA 1CB5A 4YYSA 4PI3A 2ARYA 2E00A 2FUDA 3AI8A 1ME4A 3GCBA 1Y4HA 4X6HA 3O0UA 4QBBA 3TMPA 3N4CA 2J7QC 1STFE 2Y6EA 3QJ3A 3NHEA 2NQGA 3DF0A 2CB5A 3TNXA 4W5CA 2B1NA 5EZSA 1U9XA 3IFUA 2PADA 1GLOA 3QT4A 5JA7A 3O1GA 3I06A 3PSEA 2AIMA 5PADA 7PCKA 3H7DA 3MTNA 1BQIA 4G54A 2YJBA 1NB5A 2JQGR 3CBJA 1X9YA 3HWNA 1EWOA 2R9CA 2IPPB 4RF1A 2UZJA 2G8EA 3IV2A 5JZEA 1NLJA 3E1ZB 4W4UA 2FYEA 3KSEA 4GUAA 2DC8A 1BY8A 1PCIA 2DOSA 2AVWA 1U9QX 3WXGA 3KFQA 1Y08A 5CHVA 3KWZA 2HH5A 3H89A 1IWDA 4PADA 2DCCA 5CHTA 1QDQA 3W30A 1AYUA 3WXFA 4WA6A 3MTVA 3U8EA 1TL9A 2XU5A 3BB7A 3RNVA 4BPVA 1KFUL 2VHFA 2VHSA 3V6EA 3S3RA 2FQ9A 1ITOA 1MS6A 2C0YA 1BGOA 4AXMA 1DKIA 1YVBA 3S3QA 4RNAA 2WBFX 4YYVA 5A24A 2DC6A 5EGWA 4M0WA 4WURA 3PHWA 2FT2A 2G8JA 1VSNA 3MP2A 3KX1A 3K24A 4YYQA 4YVAA 2P7UA 4CDFB 2JTCA 4BSQA 4RY2A 1F29A 2B1MA 4HXDB 4BOUA 1MDWA 5CVMA 1YT7A 3K9MA 1QMYA 4XR7A 2FO5A 1POPA 1ICFA 2FTDA 2AGAA 2AYOA 3P5XA 1AU4A 2F7DA 1EWPA 3BPFA 5CVOB 1EF7A 1MHWA 2P86A 1BP4A 5KO3A 1KXRA 4QRGA 3PRMA 4MZSA 2HHNA 2JRIA 2OZ2A 1YK7A 1MEMA 1TU6A 1CQDA 1CPJA 4D8EA 4N79A 1AYVA 1CTEA 1NQCA 4N4ZA 3IEJA 3KW9A 5EF4A 2GFOA 1ZIVA 1O0EA 4D8BA 2G7YA 3CH3X 2XU3A 1NB3A 4W5BA 2DZZA 2Y5BA 1JQPA 2DCBA 2AUXA 4OELA 1M6DA 5F02A 4I05A 1PPOA 4KLBA 2AU1A 4OVZB 2BTWA 4N8WA 4CDCB 3OVZA 2DC7A 4IP3A 1A6RA 4Q8HA 1CV8A 2BDZA 1DF0A 4DMXA 3HHAA 3N3KA 3M99A 1GECE 5CVNB 4AXLA 1NL6A 1AIMA 3W31A 5JH3A 2AS8A 3PDFA 2FRAA 3BBAA 4OEMA 5K16A 3D6SA 2NQIA 3KKUA 4RF0A 1YZBA 4ZUXU 4BS5A 3OF9A 3OF8A 2DC9A 2DCAA 4BS6A 4X6JA 1QOLA 1KHPA 2AUZA 4RKXA 3MJ5A 4YYRA 3F75A 3K8UA 3PHXA 4MM3B 4QRXA 2DJFB 2E03A 3PW3A 4CZWA 2YJ9A 2O6XA 3ZUAA 1PPPA 2YJ8A 3H8CA 1F2AA 2YJ2A 4BOZA 2R9NA 2R9MA 1U9VA 2FRQA 3V6CA 5E6JA 3MHSA 3E9SA 2DJGB 3PNRA 3OISA 3O65A 4FIPA 3HD3A 2YJCA 1ME3A 3MHHA 3RVWA 2H7JA 2FE8A 2NQDB 3IMAA 1TLOA 1CVZA 3BOWA 3CH2X 6PADA 4I04A 4YYWA 1PADA 2R6NA 4REZA 3BWKA 4BOQA 3CBKA 5EZQA 1F2CA 1ZCMA 1AU2A 4D8IA 1QXPA 1PE6A 3ERVA 4CDDB
chains in the Genus database with same CATH topology
3PHXA 3PRMA 4BOPA 1UKFA 2DOSA 4OVZA 2JTCA 3OQCA 4MM3B 4OVZB 3TRKA 2FE8A 4P16A 2JRIA 2BTWA 2BU3A 3PT2A 4RF0A 5KO3A 2J7QA 2BTWB 2Z84A 1YZBA 4HXDB 4BOSA 4BOUA 4IP3A 4R3DA 4ZTBA 2HWKA 5EZSA 1DKIA 3PRPA 2AGAA 4RNAA 3IFUA 4D8BA 4REZA 4RF1A 4OW0A 3W30A 2UZJA 4D8EA 4BOZA 3PHUA 3MTVA 4PT5A 4A5UA 4BOQA 5JZEA 5EZQA 3BB7A 3B21A 5E6JA 4IUMA 3BY4A 3E9SA 3MJ5A 4RKXA 3C0RA 4M0WA 3PHWA 4WURA 3O65A 4XZXA 3RNVA 3BBAA 4GUAA 3TMPA 2J7QC 3PSEA 3W31A 4D8IA 3MP2A 1PVJA 4MI7A 3ZNHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PHX A;  4HXD B;  3BY4 A;  3PRM A;  3ZNH A;  4BOS A;  3C0R A;  3TMP A;  3PHW A;  4BOU A;  4BOP A;  4BOZ A;  3PHU A;  3PSE A;  4BOQ A;  3PRP A;  5JZE A;  3PT2 A; 
#chains in the Genus database with same CATH topology
 8PCH A;  5J94 A;  2IBI A;  4OVZ A;  4DMY A;  3PBH A;  2CIO A;  2BTW B;  2Z84 A;  1U5I A;  1HUC B;  1EWM A;  4ZTB A;  1K3B B;  2JQF R;  3P5W A;  1GMY A;  1CJL A;  1MEG A;  2P0R A;  3B21 A;  2XU4 A;  3BY4 A;  3C0R A;  4QRV A;  4MI7 A;  2PNS A;  1AEC A;  3TRK A;  9PAP A;  3BCN A;  4HWY A;  2BDL A;  1YAL A;  2PBH A;  1AU0 A;  1PPD A;  4MZO A;  2DCD A;  4FK5 A;  2R9F A;  4XZX A;  4MSX A;  3IOQ A;  1PVJ A;  1VJV A;  4I07 A;  4XUI A;  1S4V A;  3WXE A;  1PPN A;  4BOP A;  3BC3 A;  3OQC A;  3H6S A;  3IUT A;  1U9W A;  1AYW A;  3QSD A;  4R3D A;  2HWK A;  4YYU A;  2E02 A;  1YK8 A;  3P5V A;  3F5V A;  2HD5 A;  4P6E A;  3LFY A;  2DZY A;  1KFX L;  4PP1 A;  3BPM A;  3KWB X;  1ATK A;  3P5U A;  2R9O A;  2BU3 A;  4BQV A;  2NQA A;  5FPW A;  2G6D A;  3N3G A;  1NPZ A;  3PRP A;  3USV A;  4Q8G A;  1GCB A;  1EWL A;  1PBH A;  2PRE A;  4PP2 E;  2ACT A;  4FJC A;  3RVV A;  1MIR A;  2ATO A;  3HHI A;  4QH6 A;  4CDE B;  1DEU A;  2OP3 A;  3B79 A;  1XKG A;  2HXZ A;  3ZNH A;  1PXV A;  3I3T A;  4P6G A;  4P16 A;  1AU3 A;  2GHU A;  1CS8 A;  4BOS A;  3H8B A;  3C9E A;  1PIP A;  2AYN A;  4OW0 A;  3PHU A;  3MOR A;  4PT5 A;  2F1G A;  1Q6K A;  2XU1 A;  1SNK A;  4A5U A;  4IUM A;  3OVX A;  1FH0 A;  1CSB B;  3LXS A;  1KHQ A;  1UKF A;  3RVX A;  1SP4 B;  4YV8 A;  2E01 A;  4X6I A;  1F2B A;  3PT2 A;  1THE A;  2J7Q A;  3IHP A;  2OUL A;  4K7C A;  1CB5 A;  4YYS A;  4PI3 A;  2ARY A;  2E00 A;  2FUD A;  3AI8 A;  1ME4 A;  3GCB A;  1Y4H A;  4X6H A;  3O0U A;  4QBB A;  3TMP A;  3N4C A;  2J7Q C;  1STF E;  2Y6E A;  3QJ3 A;  3NHE A;  2NQG A;  3DF0 A;  2CB5 A;  3TNX A;  4W5C A;  2B1N A;  5EZS A;  1U9X A;  3IFU A;  2PAD A;  1GLO A;  3QT4 A;  5JA7 A;  3O1G A;  3I06 A;  3PSE A;  2AIM A;  5PAD A;  7PCK A;  3H7D A;  3MTN A;  1BQI A;  4G54 A;  2YJB A;  1NB5 A;  2JQG R;  3CBJ A;  1X9Y A;  3HWN A;  1EWO A;  2R9C A;  2IPP B;  4RF1 A;  2UZJ A;  2G8E A;  3IV2 A;  5JZE A;  1NLJ A;  3E1Z B;  4W4U A;  2FYE A;  3KSE A;  4GUA A;  2DC8 A;  1BY8 A;  1PCI A;  2DOS A;  2AVW A;  1U9Q X;  3WXG A;  3KFQ A;  1Y08 A;  5CHV A;  3KWZ A;  2HH5 A;  3H89 A;  1IWD A;  4PAD A;  2DCC A;  5CHT A;  1QDQ A;  3W30 A;  1AYU A;  3WXF A;  4WA6 A;  3MTV A;  3U8E A;  1TL9 A;  2XU5 A;  3BB7 A;  3RNV A;  4BPV A;  1KFU L;  2VHF A;  2VHS A;  3V6E A;  3S3R A;  2FQ9 A;  1ITO A;  1MS6 A;  2C0Y A;  1BGO A;  4AXM A;  1DKI A;  1YVB A;  3S3Q A;  4RNA A;  2WBF X;  4YYV A;  5A24 A;  2DC6 A;  5EGW A;  4M0W A;  4WUR A;  3PHW A;  2FT2 A;  2G8J A;  1VSN A;  3MP2 A;  3KX1 A;  3K24 A;  4YYQ A;  4YVA A;  2P7U A;  4CDF B;  2JTC A;  4BSQ A;  4RY2 A;  1F29 A;  2B1M A;  4HXD B;  4BOU A;  1MDW A;  5CVM A;  1YT7 A;  3K9M A;  1QMY A;  4XR7 A;  2FO5 A;  1POP A;  1ICF A;  2FTD A;  2AGA A;  2AYO A;  3P5X A;  1AU4 A;  2F7D A;  1EWP A;  3BPF A;  5CVO B;  1EF7 A;  1MHW A;  2P86 A;  1BP4 A;  5KO3 A;  1KXR A;  4QRG A;  3PRM A;  4MZS A;  2HHN A;  2JRI A;  2OZ2 A;  1YK7 A;  1MEM A;  1TU6 A;  1CQD A;  1CPJ A;  4D8E A;  4N79 A;  1AYV A;  1CTE A;  1NQC A;  4N4Z A;  3IEJ A;  3KW9 A;  5EF4 A;  2GFO A;  1ZIV A;  1O0E A;  4D8B A;  2G7Y A;  3CH3 X;  2XU3 A;  1NB3 A;  4W5B A;  2DZZ A;  2Y5B A;  1JQP A;  2DCB A;  2AUX A;  4OEL A;  1M6D A;  5F02 A;  4I05 A;  1PPO A;  4KLB A;  2AU1 A;  4OVZ B;  2BTW A;  4N8W A;  4CDC B;  3OVZ A;  2DC7 A;  4IP3 A;  1A6R A;  4Q8H A;  1CV8 A;  2BDZ A;  1DF0 A;  4DMX A;  3HHA A;  3N3K A;  3M99 A;  1GEC E;  5CVN B;  4AXL A;  1NL6 A;  1AIM A;  3W31 A;  5JH3 A;  2AS8 A;  3PDF A;  2FRA A;  3BBA A;  4OEM A;  5K16 A;  3D6S A;  2NQI A;  3KKU A;  4RF0 A;  1YZB A;  4ZUX U;  4BS5 A;  3OF9 A;  3OF8 A;  2DC9 A;  2DCA A;  4BS6 A;  4X6J A;  1QOL A;  1KHP A;  2AUZ A;  4RKX A;  3MJ5 A;  4YYR A;  3F75 A;  3K8U A;  3PHX A;  4MM3 B;  4QRX A;  2DJF B;  2E03 A;  3PW3 A;  4CZW A;  2YJ9 A;  2O6X A;  3ZUA A;  1PPP A;  2YJ8 A;  3H8C A;  1F2A A;  2YJ2 A;  4BOZ A;  2R9N A;  2R9M A;  1U9V A;  2FRQ A;  3V6C A;  5E6J A;  3MHS A;  3E9S A;  2DJG B;  3PNR A;  3OIS A;  3O65 A;  4FIP A;  3HD3 A;  2YJC A;  1ME3 A;  3MHH A;  3RVW A;  2H7J A;  2FE8 A;  2NQD B;  3IMA A;  1TLO A;  1CVZ A;  3BOW A;  3CH2 X;  6PAD A;  4I04 A;  4YYW A;  1PAD A;  2R6N A;  4REZ A;  3BWK A;  4BOQ A;  3CBK A;  5EZQ A;  1F2C A;  1ZCM A;  1AU2 A;  4D8I A;  1QXP A;  1PE6 A;  3ERV A;  4CDD B; 
#chains in the Genus database with same CATH homology
 3PHX A;  3PRM A;  4BOP A;  1UKF A;  2DOS A;  4OVZ A;  2JTC A;  3OQC A;  4MM3 B;  4OVZ B;  3TRK A;  2FE8 A;  4P16 A;  2JRI A;  2BTW A;  2BU3 A;  3PT2 A;  4RF0 A;  5KO3 A;  2J7Q A;  2BTW B;  2Z84 A;  1YZB A;  4HXD B;  4BOS A;  4BOU A;  4IP3 A;  4R3D A;  4ZTB A;  2HWK A;  5EZS A;  1DKI A;  3PRP A;  2AGA A;  4RNA A;  3IFU A;  4D8B A;  4REZ A;  4RF1 A;  4OW0 A;  3W30 A;  2UZJ A;  4D8E A;  4BOZ A;  3PHU A;  3MTV A;  4PT5 A;  4A5U A;  4BOQ A;  5JZE A;  5EZQ A;  3BB7 A;  3B21 A;  5E6J A;  4IUM A;  3BY4 A;  3E9S A;  3MJ5 A;  4RKX A;  3C0R A;  4M0W A;  3PHW A;  4WUR A;  3O65 A;  4XZX A;  3RNV A;  3BBA A;  4GUA A;  3TMP A;  2J7Q C;  3PSE A;  3W31 A;  4D8I A;  3MP2 A;  1PVJ A;  4MI7 A;  3ZNH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...