2FT2A

Human cathepsin s with inhibitor cra-29728
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cathepsin S
publication title Human Cathepsin S with Inhibitor CRA-29728
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 49
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2ft2A00
1MHWA 3IHPA 3MHSA 2NQAA 1PBHA 5FPWA 2R9FA 3H6SA 2AUZA 4QRGA 5F02A 2F1GA 2YJ9A 4FK5A 4AXMA 3U8EA 1MS6A 3H7DA 1MEGA 6PADA 1NLJA 1SP4B 1CQDA 4YYUA 3QJ3A 2VHSA 2PREA 3RVVA 2BDLA 4DMXA 4KLBA 1TLOA 1IWDA 4PP2E 5EGWA 2PBHA 2B1MA 4CDDB 1ICFA 4Q8GA 1EWPA 3IOQA 2AIMA 4ZUXU 5K16A 2G8JA 2C0YA 2R9OA 3F5VA 1AYWA 2DC9A 3BOWA 2ACTA 2YJ2A 3QSDA 1KFXL 2AS8A 3HHAA 3RVWA 7PCKA 1F2CA 2HXZA 3KKUA 1ZIVA 3K8UA 2PADA 3AI8A 4MZOA 1POPA 3IEJA 2DCAA 2FUDA 3K9MA 9PAPA 3ERVA 1STFE 3BPFA 2FT2A 1YVBA 2O6XA 1ZCMA 2AVWA 2NQDB 3M99A 1KHPA 3BC3A 1KFUL 4YYWA 3E1ZB 3H8BA 1HUCB 2P86A 2DC7A 5A24A 2NQIA 3QT4A 5JH3A 1AU0A 1BY8A 3V6EA 3IMAA 4PADA 4WA6A 4PI3A 5CVOB 4I05A 2FTDA 1QDQA 3CBKA 1MDWA 2NQGA 5CHTA 3RVXA 4N79A 2FO5A 3KW9A 4W5BA 4MSXA 1U9XA 1NQCA 4RY2A 1ITOA 1AIMA 4CDEB 1FH0A 4P6GA 2CIOA 1NPZA 2G8EA 3TNXA 2HH5A 1KXRA 1AU4A 3HHIA 3HWNA 4FIPA 2DCDA 3V6CA 1F29A 2YJCA 4X6IA 3CH2X 4HWYA 2XU4A 1PPNA 2DJGB 1AU3A 4BPVA 3N4CA 4FJCA 2AYNA 4N4ZA 1GLOA 3OVXA 1U9VA 3I3TA 2DZZA 5PADA 3PDFA 3S3QA 3ZUAA 2GFOA 1EWMA 4YVAA 3OF8A 4N8WA 1U5IA 1Y08A 4OEMA 4XR7A 1CJLA 2FQ9A 2DCBA 3IV2A 1ATKA 2E00A 1TU6A 1ME4A 3C9EA 4I07A 4QRXA 2XU1A 1NL6A 1YK7A 2OP3A 2G7YA 2PNSA 2DJFB 2H7JA 3KWZA 4Q8HA 4QRVA 4I04A 3H89A 3BCNA 1CS8A 1YK8A 3WXFA 1QXPA 5CVMA 3PBHA 3MORA 1DEUA 3D6SA 1Q6KA 2E01A 2OZ2A 2JQFR 3MTNA 2BDZA 2E02A 4AXLA 1ME3A 4CDCB 4XUIA 3OF9A 2VHFA 1BQIA 1PE6A 2IPPB 3OISA 1CSBB 2IBIA 1PIPA 3I06A 3O0UA 1AU2A 3NHEA 3HD3A 4MZSA 4YV8A 4YYVA 4BSQA 3WXEA 3S3RA 2Y6EA 5J94A 1BGOA 3BWKA 1X9YA 5CHVA 1NB3A 3KFQA 2E03A 2AYOA 3P5XA 3N3GA 4BQVA 3PNRA 3GCBA 1TL9A 4QBBA 1A6RA 1CV8A 2XU3A 3K24A 4YYRA 3P5WA 1AYUA 1JQPA 3P5VA 4X6JA 1PADA 2DC6A 3WXGA 3IUTA 2CB5A 3KWBX 2WBFX 1VJVA 1F2BA 3KSEA 1EWOA 1Y4HA 4QH6A 2P0RA 3H8CA 3LXSA 2DC8A 1MIRA 4G54A 4YYQA 1SNKA 2R6NA 2F7DA 3KX1A 2GHUA 1K3BB 4K7CA 1S4VA 1PXVA 8PCHA 2R9MA 3P5UA 2XU5A 1THEA 3DF0A 4X6HA 2FRAA 1PPPA 1VSNA 1O0EA 3O1GA 3PW3A 5CVNB 1XKGA 2HD5A 3MHHA 4W5CA 2G6DA 1F2AA 2FRQA 2YJ8A 2R9NA 3BPMA 3B79A 4BS6A 2P7UA 1CPJA 1PCIA 2ATOA 4OELA 3CH3X 1AECA 4YYSA 1GECE 2ARYA 2AUXA 2DZYA 2FYEA 1GCBA 1EF7A 1DF0A 2R9CA 4DMYA 1CVZA 1M6DA 3LFYA 5JA7A 2YJBA 1PPDA 4W4UA 1GMYA 4PP1A 4CZWA 2OULA 4BS5A 1AYVA 1U9WA 4P6EA 4CDFB 1PPOA 1CTEA 1YALA 2B1NA 1BP4A 1QMYA 2AU1A 1YT7A 3N3KA 1CB5A 1MEMA 1NB5A 2JQGR 2Y5BA 3CBJA 3OVZA 2HHNA 1U9QX 5EF4A 3F75A 1QOLA 1KHQA 1EWLA 2DCCA 3USVA
chains in the Genus database with same CATH superfamily
1MHWA 3IHPA 3MHSA 2NQAA 3TMPA 1PBHA 5FPWA 2R9FA 2AGAA 3H6SA 2AUZA 4QRGA 5F02A 2F1GA 2YJ9A 4FK5A 4MM3B 4AXMA 3OQCA 3U8EA 1MS6A 5JZEA 3H7DA 1MEGA 6PADA 4PT5A 1NLJA 1SP4B 1CQDA 4YYUA 3QJ3A 2VHSA 2PREA 3RVVA 2BDLA 4DMXA 4KLBA 1TLOA 1IWDA 4PP2E 2J7QC 5EGWA 2PBHA 2B1MA 4RNAA 4CDDB 5EZSA 1ICFA 4Q8GA 1EWPA 3IOQA 2AIMA 4ZUXU 5K16A 2G8JA 2C0YA 2R9OA 3F5VA 1AYWA 2DC9A 3BOWA 2ACTA 2YJ2A 3QSDA 1KFXL 2AS8A 3HHAA 3RVWA 7PCKA 1F2CA 2HXZA 3KKUA 1ZIVA 3K8UA 4RF0A 2J7QA 2PADA 3AI8A 4MZOA 1POPA 3IEJA 2DCAA 2FUDA 3K9MA 9PAPA 3ERVA 1STFE 3BPFA 2FT2A 1YVBA 2O6XA 1ZCMA 2AVWA 2NQDB 3M99A 2BTWB 1KHPA 3BC3A 3PRMA 1KFUL 4YYWA 3E1ZB 3H8BA 1HUCB 2P86A 4BOSA 2DC7A 4D8IA 5A24A 2NQIA 3PHWA 3QT4A 5JH3A 1AU0A 1BY8A 3V6EA 3IMAA 2BTWA 3MJ5A 4PADA 4WA6A 4PI3A 5CVOB 4I05A 2FTDA 1QDQA 3CBKA 1MDWA 2NQGA 4IUMA 4BOZA 5CHTA 3RVXA 4OVZA 4N79A 2FO5A 3KW9A 4W5BA 4MSXA 1U9XA 1NQCA 4RY2A 1ITOA 1AIMA 4CDEB 1FH0A 4P6GA 2JTCA 3PHXA 2CIOA 1NPZA 2G8EA 3TNXA 3PHUA 2HH5A 1KXRA 1AU4A 3HHIA 3HWNA 4FIPA 2DCDA 3V6CA 1F29A 2YJCA 4HXDB 4X6IA 3CH2X 3BB7A 3BY4A 4HWYA 3ZNHA 2XU4A 1PPNA 2DJGB 3RNVA 1AU3A 4MI7A 4BPVA 3N4CA 4FJCA 3W31A 3IFUA 2AYNA 4ZTBA 4N4ZA 3E9SA 1GLOA 4GUAA 3OVXA 1U9VA 3I3TA 2DZZA 5PADA 4OW0A 3PDFA 3S3QA 3ZUAA 2GFOA 1EWMA 4YVAA 3OF8A 1UKFA 4N8WA 1U5IA 4WURA 1Y08A 4OEMA 4XR7A 1CJLA 2FQ9A 2DCBA 3IV2A 1ATKA 2E00A 1TU6A 5E6JA 1ME4A 4RF1A 3C9EA 4I07A 4QRXA 2XU1A 1NL6A 4A5UA 1YK7A 2OP3A 2G7YA 2PNSA 2DJFB 2H7JA 3KWZA 4Q8HA 4QRVA 4I04A 3C0RA 3H89A 3BCNA 1CS8A 1YK8A 3WXFA 1QXPA 5CVMA 3PBHA 4BOQA 3MORA 1DEUA 3D6SA 1Q6KA 2E01A 2OZ2A 2JQFR 3MTNA 2BDZA 2E02A 4AXLA 4IP3A 1ME3A 4CDCB 4XUIA 2Z84A 3OF9A 2VHFA 4M0WA 1BQIA 1PE6A 2IPPB 3OISA 4P16A 1CSBB 2IBIA 4D8EA 3W30A 4BOUA 1PIPA 3O0UA 2FE8A 3I06A 1AU2A 3PSEA 3NHEA 3HD3A 4MZSA 4YV8A 4YYVA 4BSQA 3WXEA 3S3RA 2Y6EA 5J94A 1BGOA 3BWKA 1X9YA 5CHVA 1NB3A 3KFQA 2E03A 2AYOA 3P5XA 3N3GA 4BQVA 3PNRA 3GCBA 1TL9A 3MP2A 4QBBA 1A6RA 1CV8A 2XU3A 3K24A 4YYRA 5KO3A 2UZJA 3PRPA 4BOPA 3P5WA 1AYUA 1JQPA 3P5VA 3MTVA 4X6JA 1PADA 2DC6A 3WXGA 2HWKA 3IUTA 2CB5A 3KWBX 2WBFX 1VJVA 1F2BA 3KSEA 1EWOA 1Y4HA 4QH6A 2P0RA 3H8CA 2JRIA 3LXSA 2DC8A 1MIRA 3TRKA 4G54A 4REZA 4YYQA 1SNKA 2R6NA 2F7DA 3KX1A 2GHUA 1K3BB 4K7CA 1S4VA 1PXVA 8PCHA 2R9MA 3P5UA 5EZQA 2XU5A 1THEA 3DF0A 4X6HA 2FRAA 1PPPA 1VSNA 1PVJA 1O0EA 3O1GA 3PW3A 4XZXA 3BBAA 5CVNB 1XKGA 2HD5A 3MHHA 4RKXA 4W5CA 3O65A 2G6DA 1F2AA 2FRQA 2YJ8A 2R9NA 3BPMA 3B79A 4BS6A 2P7UA 1CPJA 1PCIA 2ATOA 4OELA 3CH3X 1AECA 4YYSA 1YZBA 1GECE 2ARYA 2AUXA 2DZYA 2FYEA 1GCBA 1EF7A 3PT2A 1DF0A 2R9CA 4DMYA 1CVZA 1M6DA 3LFYA 5JA7A 1DKIA 2DOSA 2YJBA 1PPDA 4OVZB 4W4UA 1GMYA 4PP1A 4D8BA 4CZWA 2OULA 4BS5A 1AYVA 1U9WA 4P6EA 4CDFB 1PPOA 1CTEA 1YALA 2B1NA 1BP4A 1QMYA 2AU1A 1YT7A 3N3KA 4R3DA 1CB5A 1MEMA 1NB5A 2JQGR 2Y5BA 3CBJA 3OVZA 2BU3A 2HHNA 1U9QX 5EF4A 3F75A 3B21A 1QOLA 1KHQA 1EWLA 2DCCA 3USVA
chains in the Genus database with same CATH topology
1MHWA 3IHPA 3MHSA 2NQAA 1PBHA 5FPWA 2R9FA 3H6SA 2AUZA 4QRGA 5F02A 2F1GA 2YJ9A 4FK5A 4AXMA 3U8EA 1MS6A 3H7DA 4BGFA 1MEGA 6PADA 1NLJA 1SP4B 1CQDA 4YYUA 3QJ3A 2VHSA 2PREA 3RVVA 2BDLA 4DMXA 4KLBA 1TLOA 1IWDA 4PP2E 5EGWA 2PBHA 2B1MA 4CDDB 1ICFA 4Q8GA 1EWPA 3IOQA 2AIMA 4ZUXU 5K16A 2G8JA 2C0YA 2R9OA 3F5VA 1AYWA 2DC9A 3BOWA 2ACTA 2YJ2A 3QSDA 1KFXL 2AS8A 3HHAA 3RVWA 7PCKA 1F2CA 2HXZA 3KKUA 1ZIVA 3K8UA 2PADA 3AI8A 4MZOA 1POPA 3IEJA 2DCAA 2FUDA 3K9MA 9PAPA 3ERVA 1STFE 3BPFA 2FT2A 1YVBA 2O6XA 1ZCMA 2AVWA 2NQDB 3M99A 1KHPA 3BC3A 1KFUL 4YYWA 3E1ZB 3H8BA 1HUCB 2P86A 2DC7A 5A24A 2NQIA 3QT4A 5JH3A 1AU0A 1BY8A 4NV8A 3IMAA 3V6EA 4PADA 4WA6A 4PI3A 5CVOB 4I05A 2FTDA 1QDQA 3CBKA 1MDWA 2NQGA 1E2TA 5CHTA 3RVXA 4N79A 2FO5A 3KW9A 4W5BA 4MSXA 1U9XA 1NQCA 4RY2A 1ITOA 1AIMA 4CDEB 1FH0A 4P6GA 4NV7A 2CIOA 1NPZA 2G8EA 3TNXA 2HH5A 1KXRA 1AU4A 3HHIA 3HWNA 4FIPA 2DCDA 3V6CA 1F29A 2YJCA 4X6IA 3CH2X 4HWYA 2XU4A 1PPNA 2DJGB 1AU3A 4BPVA 3N4CA 4FJCA 3LTWA 2VFBA 2AYNA 4N4ZA 1GLOA 3OVXA 1U9VA 3I3TA 2DZZA 5PADA 3PDFA 3S3QA 3ZUAA 2GFOA 1EWMA 4YVAA 3OF8A 4N8WA 1U5IA 1Y08A 3D9WA 4OEMA 4XR7A 1CJLA 2FQ9A 2BSZA 2DCBA 3IV2A 1ATKA 2E00A 1W4TA 1TU6A 1ME4A 3C9EA 4I07A 4QRXA 2XU1A 1NL6A 1YK7A 2OP3A 2G7YA 2PNSA 2DJFB 2H7JA 3KWZA 4Q8HA 4QRVA 4I04A 3H89A 3BCNA 1CS8A 1YK8A 3WXFA 1QXPA 5CVMA 3PBHA 3MORA 1DEUA 3D6SA 1Q6KA 2E01A 2OZ2A 2JQFR 3MTNA 2BDZA 2E02A 4AXLA 1GX3A 1ME3A 4CDCB 4XUIA 3OF9A 2VHFA 1BQIA 1PE6A 2IPPB 3OISA 1CSBB 2IBIA 1PIPA 3I06A 3O0UA 1AU2A 3NHEA 3HD3A 4MZSA 4YV8A 4YYVA 4BSQA 3WXEA 3S3RA 4C5PA 2Y6EA 5J94A 1BGOA 3BWKA 1X9YA 4GUZA 5CHVA 1NB3A 3KFQA 2E03A 2AYOA 2VFCA 3P5XA 3N3GA 4BQVA 3PNRA 3GCBA 1TL9A 4QBBA 1A6RA 1CV8A 2XU3A 3K24A 4YYRA 3P5WA 1AYUA 1JQPA 3P5VA 4B55A 4X6JA 1PADA 2DC6A 3WXGA 3IUTA 2CB5A 3KWBX 2WBFX 1VJVA 1F2BA 3KSEA 1EWOA 1Y4HA 4QH6A 2P0RA 3H8CA 3LXSA 2DC8A 1MIRA 4G54A 4YYQA 1SNKA 2R6NA 2F7DA 3KX1A 2GHUA 1K3BB 4K7CA 1S4VA 1PXVA 8PCHA 2R9MA 3P5UA 2XU5A 1THEA 3DF0A 4X6HA 2FRAA 1PPPA 1VSNA 1O0EA 3O1GA 3PW3A 5CVNB 1XKGA 2HD5A 3MHHA 4W5CA 1W5RA 2G6DA 1F2AA 2FRQA 2YJ8A 2R9NA 3BPMA 3B79A 4BS6A 2P7UA 1CPJA 1PCIA 2ATOA 4OELA 3CH3X 1AECA 4YYSA 1GECE 2ARYA 2AUXA 2DZYA 2FYEA 1GCBA 1EF7A 1DF0A 2R9CA 4DMYA 1CVZA 1M6DA 3LFYA 5JA7A 2YJBA 1PPDA 4W4UA 1GMYA 4PP1A 4CZWA 2OULA 4BS5A 1AYVA 1U9WA 4P6EA 4CDFB 1PPOA 1CTEA 1YALA 2B1NA 1BP4A 1QMYA 2AU1A 1YT7A 3N3KA 1CB5A 1MEMA 1NB5A 2JQGR 1W6FA 2Y5BA 3CBJA 3OVZA 2HHNA 1U9QX 5EF4A 3F75A 1QOLA 1KHQA 1EWLA 2DCCA 3USVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MHW A;  3IHP A;  3MHS A;  2NQA A;  1PBH A;  5FPW A;  2R9F A;  3H6S A;  2AUZ A;  4QRG A;  5F02 A;  2F1G A;  2YJ9 A;  4FK5 A;  4AXM A;  3U8E A;  1MS6 A;  3H7D A;  1MEG A;  6PAD A;  1NLJ A;  1SP4 B;  1CQD A;  4YYU A;  3QJ3 A;  2VHS A;  2PRE A;  3RVV A;  2BDL A;  4DMX A;  4KLB A;  1TLO A;  1IWD A;  4PP2 E;  5EGW A;  2PBH A;  2B1M A;  4CDD B;  1ICF A;  4Q8G A;  1EWP A;  3IOQ A;  2AIM A;  4ZUX U;  5K16 A;  2G8J A;  2C0Y A;  2R9O A;  3F5V A;  1AYW A;  2DC9 A;  3BOW A;  2ACT A;  2YJ2 A;  3QSD A;  1KFX L;  2AS8 A;  3HHA A;  3RVW A;  7PCK A;  1F2C A;  2HXZ A;  3KKU A;  1ZIV A;  3K8U A;  2PAD A;  3AI8 A;  4MZO A;  1POP A;  3IEJ A;  2DCA A;  2FUD A;  3K9M A;  9PAP A;  3ERV A;  1STF E;  3BPF A;  2FT2 A;  1YVB A;  2O6X A;  1ZCM A;  2AVW A;  2NQD B;  3M99 A;  1KHP A;  3BC3 A;  1KFU L;  4YYW A;  3E1Z B;  3H8B A;  1HUC B;  2P86 A;  2DC7 A;  5A24 A;  2NQI A;  3QT4 A;  5JH3 A;  1AU0 A;  1BY8 A;  3V6E A;  3IMA A;  4PAD A;  4WA6 A;  4PI3 A;  5CVO B;  4I05 A;  2FTD A;  1QDQ A;  3CBK A;  1MDW A;  2NQG A;  5CHT A;  3RVX A;  4N79 A;  2FO5 A;  3KW9 A;  4W5B A;  4MSX A;  1U9X A;  1NQC A;  4RY2 A;  1ITO A;  1AIM A;  4CDE B;  1FH0 A;  4P6G A;  2CIO A;  1NPZ A;  2G8E A;  3TNX A;  2HH5 A;  1KXR A;  1AU4 A;  3HHI A;  3HWN A;  4FIP A;  2DCD A;  3V6C A;  1F29 A;  2YJC A;  4X6I A;  3CH2 X;  4HWY A;  2XU4 A;  1PPN A;  2DJG B;  1AU3 A;  4BPV A;  3N4C A;  4FJC A;  2AYN A;  4N4Z A;  1GLO A;  3OVX A;  1U9V A;  3I3T A;  2DZZ A;  5PAD A;  3PDF A;  3S3Q A;  3ZUA A;  2GFO A;  1EWM A;  4YVA A;  3OF8 A;  4N8W A;  1U5I A;  1Y08 A;  4OEM A;  4XR7 A;  1CJL A;  2FQ9 A;  2DCB A;  3IV2 A;  1ATK A;  2E00 A;  1TU6 A;  1ME4 A;  3C9E A;  4I07 A;  4QRX A;  2XU1 A;  1NL6 A;  1YK7 A;  2OP3 A;  2G7Y A;  2PNS A;  2DJF B;  2H7J A;  3KWZ A;  4Q8H A;  4QRV A;  4I04 A;  3H89 A;  3BCN A;  1CS8 A;  1YK8 A;  3WXF A;  1QXP A;  5CVM A;  3PBH A;  3MOR A;  1DEU A;  3D6S A;  1Q6K A;  2E01 A;  2OZ2 A;  2JQF R;  3MTN A;  2BDZ A;  2E02 A;  4AXL A;  1ME3 A;  4CDC B;  4XUI A;  3OF9 A;  2VHF A;  1BQI A;  1PE6 A;  2IPP B;  3OIS A;  1CSB B;  2IBI A;  1PIP A;  3I06 A;  3O0U A;  1AU2 A;  3NHE A;  3HD3 A;  4MZS A;  4YV8 A;  4YYV A;  4BSQ A;  3WXE A;  3S3R A;  2Y6E A;  5J94 A;  1BGO A;  3BWK A;  1X9Y A;  5CHV A;  1NB3 A;  3KFQ A;  2E03 A;  2AYO A;  3P5X A;  3N3G A;  4BQV A;  3PNR A;  3GCB A;  1TL9 A;  4QBB A;  1A6R A;  1CV8 A;  2XU3 A;  3K24 A;  4YYR A;  3P5W A;  1AYU A;  1JQP A;  3P5V A;  4X6J A;  1PAD A;  2DC6 A;  3WXG A;  3IUT A;  2CB5 A;  3KWB X;  2WBF X;  1VJV A;  1F2B A;  3KSE A;  1EWO A;  1Y4H A;  4QH6 A;  2P0R A;  3H8C A;  3LXS A;  2DC8 A;  1MIR A;  4G54 A;  4YYQ A;  1SNK A;  2R6N A;  2F7D A;  3KX1 A;  2GHU A;  1K3B B;  4K7C A;  1S4V A;  1PXV A;  8PCH A;  2R9M A;  3P5U A;  2XU5 A;  1THE A;  3DF0 A;  4X6H A;  2FRA A;  1PPP A;  1VSN A;  1O0E A;  3O1G A;  3PW3 A;  5CVN B;  1XKG A;  2HD5 A;  3MHH A;  4W5C A;  2G6D A;  1F2A A;  2FRQ A;  2YJ8 A;  2R9N A;  3BPM A;  3B79 A;  4BS6 A;  2P7U A;  1CPJ A;  1PCI A;  2ATO A;  4OEL A;  3CH3 X;  1AEC A;  4YYS A;  1GEC E;  2ARY A;  2AUX A;  2DZY A;  2FYE A;  1GCB A;  1EF7 A;  1DF0 A;  2R9C A;  4DMY A;  1CVZ A;  1M6D A;  3LFY A;  5JA7 A;  2YJB A;  1PPD A;  4W4U A;  1GMY A;  4PP1 A;  4CZW A;  2OUL A;  4BS5 A;  1AYV A;  1U9W A;  4P6E A;  4CDF B;  1PPO A;  1CTE A;  1YAL A;  2B1N A;  1BP4 A;  1QMY A;  2AU1 A;  1YT7 A;  3N3K A;  1CB5 A;  1MEM A;  1NB5 A;  2JQG R;  2Y5B A;  3CBJ A;  3OVZ A;  2HHN A;  1U9Q X;  5EF4 A;  3F75 A;  1QOL A;  1KHQ A;  1EWL A;  2DCC A;  3USV A; 
#chains in the Genus database with same CATH topology
 1MHW A;  3IHP A;  3MHS A;  2NQA A;  3TMP A;  1PBH A;  5FPW A;  2R9F A;  2AGA A;  3H6S A;  2AUZ A;  4QRG A;  5F02 A;  2F1G A;  2YJ9 A;  4FK5 A;  4MM3 B;  4AXM A;  3OQC A;  3U8E A;  1MS6 A;  5JZE A;  3H7D A;  1MEG A;  6PAD A;  4PT5 A;  1NLJ A;  1SP4 B;  1CQD A;  4YYU A;  3QJ3 A;  2VHS A;  2PRE A;  3RVV A;  2BDL A;  4DMX A;  4KLB A;  1TLO A;  1IWD A;  4PP2 E;  2J7Q C;  5EGW A;  2PBH A;  2B1M A;  4RNA A;  4CDD B;  5EZS A;  1ICF A;  4Q8G A;  1EWP A;  3IOQ A;  2AIM A;  4ZUX U;  5K16 A;  2G8J A;  2C0Y A;  2R9O A;  3F5V A;  1AYW A;  2DC9 A;  3BOW A;  2ACT A;  2YJ2 A;  3QSD A;  1KFX L;  2AS8 A;  3HHA A;  3RVW A;  7PCK A;  1F2C A;  2HXZ A;  3KKU A;  1ZIV A;  3K8U A;  4RF0 A;  2J7Q A;  2PAD A;  3AI8 A;  4MZO A;  1POP A;  3IEJ A;  2DCA A;  2FUD A;  3K9M A;  9PAP A;  3ERV A;  1STF E;  3BPF A;  2FT2 A;  1YVB A;  2O6X A;  1ZCM A;  2AVW A;  2NQD B;  3M99 A;  2BTW B;  1KHP A;  3BC3 A;  3PRM A;  1KFU L;  4YYW A;  3E1Z B;  3H8B A;  1HUC B;  2P86 A;  4BOS A;  2DC7 A;  4D8I A;  5A24 A;  2NQI A;  3PHW A;  3QT4 A;  5JH3 A;  1AU0 A;  1BY8 A;  3V6E A;  3IMA A;  2BTW A;  3MJ5 A;  4PAD A;  4WA6 A;  4PI3 A;  5CVO B;  4I05 A;  2FTD A;  1QDQ A;  3CBK A;  1MDW A;  2NQG A;  4IUM A;  4BOZ A;  5CHT A;  3RVX A;  4OVZ A;  4N79 A;  2FO5 A;  3KW9 A;  4W5B A;  4MSX A;  1U9X A;  1NQC A;  4RY2 A;  1ITO A;  1AIM A;  4CDE B;  1FH0 A;  4P6G A;  2JTC A;  3PHX A;  2CIO A;  1NPZ A;  2G8E A;  3TNX A;  3PHU A;  2HH5 A;  1KXR A;  1AU4 A;  3HHI A;  3HWN A;  4FIP A;  2DCD A;  3V6C A;  1F29 A;  2YJC A;  4HXD B;  4X6I A;  3CH2 X;  3BB7 A;  3BY4 A;  4HWY A;  3ZNH A;  2XU4 A;  1PPN A;  2DJG B;  3RNV A;  1AU3 A;  4MI7 A;  4BPV A;  3N4C A;  4FJC A;  3W31 A;  3IFU A;  2AYN A;  4ZTB A;  4N4Z A;  3E9S A;  1GLO A;  4GUA A;  3OVX A;  1U9V A;  3I3T A;  2DZZ A;  5PAD A;  4OW0 A;  3PDF A;  3S3Q A;  3ZUA A;  2GFO A;  1EWM A;  4YVA A;  3OF8 A;  1UKF A;  4N8W A;  1U5I A;  4WUR A;  1Y08 A;  4OEM A;  4XR7 A;  1CJL A;  2FQ9 A;  2DCB A;  3IV2 A;  1ATK A;  2E00 A;  1TU6 A;  5E6J A;  1ME4 A;  4RF1 A;  3C9E A;  4I07 A;  4QRX A;  2XU1 A;  1NL6 A;  4A5U A;  1YK7 A;  2OP3 A;  2G7Y A;  2PNS A;  2DJF B;  2H7J A;  3KWZ A;  4Q8H A;  4QRV A;  4I04 A;  3C0R A;  3H89 A;  3BCN A;  1CS8 A;  1YK8 A;  3WXF A;  1QXP A;  5CVM A;  3PBH A;  4BOQ A;  3MOR A;  1DEU A;  3D6S A;  1Q6K A;  2E01 A;  2OZ2 A;  2JQF R;  3MTN A;  2BDZ A;  2E02 A;  4AXL A;  4IP3 A;  1ME3 A;  4CDC B;  4XUI A;  2Z84 A;  3OF9 A;  2VHF A;  4M0W A;  1BQI A;  1PE6 A;  2IPP B;  3OIS A;  4P16 A;  1CSB B;  2IBI A;  4D8E A;  3W30 A;  4BOU A;  1PIP A;  3O0U A;  2FE8 A;  3I06 A;  1AU2 A;  3PSE A;  3NHE A;  3HD3 A;  4MZS A;  4YV8 A;  4YYV A;  4BSQ A;  3WXE A;  3S3R A;  2Y6E A;  5J94 A;  1BGO A;  3BWK A;  1X9Y A;  5CHV A;  1NB3 A;  3KFQ A;  2E03 A;  2AYO A;  3P5X A;  3N3G A;  4BQV A;  3PNR A;  3GCB A;  1TL9 A;  3MP2 A;  4QBB A;  1A6R A;  1CV8 A;  2XU3 A;  3K24 A;  4YYR A;  5KO3 A;  2UZJ A;  3PRP A;  4BOP A;  3P5W A;  1AYU A;  1JQP A;  3P5V A;  3MTV A;  4X6J A;  1PAD A;  2DC6 A;  3WXG A;  2HWK A;  3IUT A;  2CB5 A;  3KWB X;  2WBF X;  1VJV A;  1F2B A;  3KSE A;  1EWO A;  1Y4H A;  4QH6 A;  2P0R A;  3H8C A;  2JRI A;  3LXS A;  2DC8 A;  1MIR A;  3TRK A;  4G54 A;  4REZ A;  4YYQ A;  1SNK A;  2R6N A;  2F7D A;  3KX1 A;  2GHU A;  1K3B B;  4K7C A;  1S4V A;  1PXV A;  8PCH A;  2R9M A;  3P5U A;  5EZQ A;  2XU5 A;  1THE A;  3DF0 A;  4X6H A;  2FRA A;  1PPP A;  1VSN A;  1PVJ A;  1O0E A;  3O1G A;  3PW3 A;  4XZX A;  3BBA A;  5CVN B;  1XKG A;  2HD5 A;  3MHH A;  4RKX A;  4W5C A;  3O65 A;  2G6D A;  1F2A A;  2FRQ A;  2YJ8 A;  2R9N A;  3BPM A;  3B79 A;  4BS6 A;  2P7U A;  1CPJ A;  1PCI A;  2ATO A;  4OEL A;  3CH3 X;  1AEC A;  4YYS A;  1YZB A;  1GEC E;  2ARY A;  2AUX A;  2DZY A;  2FYE A;  1GCB A;  1EF7 A;  3PT2 A;  1DF0 A;  2R9C A;  4DMY A;  1CVZ A;  1M6D A;  3LFY A;  5JA7 A;  1DKI A;  2DOS A;  2YJB A;  1PPD A;  4OVZ B;  4W4U A;  1GMY A;  4PP1 A;  4D8B A;  4CZW A;  2OUL A;  4BS5 A;  1AYV A;  1U9W A;  4P6E A;  4CDF B;  1PPO A;  1CTE A;  1YAL A;  2B1N A;  1BP4 A;  1QMY A;  2AU1 A;  1YT7 A;  3N3K A;  4R3D A;  1CB5 A;  1MEM A;  1NB5 A;  2JQG R;  2Y5B A;  3CBJ A;  3OVZ A;  2BU3 A;  2HHN A;  1U9Q X;  5EF4 A;  3F75 A;  3B21 A;  1QOL A;  1KHQ A;  1EWL A;  2DCC A;  3USV A; 
#chains in the Genus database with same CATH homology
 1MHW A;  3IHP A;  3MHS A;  2NQA A;  1PBH A;  5FPW A;  2R9F A;  3H6S A;  2AUZ A;  4QRG A;  5F02 A;  2F1G A;  2YJ9 A;  4FK5 A;  4AXM A;  3U8E A;  1MS6 A;  3H7D A;  4BGF A;  1MEG A;  6PAD A;  1NLJ A;  1SP4 B;  1CQD A;  4YYU A;  3QJ3 A;  2VHS A;  2PRE A;  3RVV A;  2BDL A;  4DMX A;  4KLB A;  1TLO A;  1IWD A;  4PP2 E;  5EGW A;  2PBH A;  2B1M A;  4CDD B;  1ICF A;  4Q8G A;  1EWP A;  3IOQ A;  2AIM A;  4ZUX U;  5K16 A;  2G8J A;  2C0Y A;  2R9O A;  3F5V A;  1AYW A;  2DC9 A;  3BOW A;  2ACT A;  2YJ2 A;  3QSD A;  1KFX L;  2AS8 A;  3HHA A;  3RVW A;  7PCK A;  1F2C A;  2HXZ A;  3KKU A;  1ZIV A;  3K8U A;  2PAD A;  3AI8 A;  4MZO A;  1POP A;  3IEJ A;  2DCA A;  2FUD A;  3K9M A;  9PAP A;  3ERV A;  1STF E;  3BPF A;  2FT2 A;  1YVB A;  2O6X A;  1ZCM A;  2AVW A;  2NQD B;  3M99 A;  1KHP A;  3BC3 A;  1KFU L;  4YYW A;  3E1Z B;  3H8B A;  1HUC B;  2P86 A;  2DC7 A;  5A24 A;  2NQI A;  3QT4 A;  5JH3 A;  1AU0 A;  1BY8 A;  4NV8 A;  3IMA A;  3V6E A;  4PAD A;  4WA6 A;  4PI3 A;  5CVO B;  4I05 A;  2FTD A;  1QDQ A;  3CBK A;  1MDW A;  2NQG A;  1E2T A;  5CHT A;  3RVX A;  4N79 A;  2FO5 A;  3KW9 A;  4W5B A;  4MSX A;  1U9X A;  1NQC A;  4RY2 A;  1ITO A;  1AIM A;  4CDE B;  1FH0 A;  4P6G A;  4NV7 A;  2CIO A;  1NPZ A;  2G8E A;  3TNX A;  2HH5 A;  1KXR A;  1AU4 A;  3HHI A;  3HWN A;  4FIP A;  2DCD A;  3V6C A;  1F29 A;  2YJC A;  4X6I A;  3CH2 X;  4HWY A;  2XU4 A;  1PPN A;  2DJG B;  1AU3 A;  4BPV A;  3N4C A;  4FJC A;  3LTW A;  2VFB A;  2AYN A;  4N4Z A;  1GLO A;  3OVX A;  1U9V A;  3I3T A;  2DZZ A;  5PAD A;  3PDF A;  3S3Q A;  3ZUA A;  2GFO A;  1EWM A;  4YVA A;  3OF8 A;  4N8W A;  1U5I A;  1Y08 A;  3D9W A;  4OEM A;  4XR7 A;  1CJL A;  2FQ9 A;  2BSZ A;  2DCB A;  3IV2 A;  1ATK A;  2E00 A;  1W4T A;  1TU6 A;  1ME4 A;  3C9E A;  4I07 A;  4QRX A;  2XU1 A;  1NL6 A;  1YK7 A;  2OP3 A;  2G7Y A;  2PNS A;  2DJF B;  2H7J A;  3KWZ A;  4Q8H A;  4QRV A;  4I04 A;  3H89 A;  3BCN A;  1CS8 A;  1YK8 A;  3WXF A;  1QXP A;  5CVM A;  3PBH A;  3MOR A;  1DEU A;  3D6S A;  1Q6K A;  2E01 A;  2OZ2 A;  2JQF R;  3MTN A;  2BDZ A;  2E02 A;  4AXL A;  1GX3 A;  1ME3 A;  4CDC B;  4XUI A;  3OF9 A;  2VHF A;  1BQI A;  1PE6 A;  2IPP B;  3OIS A;  1CSB B;  2IBI A;  1PIP A;  3I06 A;  3O0U A;  1AU2 A;  3NHE A;  3HD3 A;  4MZS A;  4YV8 A;  4YYV A;  4BSQ A;  3WXE A;  3S3R A;  4C5P A;  2Y6E A;  5J94 A;  1BGO A;  3BWK A;  1X9Y A;  4GUZ A;  5CHV A;  1NB3 A;  3KFQ A;  2E03 A;  2AYO A;  2VFC A;  3P5X A;  3N3G A;  4BQV A;  3PNR A;  3GCB A;  1TL9 A;  4QBB A;  1A6R A;  1CV8 A;  2XU3 A;  3K24 A;  4YYR A;  3P5W A;  1AYU A;  1JQP A;  3P5V A;  4B55 A;  4X6J A;  1PAD A;  2DC6 A;  3WXG A;  3IUT A;  2CB5 A;  3KWB X;  2WBF X;  1VJV A;  1F2B A;  3KSE A;  1EWO A;  1Y4H A;  4QH6 A;  2P0R A;  3H8C A;  3LXS A;  2DC8 A;  1MIR A;  4G54 A;  4YYQ A;  1SNK A;  2R6N A;  2F7D A;  3KX1 A;  2GHU A;  1K3B B;  4K7C A;  1S4V A;  1PXV A;  8PCH A;  2R9M A;  3P5U A;  2XU5 A;  1THE A;  3DF0 A;  4X6H A;  2FRA A;  1PPP A;  1VSN A;  1O0E A;  3O1G A;  3PW3 A;  5CVN B;  1XKG A;  2HD5 A;  3MHH A;  4W5C A;  1W5R A;  2G6D A;  1F2A A;  2FRQ A;  2YJ8 A;  2R9N A;  3BPM A;  3B79 A;  4BS6 A;  2P7U A;  1CPJ A;  1PCI A;  2ATO A;  4OEL A;  3CH3 X;  1AEC A;  4YYS A;  1GEC E;  2ARY A;  2AUX A;  2DZY A;  2FYE A;  1GCB A;  1EF7 A;  1DF0 A;  2R9C A;  4DMY A;  1CVZ A;  1M6D A;  3LFY A;  5JA7 A;  2YJB A;  1PPD A;  4W4U A;  1GMY A;  4PP1 A;  4CZW A;  2OUL A;  4BS5 A;  1AYV A;  1U9W A;  4P6E A;  4CDF B;  1PPO A;  1CTE A;  1YAL A;  2B1N A;  1BP4 A;  1QMY A;  2AU1 A;  1YT7 A;  3N3K A;  1CB5 A;  1MEM A;  1NB5 A;  2JQG R;  1W6F A;  2Y5B A;  3CBJ A;  3OVZ A;  2HHN A;  1U9Q X;  5EF4 A;  3F75 A;  1QOL A;  1KHQ A;  1EWL A;  2DCC A;  3USV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...