2FT2A

Human cathepsin s with inhibitor cra-29728
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
217
structure length
217
Chain Sequence
b'LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cathepsin S
publication title Human Cathepsin S with Inhibitor CRA-29728
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 49
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2ft2A00
3H8BA 1AYVA 1CJLA 1TU6A 4YYQA 3O1GA 4HWYA 1AU4A 2XU4A 3MORA 4X6JA 1O0EA 2YJCA 4QH6A 1MEGA 2OULA 1AYUA 4I07A 5CHVA 1S4VA 3H89A 4CDDB 3IMAA 1MIRA 2FRQA 1MDWA 3B79A 4PADA 5A24A 1NPZA 1MEMA 1PPOA 1NLJA 3HD3A 1CTEA 1YALA 3K9MA 5CVNB 4WA6A 4CDCB 3O0UA 4W4UA 4X6HA 1THEA 3H6SA 1PBHA 2BDLA 3RVWA 1AU3A 2XU1A 3K8UA 5EGWA 1EWPA 1CV8A 5F02A 1PPPA 3PW3A 4QRXA 2DCCA 2CIOA 2ACTA 1KXRA 4OELA 3WXEA 3MHSA 1GMYA 2G7YA 4XR7A 3MTNA 1ICFA 4YVAA 1SP4B 4N79A 5K16A 4X6IA 3HHAA 1CVZA 4W5CA 3KWZA 2NQAA 3MHHA 4CZWA 2R9NA 3V6CA 3V6EA 5PADA 1ME3A 1EWOA 4DMXA 3C9EA 3I06A 2FRAA 2E02A 7PCKA 1POPA 2P7UA 1TL9A 3BPMA 2F1GA 3KSEA 4MZOA 3OF8A 2OZ2A 3S3QA 1HUCB 3OVXA 2AYOA 2E01A 2FTDA 3BOWA 3PDFA 3CBKA 2DCDA 1NB5A 3BCNA 2HD5A 3IUTA 3OVZA 4P6GA 3LXSA 4YYWA 3F75A 2R9OA 4PI3A 1M6DA 3S3RA 1F29A 2AVWA 3DF0A 2YJBA 2YJ2A 2DZZA 1NB3A 2G6DA 1STFE 4ZUXU 3M99A 4KLBA 1MS6A 2XU3A 4N4ZA 5CVMA 5J94A 2P0RA 3QT4A 2DC6A 4BQVA 1KFXL 3IV2A 1YK8A 4BPVA 3BWKA 4P6EA 1Q6KA 1NL6A 2G8EA 2NQDB 4CDFB 5EF4A 3N4CA 1QOLA 4W5BA 4FIPA 3WXFA 4I04A 1YVBA 2FQ9A 1YK7A 1ZIVA 4PP1A 1QMYA 2AUXA 1PPNA 4G54A 4QRGA 4RY2A 2BDZA 1Y08A 1U9XA 2R9FA 2P86A 2ATOA 4BSQA 1U9WA 4BS6A 4I05A 3AI8A 2FYEA 3N3KA 2ARYA 2AS8A 1AYWA 1Y4HA 1GCBA 2DCBA 2JQGR 4FK5A 1F2AA 3TNXA 5CVOB 1GLOA 2Y5BA 3NHEA 5CHTA 2YJ9A 1BQIA 3GCBA 2HXZA 1DEUA 2IPPB 2JQFR 3IEJA 1MHWA 1QXPA 1IWDA 2PADA 1ME4A 4YYSA 1BY8A 1X9YA 4K7CA 1FH0A 4CDEB 1TLOA 1U9VA 1QDQA 3ERVA 1XKGA 3K24A 2DZYA 2C0YA 1AU0A 1EF7A 3USVA 2AYNA 4FJCA 2B1NA 5JH3A 1ATKA 1CS8A 5FPWA 1YT7A 2PBHA 1A6RA 1KFUL 2Y6EA 3E1ZB 1CB5A 3H7DA 1PE6A 2H7JA 2NQIA 3CBJA 2DCAA 4N8WA 1SNKA 3CH2X 4MZSA 3H8CA 2WBFX 2R9MA 3P5XA 4PP2E 3KFQA 1KHQA 1F2CA 4QBBA 3CH3X 5JA7A 3QSDA 3IHPA 2FT2A 6PADA 2NQGA 3RVVA 2FO5A 2AIMA 2PNSA 3ZUAA 3P5WA 2YJ8A 3LFYA 1GECE 1KHPA 2HH5A 4YV8A 2E03A 1PPDA 1AU2A 2GFOA 2PREA 2G8JA 3U8EA 3BPFA 2DJGB 3PBHA 3OF9A 2B1MA 2DC7A 3I3TA 1U9QX 3IOQA 1JQPA 4XUIA 3HWNA 2DJFB 2E00A 4Q8GA 1ZCMA 2O6XA 2DC8A 3OISA 1ITOA 3N3GA 3KW9A 1EWMA 9PAPA 4DMYA 3KWBX 1U5IA 1VJVA 1CSBB 4YYUA 1CPJA 8PCHA 2R6NA 2OP3A 2IBIA 2HHNA 3P5UA 4MSXA 3KKUA 3P5VA 1BP4A 1VSNA 2AU1A 1AECA 3WXGA 3D6SA 1PCIA 4AXLA 2DC9A 2CB5A 1DF0A 1PADA 4YYVA 4YYRA 3RVXA 1NQCA 3F5VA 4BS5A 2VHFA 2GHUA 3PNRA 4QRVA 2F7DA 2AUZA 1F2BA 1CQDA 4Q8HA 1AIMA 2R9CA 3QJ3A 2VHSA 3HHIA 2FUDA 1PIPA 1BGOA 4AXMA 1PXVA 1K3BB 4OEMA 1EWLA 2XU5A 3BC3A 3KX1A
chains in the Genus database with same CATH superfamily
3H8BA 1AYVA 1CJLA 3PSEA 1TU6A 4YYQA 3O1GA 3TMPA 4HWYA 1AU4A 2XU4A 3MORA 3C0RA 4BOUA 4X6JA 1O0EA 2YJCA 4QH6A 1MEGA 2OULA 5JZEA 1AYUA 4I07A 5CHVA 1S4VA 3H89A 4CDDB 3IMAA 1MIRA 2FRQA 1MDWA 3B79A 4PADA 5A24A 4OW0A 3PT2A 1NPZA 4BOPA 2JRIA 1MEMA 1PPOA 1NLJA 3HD3A 3MP2A 1CTEA 1YALA 3K9MA 5CVNB 4WA6A 4CDCB 3O0UA 4W4UA 4X6HA 1THEA 3H6SA 1PBHA 2BDLA 3RVWA 1AU3A 2XU1A 3K8UA 3PHXA 5EGWA 1EWPA 1CV8A 5F02A 1PPPA 3PW3A 4QRXA 2DCCA 3RNVA 4IP3A 2CIOA 4PT5A 2ACTA 1KXRA 4RKXA 4OELA 3WXEA 3MHSA 1GMYA 2G7YA 4XR7A 3MTNA 2BTWA 1ICFA 4YVAA 1SP4B 4N79A 5K16A 4X6IA 3HHAA 3ZNHA 1CVZA 4W5CA 3KWZA 2NQAA 3MHHA 4CZWA 2R9NA 3V6CA 3V6EA 5PADA 1ME3A 1EWOA 4DMXA 3C9EA 3I06A 2FRAA 2E02A 7PCKA 1POPA 2P7UA 1TL9A 3BPMA 2AGAA 3BBAA 2F1GA 3KSEA 4MI7A 4MZOA 5E6JA 4OVZB 3OF8A 2OZ2A 3S3QA 1HUCB 3OVXA 2AYOA 2E01A 2FTDA 3BOWA 3PDFA 3CBKA 2DCDA 1NB5A 3BCNA 2HD5A 3IUTA 3OVZA 4P6GA 3LXSA 3W31A 4YYWA 3F75A 2R9OA 4PI3A 1M6DA 3S3RA 2HWKA 1F29A 2AVWA 3DF0A 2YJBA 3PHWA 2YJ2A 2DZZA 1NB3A 2G6DA 1STFE 4ZUXU 3M99A 4KLBA 1MS6A 3TRKA 2XU3A 4N4ZA 5CVMA 5J94A 2P0RA 3O65A 3QT4A 2DC6A 4IUMA 4BQVA 1KFXL 3IV2A 4GUAA 1YK8A 4BPVA 3BWKA 4P6EA 1Q6KA 1NL6A 2G8EA 2NQDB 4CDFB 5EF4A 3N4CA 1QOLA 4W5BA 4FIPA 3WXFA 4I04A 1YVBA 2FQ9A 1YK7A 1ZIVA 3W30A 4PP1A 3BY4A 1QMYA 4RF1A 3PRPA 2AUXA 1PPNA 4G54A 4QRGA 4RY2A 2BDZA 1Y08A 1U9XA 2R9FA 2P86A 2ATOA 2J7QA 4BSQA 1U9WA 4BS6A 4I05A 4OVZA 3AI8A 2FYEA 3N3KA 4BOQA 2ARYA 2FE8A 2AS8A 1AYWA 1Y4HA 1GCBA 2DCBA 2DOSA 2JQGR 4FK5A 1F2AA 5KO3A 3TNXA 5CVOB 1GLOA 4M0WA 2Y5BA 3NHEA 5CHTA 2YJ9A 4HXDB 1BQIA 3GCBA 2HXZA 1DEUA 2IPPB 2JTCA 2JQFR 3IEJA 1MHWA 1QXPA 1IWDA 2PADA 1ME4A 4YYSA 1BY8A 1X9YA 4K7CA 1FH0A 4WURA 4CDEB 1TLOA 1U9VA 4R3DA 1QDQA 3ERVA 1XKGA 3K24A 2DZYA 2C0YA 1AU0A 3MTVA 1EF7A 3USVA 2AYNA 4FJCA 2B1NA 4BOZA 4ZTBA 5JH3A 1ATKA 1CS8A 4P16A 5FPWA 1YT7A 2PBHA 1A6RA 1KFUL 2Y6EA 3E9SA 3E1ZB 1CB5A 3H7DA 1PE6A 3IFUA 2H7JA 1PVJA 2BU3A 2NQIA 3CBJA 2DCAA 4N8WA 1SNKA 3OQCA 3CH2X 4MZSA 1UKFA 3H8CA 2WBFX 4RF0A 2R9MA 3P5XA 4PP2E 3KFQA 1KHQA 1F2CA 4QBBA 4RNAA 3CH3X 5JA7A 3QSDA 3IHPA 2FT2A 3PRMA 3B21A 6PADA 2NQGA 3RVVA 2FO5A 2AIMA 5EZSA 2PNSA 3ZUAA 3P5WA 2YJ8A 3LFYA 1GECE 1KHPA 2HH5A 4YV8A 2E03A 1PPDA 1AU2A 2GFOA 2PREA 2G8JA 4A5UA 3U8EA 3BPFA 2DJGB 3PBHA 3OF9A 2B1MA 2DC7A 3I3TA 1U9QX 3BB7A 3IOQA 1JQPA 4XUIA 3HWNA 2DJFB 2E00A 3MJ5A 2Z84A 4Q8GA 1ZCMA 2O6XA 2DC8A 3OISA 1ITOA 3N3GA 3KW9A 1EWMA 9PAPA 4DMYA 3KWBX 1U5IA 1VJVA 1CSBB 4YYUA 1CPJA 8PCHA 2R6NA 2OP3A 2UZJA 2IBIA 2HHNA 3PHUA 4D8BA 3P5UA 4MSXA 3KKUA 3P5VA 1BP4A 1VSNA 2AU1A 1AECA 3WXGA 3D6SA 4D8IA 1PCIA 4AXLA 2DC9A 4XZXA 2CB5A 1DF0A 1PADA 4YYVA 4YYRA 3RVXA 1NQCA 3F5VA 5EZQA 4BS5A 2VHFA 2GHUA 3PNRA 4QRVA 2F7DA 2BTWB 2AUZA 1F2BA 1CQDA 4Q8HA 1DKIA 1AIMA 4MM3B 1YZBA 2R9CA 3QJ3A 2VHSA 3HHIA 2FUDA 1PIPA 4BOSA 1BGOA 4AXMA 1PXVA 1K3BB 4OEMA 1EWLA 2XU5A 4D8EA 3BC3A 4REZA 3KX1A 2J7QC
chains in the Genus database with same CATH topology
3H8BA 1AYVA 1CJLA 1TU6A 4YYQA 3O1GA 4HWYA 1AU4A 2XU4A 3MORA 4X6JA 1O0EA 2YJCA 4QH6A 1MEGA 2OULA 1AYUA 4I07A 5CHVA 1S4VA 3H89A 4CDDB 3IMAA 1MIRA 2FRQA 1MDWA 3B79A 4PADA 5A24A 1NPZA 1MEMA 1PPOA 1NLJA 3HD3A 3LTWA 1CTEA 1YALA 3K9MA 5CVNB 4WA6A 4CDCB 3O0UA 4W4UA 4X6HA 1THEA 3H6SA 1PBHA 2BDLA 3RVWA 1AU3A 2XU1A 3K8UA 5EGWA 1EWPA 1CV8A 5F02A 1PPPA 3PW3A 4QRXA 2DCCA 2CIOA 2ACTA 1KXRA 4OELA 3WXEA 3MHSA 1GMYA 2G7YA 4XR7A 3MTNA 1ICFA 4YVAA 1SP4B 4N79A 5K16A 4BGFA 4X6IA 3HHAA 3D9WA 1CVZA 4W5CA 3KWZA 2NQAA 3MHHA 4CZWA 2R9NA 3V6CA 3V6EA 5PADA 1ME3A 1EWOA 4DMXA 3C9EA 3I06A 2FRAA 2E02A 7PCKA 1POPA 2P7UA 4C5PA 1TL9A 3BPMA 2F1GA 3KSEA 4MZOA 3OF8A 2OZ2A 3S3QA 1HUCB 3OVXA 2AYOA 2VFBA 2E01A 2FTDA 3BOWA 3PDFA 3CBKA 2DCDA 1NB5A 3BCNA 2HD5A 3IUTA 3OVZA 4P6GA 3LXSA 4YYWA 3F75A 2R9OA 4PI3A 1M6DA 3S3RA 1F29A 2AVWA 3DF0A 2YJBA 2YJ2A 2DZZA 1NB3A 2G6DA 1STFE 4ZUXU 3M99A 4KLBA 1MS6A 2XU3A 4N4ZA 5CVMA 5J94A 2P0RA 3QT4A 2DC6A 4BQVA 1KFXL 3IV2A 1YK8A 4BPVA 3BWKA 4P6EA 1Q6KA 1NL6A 2G8EA 2NQDB 4CDFB 5EF4A 3N4CA 1QOLA 4W5BA 4FIPA 3WXFA 4I04A 1YVBA 2FQ9A 1YK7A 1ZIVA 4PP1A 1QMYA 2AUXA 1PPNA 4G54A 4QRGA 4RY2A 2BDZA 1Y08A 1U9XA 2R9FA 2P86A 2ATOA 4BSQA 1U9WA 4BS6A 4I05A 1W4TA 3AI8A 2FYEA 4NV7A 3N3KA 2ARYA 2AS8A 1AYWA 1Y4HA 1GCBA 2DCBA 2JQGR 4FK5A 1F2AA 3TNXA 5CVOB 1GLOA 2Y5BA 3NHEA 5CHTA 2YJ9A 1BQIA 3GCBA 2HXZA 1DEUA 2IPPB 2JQFR 3IEJA 1MHWA 1QXPA 1IWDA 2PADA 1ME4A 4YYSA 1BY8A 1X9YA 4K7CA 1FH0A 4CDEB 1TLOA 1U9VA 1QDQA 3ERVA 1XKGA 3K24A 2DZYA 2C0YA 1AU0A 1EF7A 3USVA 2AYNA 4FJCA 2B1NA 5JH3A 1ATKA 1CS8A 5FPWA 1YT7A 2PBHA 1A6RA 1KFUL 2Y6EA 3E1ZB 1CB5A 3H7DA 1PE6A 2H7JA 2NQIA 3CBJA 2DCAA 4N8WA 1SNKA 3CH2X 4MZSA 3H8CA 2WBFX 2R9MA 3P5XA 4PP2E 3KFQA 1KHQA 1F2CA 4QBBA 3CH3X 5JA7A 3QSDA 3IHPA 2FT2A 6PADA 2NQGA 3RVVA 2FO5A 2AIMA 2PNSA 3ZUAA 3P5WA 2YJ8A 3LFYA 1GECE 1KHPA 2HH5A 4YV8A 2E03A 1PPDA 1AU2A 2GFOA 2PREA 2G8JA 3U8EA 3BPFA 2DJGB 3PBHA 1W5RA 3OF9A 2B1MA 2DC7A 3I3TA 1U9QX 3IOQA 1JQPA 4XUIA 3HWNA 2DJFB 2E00A 2VFCA 4Q8GA 1ZCMA 2O6XA 2DC8A 3OISA 1ITOA 3N3GA 4B55A 3KW9A 1EWMA 9PAPA 4DMYA 3KWBX 1U5IA 4NV8A 1E2TA 1VJVA 1CSBB 4YYUA 1CPJA 8PCHA 2R6NA 2OP3A 2IBIA 2HHNA 3P5UA 4MSXA 3KKUA 1W6FA 3P5VA 1BP4A 1VSNA 2AU1A 1AECA 3WXGA 3D6SA 1PCIA 4AXLA 2DC9A 2CB5A 1DF0A 1PADA 4YYVA 4YYRA 3RVXA 1NQCA 2BSZA 3F5VA 4BS5A 2VHFA 2GHUA 3PNRA 4QRVA 2F7DA 2AUZA 1F2BA 1CQDA 4Q8HA 1AIMA 2R9CA 3QJ3A 2VHSA 3HHIA 2FUDA 1PIPA 1BGOA 4AXMA 4GUZA 1PXVA 1K3BB 4OEMA 1EWLA 2XU5A 1GX3A 3BC3A 3KX1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H8B A;  1AYV A;  1CJL A;  1TU6 A;  4YYQ A;  3O1G A;  4HWY A;  1AU4 A;  2XU4 A;  3MOR A;  4X6J A;  1O0E A;  2YJC A;  4QH6 A;  1MEG A;  2OUL A;  1AYU A;  4I07 A;  5CHV A;  1S4V A;  3H89 A;  4CDD B;  3IMA A;  1MIR A;  2FRQ A;  1MDW A;  3B79 A;  4PAD A;  5A24 A;  1NPZ A;  1MEM A;  1PPO A;  1NLJ A;  3HD3 A;  1CTE A;  1YAL A;  3K9M A;  5CVN B;  4WA6 A;  4CDC B;  3O0U A;  4W4U A;  4X6H A;  1THE A;  3H6S A;  1PBH A;  2BDL A;  3RVW A;  1AU3 A;  2XU1 A;  3K8U A;  5EGW A;  1EWP A;  1CV8 A;  5F02 A;  1PPP A;  3PW3 A;  4QRX A;  2DCC A;  2CIO A;  2ACT A;  1KXR A;  4OEL A;  3WXE A;  3MHS A;  1GMY A;  2G7Y A;  4XR7 A;  3MTN A;  1ICF A;  4YVA A;  1SP4 B;  4N79 A;  5K16 A;  4X6I A;  3HHA A;  1CVZ A;  4W5C A;  3KWZ A;  2NQA A;  3MHH A;  4CZW A;  2R9N A;  3V6C A;  3V6E A;  5PAD A;  1ME3 A;  1EWO A;  4DMX A;  3C9E A;  3I06 A;  2FRA A;  2E02 A;  7PCK A;  1POP A;  2P7U A;  1TL9 A;  3BPM A;  2F1G A;  3KSE A;  4MZO A;  3OF8 A;  2OZ2 A;  3S3Q A;  1HUC B;  3OVX A;  2AYO A;  2E01 A;  2FTD A;  3BOW A;  3PDF A;  3CBK A;  2DCD A;  1NB5 A;  3BCN A;  2HD5 A;  3IUT A;  3OVZ A;  4P6G A;  3LXS A;  4YYW A;  3F75 A;  2R9O A;  4PI3 A;  1M6D A;  3S3R A;  1F29 A;  2AVW A;  3DF0 A;  2YJB A;  2YJ2 A;  2DZZ A;  1NB3 A;  2G6D A;  1STF E;  4ZUX U;  3M99 A;  4KLB A;  1MS6 A;  2XU3 A;  4N4Z A;  5CVM A;  5J94 A;  2P0R A;  3QT4 A;  2DC6 A;  4BQV A;  1KFX L;  3IV2 A;  1YK8 A;  4BPV A;  3BWK A;  4P6E A;  1Q6K A;  1NL6 A;  2G8E A;  2NQD B;  4CDF B;  5EF4 A;  3N4C A;  1QOL A;  4W5B A;  4FIP A;  3WXF A;  4I04 A;  1YVB A;  2FQ9 A;  1YK7 A;  1ZIV A;  4PP1 A;  1QMY A;  2AUX A;  1PPN A;  4G54 A;  4QRG A;  4RY2 A;  2BDZ A;  1Y08 A;  1U9X A;  2R9F A;  2P86 A;  2ATO A;  4BSQ A;  1U9W A;  4BS6 A;  4I05 A;  3AI8 A;  2FYE A;  3N3K A;  2ARY A;  2AS8 A;  1AYW A;  1Y4H A;  1GCB A;  2DCB A;  2JQG R;  4FK5 A;  1F2A A;  3TNX A;  5CVO B;  1GLO A;  2Y5B A;  3NHE A;  5CHT A;  2YJ9 A;  1BQI A;  3GCB A;  2HXZ A;  1DEU A;  2IPP B;  2JQF R;  3IEJ A;  1MHW A;  1QXP A;  1IWD A;  2PAD A;  1ME4 A;  4YYS A;  1BY8 A;  1X9Y A;  4K7C A;  1FH0 A;  4CDE B;  1TLO A;  1U9V A;  1QDQ A;  3ERV A;  1XKG A;  3K24 A;  2DZY A;  2C0Y A;  1AU0 A;  1EF7 A;  3USV A;  2AYN A;  4FJC A;  2B1N A;  5JH3 A;  1ATK A;  1CS8 A;  5FPW A;  1YT7 A;  2PBH A;  1A6R A;  1KFU L;  2Y6E A;  3E1Z B;  1CB5 A;  3H7D A;  1PE6 A;  2H7J A;  2NQI A;  3CBJ A;  2DCA A;  4N8W A;  1SNK A;  3CH2 X;  4MZS A;  3H8C A;  2WBF X;  2R9M A;  3P5X A;  4PP2 E;  3KFQ A;  1KHQ A;  1F2C A;  4QBB A;  3CH3 X;  5JA7 A;  3QSD A;  3IHP A;  2FT2 A;  6PAD A;  2NQG A;  3RVV A;  2FO5 A;  2AIM A;  2PNS A;  3ZUA A;  3P5W A;  2YJ8 A;  3LFY A;  1GEC E;  1KHP A;  2HH5 A;  4YV8 A;  2E03 A;  1PPD A;  1AU2 A;  2GFO A;  2PRE A;  2G8J A;  3U8E A;  3BPF A;  2DJG B;  3PBH A;  3OF9 A;  2B1M A;  2DC7 A;  3I3T A;  1U9Q X;  3IOQ A;  1JQP A;  4XUI A;  3HWN A;  2DJF B;  2E00 A;  4Q8G A;  1ZCM A;  2O6X A;  2DC8 A;  3OIS A;  1ITO A;  3N3G A;  3KW9 A;  1EWM A;  9PAP A;  4DMY A;  3KWB X;  1U5I A;  1VJV A;  1CSB B;  4YYU A;  1CPJ A;  8PCH A;  2R6N A;  2OP3 A;  2IBI A;  2HHN A;  3P5U A;  4MSX A;  3KKU A;  3P5V A;  1BP4 A;  1VSN A;  2AU1 A;  1AEC A;  3WXG A;  3D6S A;  1PCI A;  4AXL A;  2DC9 A;  2CB5 A;  1DF0 A;  1PAD A;  4YYV A;  4YYR A;  3RVX A;  1NQC A;  3F5V A;  4BS5 A;  2VHF A;  2GHU A;  3PNR A;  4QRV A;  2F7D A;  2AUZ A;  1F2B A;  1CQD A;  4Q8H A;  1AIM A;  2R9C A;  3QJ3 A;  2VHS A;  3HHI A;  2FUD A;  1PIP A;  1BGO A;  4AXM A;  1PXV A;  1K3B B;  4OEM A;  1EWL A;  2XU5 A;  3BC3 A;  3KX1 A; 
#chains in the Genus database with same CATH topology
 3H8B A;  1AYV A;  1CJL A;  3PSE A;  1TU6 A;  4YYQ A;  3O1G A;  3TMP A;  4HWY A;  1AU4 A;  2XU4 A;  3MOR A;  3C0R A;  4BOU A;  4X6J A;  1O0E A;  2YJC A;  4QH6 A;  1MEG A;  2OUL A;  5JZE A;  1AYU A;  4I07 A;  5CHV A;  1S4V A;  3H89 A;  4CDD B;  3IMA A;  1MIR A;  2FRQ A;  1MDW A;  3B79 A;  4PAD A;  5A24 A;  4OW0 A;  3PT2 A;  1NPZ A;  4BOP A;  2JRI A;  1MEM A;  1PPO A;  1NLJ A;  3HD3 A;  3MP2 A;  1CTE A;  1YAL A;  3K9M A;  5CVN B;  4WA6 A;  4CDC B;  3O0U A;  4W4U A;  4X6H A;  1THE A;  3H6S A;  1PBH A;  2BDL A;  3RVW A;  1AU3 A;  2XU1 A;  3K8U A;  3PHX A;  5EGW A;  1EWP A;  1CV8 A;  5F02 A;  1PPP A;  3PW3 A;  4QRX A;  2DCC A;  3RNV A;  4IP3 A;  2CIO A;  4PT5 A;  2ACT A;  1KXR A;  4RKX A;  4OEL A;  3WXE A;  3MHS A;  1GMY A;  2G7Y A;  4XR7 A;  3MTN A;  2BTW A;  1ICF A;  4YVA A;  1SP4 B;  4N79 A;  5K16 A;  4X6I A;  3HHA A;  3ZNH A;  1CVZ A;  4W5C A;  3KWZ A;  2NQA A;  3MHH A;  4CZW A;  2R9N A;  3V6C A;  3V6E A;  5PAD A;  1ME3 A;  1EWO A;  4DMX A;  3C9E A;  3I06 A;  2FRA A;  2E02 A;  7PCK A;  1POP A;  2P7U A;  1TL9 A;  3BPM A;  2AGA A;  3BBA A;  2F1G A;  3KSE A;  4MI7 A;  4MZO A;  5E6J A;  4OVZ B;  3OF8 A;  2OZ2 A;  3S3Q A;  1HUC B;  3OVX A;  2AYO A;  2E01 A;  2FTD A;  3BOW A;  3PDF A;  3CBK A;  2DCD A;  1NB5 A;  3BCN A;  2HD5 A;  3IUT A;  3OVZ A;  4P6G A;  3LXS A;  3W31 A;  4YYW A;  3F75 A;  2R9O A;  4PI3 A;  1M6D A;  3S3R A;  2HWK A;  1F29 A;  2AVW A;  3DF0 A;  2YJB A;  3PHW A;  2YJ2 A;  2DZZ A;  1NB3 A;  2G6D A;  1STF E;  4ZUX U;  3M99 A;  4KLB A;  1MS6 A;  3TRK A;  2XU3 A;  4N4Z A;  5CVM A;  5J94 A;  2P0R A;  3O65 A;  3QT4 A;  2DC6 A;  4IUM A;  4BQV A;  1KFX L;  3IV2 A;  4GUA A;  1YK8 A;  4BPV A;  3BWK A;  4P6E A;  1Q6K A;  1NL6 A;  2G8E A;  2NQD B;  4CDF B;  5EF4 A;  3N4C A;  1QOL A;  4W5B A;  4FIP A;  3WXF A;  4I04 A;  1YVB A;  2FQ9 A;  1YK7 A;  1ZIV A;  3W30 A;  4PP1 A;  3BY4 A;  1QMY A;  4RF1 A;  3PRP A;  2AUX A;  1PPN A;  4G54 A;  4QRG A;  4RY2 A;  2BDZ A;  1Y08 A;  1U9X A;  2R9F A;  2P86 A;  2ATO A;  2J7Q A;  4BSQ A;  1U9W A;  4BS6 A;  4I05 A;  4OVZ A;  3AI8 A;  2FYE A;  3N3K A;  4BOQ A;  2ARY A;  2FE8 A;  2AS8 A;  1AYW A;  1Y4H A;  1GCB A;  2DCB A;  2DOS A;  2JQG R;  4FK5 A;  1F2A A;  5KO3 A;  3TNX A;  5CVO B;  1GLO A;  4M0W A;  2Y5B A;  3NHE A;  5CHT A;  2YJ9 A;  4HXD B;  1BQI A;  3GCB A;  2HXZ A;  1DEU A;  2IPP B;  2JTC A;  2JQF R;  3IEJ A;  1MHW A;  1QXP A;  1IWD A;  2PAD A;  1ME4 A;  4YYS A;  1BY8 A;  1X9Y A;  4K7C A;  1FH0 A;  4WUR A;  4CDE B;  1TLO A;  1U9V A;  4R3D A;  1QDQ A;  3ERV A;  1XKG A;  3K24 A;  2DZY A;  2C0Y A;  1AU0 A;  3MTV A;  1EF7 A;  3USV A;  2AYN A;  4FJC A;  2B1N A;  4BOZ A;  4ZTB A;  5JH3 A;  1ATK A;  1CS8 A;  4P16 A;  5FPW A;  1YT7 A;  2PBH A;  1A6R A;  1KFU L;  2Y6E A;  3E9S A;  3E1Z B;  1CB5 A;  3H7D A;  1PE6 A;  3IFU A;  2H7J A;  1PVJ A;  2BU3 A;  2NQI A;  3CBJ A;  2DCA A;  4N8W A;  1SNK A;  3OQC A;  3CH2 X;  4MZS A;  1UKF A;  3H8C A;  2WBF X;  4RF0 A;  2R9M A;  3P5X A;  4PP2 E;  3KFQ A;  1KHQ A;  1F2C A;  4QBB A;  4RNA A;  3CH3 X;  5JA7 A;  3QSD A;  3IHP A;  2FT2 A;  3PRM A;  3B21 A;  6PAD A;  2NQG A;  3RVV A;  2FO5 A;  2AIM A;  5EZS A;  2PNS A;  3ZUA A;  3P5W A;  2YJ8 A;  3LFY A;  1GEC E;  1KHP A;  2HH5 A;  4YV8 A;  2E03 A;  1PPD A;  1AU2 A;  2GFO A;  2PRE A;  2G8J A;  4A5U A;  3U8E A;  3BPF A;  2DJG B;  3PBH A;  3OF9 A;  2B1M A;  2DC7 A;  3I3T A;  1U9Q X;  3BB7 A;  3IOQ A;  1JQP A;  4XUI A;  3HWN A;  2DJF B;  2E00 A;  3MJ5 A;  2Z84 A;  4Q8G A;  1ZCM A;  2O6X A;  2DC8 A;  3OIS A;  1ITO A;  3N3G A;  3KW9 A;  1EWM A;  9PAP A;  4DMY A;  3KWB X;  1U5I A;  1VJV A;  1CSB B;  4YYU A;  1CPJ A;  8PCH A;  2R6N A;  2OP3 A;  2UZJ A;  2IBI A;  2HHN A;  3PHU A;  4D8B A;  3P5U A;  4MSX A;  3KKU A;  3P5V A;  1BP4 A;  1VSN A;  2AU1 A;  1AEC A;  3WXG A;  3D6S A;  4D8I A;  1PCI A;  4AXL A;  2DC9 A;  4XZX A;  2CB5 A;  1DF0 A;  1PAD A;  4YYV A;  4YYR A;  3RVX A;  1NQC A;  3F5V A;  5EZQ A;  4BS5 A;  2VHF A;  2GHU A;  3PNR A;  4QRV A;  2F7D A;  2BTW B;  2AUZ A;  1F2B A;  1CQD A;  4Q8H A;  1DKI A;  1AIM A;  4MM3 B;  1YZB A;  2R9C A;  3QJ3 A;  2VHS A;  3HHI A;  2FUD A;  1PIP A;  4BOS A;  1BGO A;  4AXM A;  1PXV A;  1K3B B;  4OEM A;  1EWL A;  2XU5 A;  4D8E A;  3BC3 A;  4REZ A;  3KX1 A;  2J7Q C; 
#chains in the Genus database with same CATH homology
 3H8B A;  1AYV A;  1CJL A;  1TU6 A;  4YYQ A;  3O1G A;  4HWY A;  1AU4 A;  2XU4 A;  3MOR A;  4X6J A;  1O0E A;  2YJC A;  4QH6 A;  1MEG A;  2OUL A;  1AYU A;  4I07 A;  5CHV A;  1S4V A;  3H89 A;  4CDD B;  3IMA A;  1MIR A;  2FRQ A;  1MDW A;  3B79 A;  4PAD A;  5A24 A;  1NPZ A;  1MEM A;  1PPO A;  1NLJ A;  3HD3 A;  3LTW A;  1CTE A;  1YAL A;  3K9M A;  5CVN B;  4WA6 A;  4CDC B;  3O0U A;  4W4U A;  4X6H A;  1THE A;  3H6S A;  1PBH A;  2BDL A;  3RVW A;  1AU3 A;  2XU1 A;  3K8U A;  5EGW A;  1EWP A;  1CV8 A;  5F02 A;  1PPP A;  3PW3 A;  4QRX A;  2DCC A;  2CIO A;  2ACT A;  1KXR A;  4OEL A;  3WXE A;  3MHS A;  1GMY A;  2G7Y A;  4XR7 A;  3MTN A;  1ICF A;  4YVA A;  1SP4 B;  4N79 A;  5K16 A;  4BGF A;  4X6I A;  3HHA A;  3D9W A;  1CVZ A;  4W5C A;  3KWZ A;  2NQA A;  3MHH A;  4CZW A;  2R9N A;  3V6C A;  3V6E A;  5PAD A;  1ME3 A;  1EWO A;  4DMX A;  3C9E A;  3I06 A;  2FRA A;  2E02 A;  7PCK A;  1POP A;  2P7U A;  4C5P A;  1TL9 A;  3BPM A;  2F1G A;  3KSE A;  4MZO A;  3OF8 A;  2OZ2 A;  3S3Q A;  1HUC B;  3OVX A;  2AYO A;  2VFB A;  2E01 A;  2FTD A;  3BOW A;  3PDF A;  3CBK A;  2DCD A;  1NB5 A;  3BCN A;  2HD5 A;  3IUT A;  3OVZ A;  4P6G A;  3LXS A;  4YYW A;  3F75 A;  2R9O A;  4PI3 A;  1M6D A;  3S3R A;  1F29 A;  2AVW A;  3DF0 A;  2YJB A;  2YJ2 A;  2DZZ A;  1NB3 A;  2G6D A;  1STF E;  4ZUX U;  3M99 A;  4KLB A;  1MS6 A;  2XU3 A;  4N4Z A;  5CVM A;  5J94 A;  2P0R A;  3QT4 A;  2DC6 A;  4BQV A;  1KFX L;  3IV2 A;  1YK8 A;  4BPV A;  3BWK A;  4P6E A;  1Q6K A;  1NL6 A;  2G8E A;  2NQD B;  4CDF B;  5EF4 A;  3N4C A;  1QOL A;  4W5B A;  4FIP A;  3WXF A;  4I04 A;  1YVB A;  2FQ9 A;  1YK7 A;  1ZIV A;  4PP1 A;  1QMY A;  2AUX A;  1PPN A;  4G54 A;  4QRG A;  4RY2 A;  2BDZ A;  1Y08 A;  1U9X A;  2R9F A;  2P86 A;  2ATO A;  4BSQ A;  1U9W A;  4BS6 A;  4I05 A;  1W4T A;  3AI8 A;  2FYE A;  4NV7 A;  3N3K A;  2ARY A;  2AS8 A;  1AYW A;  1Y4H A;  1GCB A;  2DCB A;  2JQG R;  4FK5 A;  1F2A A;  3TNX A;  5CVO B;  1GLO A;  2Y5B A;  3NHE A;  5CHT A;  2YJ9 A;  1BQI A;  3GCB A;  2HXZ A;  1DEU A;  2IPP B;  2JQF R;  3IEJ A;  1MHW A;  1QXP A;  1IWD A;  2PAD A;  1ME4 A;  4YYS A;  1BY8 A;  1X9Y A;  4K7C A;  1FH0 A;  4CDE B;  1TLO A;  1U9V A;  1QDQ A;  3ERV A;  1XKG A;  3K24 A;  2DZY A;  2C0Y A;  1AU0 A;  1EF7 A;  3USV A;  2AYN A;  4FJC A;  2B1N A;  5JH3 A;  1ATK A;  1CS8 A;  5FPW A;  1YT7 A;  2PBH A;  1A6R A;  1KFU L;  2Y6E A;  3E1Z B;  1CB5 A;  3H7D A;  1PE6 A;  2H7J A;  2NQI A;  3CBJ A;  2DCA A;  4N8W A;  1SNK A;  3CH2 X;  4MZS A;  3H8C A;  2WBF X;  2R9M A;  3P5X A;  4PP2 E;  3KFQ A;  1KHQ A;  1F2C A;  4QBB A;  3CH3 X;  5JA7 A;  3QSD A;  3IHP A;  2FT2 A;  6PAD A;  2NQG A;  3RVV A;  2FO5 A;  2AIM A;  2PNS A;  3ZUA A;  3P5W A;  2YJ8 A;  3LFY A;  1GEC E;  1KHP A;  2HH5 A;  4YV8 A;  2E03 A;  1PPD A;  1AU2 A;  2GFO A;  2PRE A;  2G8J A;  3U8E A;  3BPF A;  2DJG B;  3PBH A;  1W5R A;  3OF9 A;  2B1M A;  2DC7 A;  3I3T A;  1U9Q X;  3IOQ A;  1JQP A;  4XUI A;  3HWN A;  2DJF B;  2E00 A;  2VFC A;  4Q8G A;  1ZCM A;  2O6X A;  2DC8 A;  3OIS A;  1ITO A;  3N3G A;  4B55 A;  3KW9 A;  1EWM A;  9PAP A;  4DMY A;  3KWB X;  1U5I A;  4NV8 A;  1E2T A;  1VJV A;  1CSB B;  4YYU A;  1CPJ A;  8PCH A;  2R6N A;  2OP3 A;  2IBI A;  2HHN A;  3P5U A;  4MSX A;  3KKU A;  1W6F A;  3P5V A;  1BP4 A;  1VSN A;  2AU1 A;  1AEC A;  3WXG A;  3D6S A;  1PCI A;  4AXL A;  2DC9 A;  2CB5 A;  1DF0 A;  1PAD A;  4YYV A;  4YYR A;  3RVX A;  1NQC A;  2BSZ A;  3F5V A;  4BS5 A;  2VHF A;  2GHU A;  3PNR A;  4QRV A;  2F7D A;  2AUZ A;  1F2B A;  1CQD A;  4Q8H A;  1AIM A;  2R9C A;  3QJ3 A;  2VHS A;  3HHI A;  2FUD A;  1PIP A;  1BGO A;  4AXM A;  4GUZ A;  1PXV A;  1K3B B;  4OEM A;  1EWL A;  2XU5 A;  1GX3 A;  3BC3 A;  3KX1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...