2PNSA

1.9 angstrom resolution crystal structure of a plant cysteine protease ervatamin-c refinement with cdna derived amino acid sequence
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
208
structure length
208
Chain Sequence
LPEQIDWRKKGAVTPVKNQGKCGSCWAFSTVSTVESINQIRTGNLISLSEQQLVDCNKKNHGCKGGAFVYAYQYIIDNGGIDTEANYPYKAVQGPCRAAKKVVRIDGYKGVPHCNENALKKAVASQPSVVAIDASSKQFQHYKSGIFSGPCGTKLNHGVVIVGYWKDYWIVRNSWGRYWGEQGYIRMKRVGGCGLCGIARLPYYPTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ervatamin-C, a papain-like plant cysteine protease
publication title A thermostable cysteine protease precursor from a tropical plant contains an unusual C-terminal propeptide: cDNA cloning, sequence comparison and molecular modeling studies.
pubmed doi rcsb
total genus 64
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2pnsA00
1ZCMA 3RVXA 3WXFA 1CPJA 1POPA 3KFQA 1ZIVA 1GLOA 3DF0A 1YALA 1A6RA 1DEUA 3H89A 4I04A 3IHPA 7PCKA 1CTEA 3OF9A 1AU3A 3BOWA 3CBJA 4K7CA 4W5CA 2E02A 3NHEA 2P7UA 2F7DA 2F1GA 2B1MA 2AS8A 4W4UA 3QJ3A 4PP1A 3M99A 2PBHA 2E03A 4BS5A 3LFYA 3ZUAA 1PE6A 3N3GA 2HXZA 2DC7A 3CBKA 1SNKA 9PAPA 2FT2A 8PCHA 1AECA 1GCBA 4BPVA 3KKUA 1TU6A 1BQIA 4FIPA 1PCIA 4G54A 5FPWA 5J94A 2YJCA 3HHIA 1VSNA 1ME3A 5PADA 2FUDA 4QBBA 2WBFX 4YV8A 1NB5A 2OULA 2P86A 3BC3A 2YJ2A 2FRAA 3P5XA 1CV8A 1ITOA 1M6DA 3BCNA 3H6SA 1NB3A 1IWDA 2ACTA 5CHTA 3I06A 1PPOA 2PADA 4X6HA 3BPMA 3HWNA 3OISA 5F02A 1PADA 1PPPA 4YYVA 1Y4HA 1U9VA 3E1ZB 4CDFB 2DC8A 2AUXA 1F2CA 4Q8GA 2G8JA 2R9OA 1QOLA 2YJBA 4XR7A 1KXRA 2CIOA 1PBHA 1CJLA 3D6SA 4YYRA 4KLBA 1Q6KA 1GMYA 2NQGA 1U9QX 1NLJA 2DCCA 1MDWA 4YVAA 3TNXA 3PNRA 1PXVA 3CH3X 2JQGR 4P6EA 4QH6A 3OF8A 2R9FA 2NQDB 3V6CA 4BQVA 4MZSA 1KFXL 2H7JA 2DJGB 1AIMA 3N3KA 2GHUA 5EGWA 2NQAA 1DF0A 2HH5A 1QDQA 5JH3A 3P5UA 1CVZA 2R9MA 1EF7A 1YK8A 3K24A 4DMXA 1Y08A 3K9MA 2Y5BA 2HD5A 2PREA 1YK7A 2FO5A 3IOQA 3H7DA 5A24A 2B1NA 1TL9A 4CZWA 1BGOA 3V6EA 1CB5A 2YJ8A 3F5VA 2OP3A 3IUTA 2AYOA 1PPNA 4YYSA 2IBIA 4I07A 1U5IA 3RVVA 3P5VA 1QXPA 4ZUXU 4MZOA 2AVWA 4HWYA 1CS8A 1F29A 3AI8A 2HHNA 1PPDA 4QRVA 1THEA 1AU4A 4RY2A 4PP2E 2DC6A 1NQCA 4OELA 5CHVA 5K16A 1AU2A 1AYVA 1BY8A 1AU0A 2DCAA 4CDEB 1KFUL 3ERVA 1AYWA 3KWBX 2XU5A 1MEMA 3BWKA 1U9WA 1MEGA 3N4CA 4QRGA 3C9EA 2ATOA 2DCDA 3LXSA 3MHHA 1EWMA 3PDFA 4FK5A 2IPPB 1YT7A 3IV2A 1ATKA 1NPZA 4MSXA 2Y6EA 3BPFA 1EWLA 4X6IA 4N4ZA 5JA7A 3KSEA 4OEMA 2ARYA 1ICFA 1EWOA 1X9YA 3PBHA 3KWZA 1MHWA 2YJ9A 3IMAA 2GFOA 2NQIA 4CDCB 1O0EA 1EWPA 4N79A 4DMYA 5CVNB 2JQFR 2XU4A 2G8EA 3HD3A 6PADA 3IEJA 1QMYA 2PNSA 2VHSA 4YYWA 1NL6A 3MTNA 3F75A 1TLOA 4FJCA 1YVBA 4YYUA 2FTDA 3HHAA 2BDZA 4WA6A 1F2BA 1MS6A 3H8BA 1GECE 2R9NA 1JQPA 4P6GA 1HUCB 1SP4B 1MIRA 3QT4A 2XU1A 4I05A 4YYQA 1VJVA 3GCBA 2AIMA 2O6XA 2DJFB 2DZYA 4BSQA 3KX1A 1FH0A 1ME4A 2CB5A 3MORA 2AYNA 3S3RA 3WXGA 2BDLA 4Q8HA 3U8EA 1F2AA 3O1GA 3PW3A 2VHFA 2FYEA 1PIPA 2R6NA 2DC9A 1BP4A 5EF4A 3USVA 2G7YA 3QSDA 4X6JA 1CSBB 2FQ9A 4N8WA 5CVMA 1U9XA 2AUZA 1CQDA 1STFE 4XUIA 1XKGA 3RVWA 2XU3A 2DCBA 3S3QA 3H8CA 4QRXA 2R9CA 4BS6A 3WXEA 4AXMA 1KHQA 1AYUA 2OZ2A 5CVOB 3O0UA 1KHPA 1K3BB 2G6DA 4PADA 2P0RA 2AU1A 2E01A 3OVZA 4W5BA 3MHSA 3P5WA 3CH2X 2FRQA 2C0YA 3OVXA 4AXLA 3K8UA 3KW9A 3B79A 3I3TA 2DZZA 4PI3A 2E00A 4CDDB 1S4VA
chains in the Genus database with same CATH superfamily
1ZCMA 3RVXA 3WXFA 2AGAA 1CPJA 1POPA 3KFQA 1ZIVA 1GLOA 3DF0A 2HWKA 1YALA 2JTCA 1A6RA 1DEUA 3H89A 4I04A 3IHPA 7PCKA 1CTEA 3OF9A 1AU3A 3BOWA 3CBJA 4K7CA 4W5CA 2E02A 3NHEA 4BOQA 4R3DA 4RKXA 2P7UA 2F7DA 2F1GA 2B1MA 2AS8A 4W4UA 3QJ3A 4PP1A 3M99A 2PBHA 2E03A 3BY4A 4BS5A 3LFYA 3ZUAA 1PE6A 3N3GA 2HXZA 2DC7A 2BU3A 2JRIA 3CBKA 1SNKA 9PAPA 3O65A 2FT2A 8PCHA 1YZBA 3TRKA 1AECA 1GCBA 4M0WA 4BPVA 3KKUA 1TU6A 1BQIA 4FIPA 1PCIA 4G54A 4GUAA 3PT2A 3OQCA 5FPWA 3PSEA 5JZEA 5J94A 2YJCA 3HHIA 1VSNA 1ME3A 4A5UA 3RNVA 5PADA 2FUDA 4QBBA 2WBFX 4YV8A 1NB5A 2OULA 2P86A 3BC3A 2YJ2A 2FRAA 3P5XA 1CV8A 1ITOA 1M6DA 3BCNA 3H6SA 1NB3A 1IWDA 3W30A 2ACTA 5CHTA 3I06A 1PPOA 2PADA 4X6HA 3BPMA 3HWNA 3OISA 5F02A 1PADA 1PPPA 4YYVA 1Y4HA 1U9VA 3E1ZB 4OVZA 4CDFB 2DC8A 2AUXA 1F2CA 4Q8GA 2G8JA 2R9OA 1QOLA 2YJBA 4XR7A 1KXRA 2CIOA 1PBHA 1CJLA 3D6SA 4YYRA 4KLBA 1Q6KA 1GMYA 2NQGA 2Z84A 1U9QX 1NLJA 2DCCA 1MDWA 4YVAA 3TNXA 4HXDB 3PNRA 1PXVA 3CH3X 2JQGR 4P6EA 4QH6A 3OF8A 2R9FA 2NQDB 3V6CA 4BQVA 2J7QA 4MZSA 1KFXL 3B21A 4WURA 2H7JA 2DJGB 1AIMA 3N3KA 4D8EA 2GHUA 5EGWA 2NQAA 4BOPA 1DF0A 2HH5A 1QDQA 5JH3A 3P5UA 1CVZA 2R9MA 1EF7A 1YK8A 3K24A 4DMXA 1Y08A 3K9MA 2Y5BA 2HD5A 2PREA 1YK7A 2FO5A 3IOQA 3H7DA 5A24A 3MTVA 2B1NA 1TL9A 4CZWA 1BGOA 3V6EA 1CB5A 2YJ8A 3F5VA 2OP3A 3IUTA 2AYOA 1PPNA 4YYSA 2IBIA 3C0RA 1U5IA 4I07A 4MI7A 3RVVA 3P5VA 1QXPA 4RNAA 4ZUXU 4MZOA 4REZA 2AVWA 4HWYA 3BBAA 1CS8A 1F29A 3AI8A 2HHNA 5EZSA 1PPDA 4QRVA 2BTWB 1THEA 1AU4A 4XZXA 4RY2A 4PP2E 2DC6A 1NQCA 4OELA 5CHVA 5K16A 1AU2A 4MM3B 1AYVA 1BY8A 1AU0A 2DCAA 3ZNHA 4CDEB 1KFUL 2DOSA 3ERVA 1AYWA 3KWBX 2XU5A 4P16A 1MEMA 3BWKA 1U9WA 1MEGA 3N4CA 4QRGA 4RF1A 3PHUA 3C9EA 4BOZA 2ATOA 5EZQA 2DCDA 3LXSA 3MHHA 1EWMA 2J7QC 3PDFA 4FK5A 2IPPB 3MJ5A 1YT7A 3IV2A 1ATKA 3PHXA 3W31A 1NPZA 4MSXA 2Y6EA 3BPFA 1EWLA 4X6IA 4N4ZA 5JA7A 3KSEA 4OEMA 2ARYA 1ICFA 1EWOA 1X9YA 3PBHA 3KWZA 1MHWA 4ZTBA 2YJ9A 3IMAA 5KO3A 2GFOA 2NQIA 4CDCB 1O0EA 1EWPA 4N79A 4DMYA 4BOUA 5CVNB 2JQFR 2XU4A 3IFUA 2G8EA 3HD3A 6PADA 3IEJA 1QMYA 2PNSA 2VHSA 4YYWA 1NL6A 3MTNA 3F75A 1TLOA 4FJCA 1YVBA 1PVJA 4YYUA 2FTDA 3HHAA 2BDZA 4WA6A 1F2BA 1MS6A 3H8BA 1GECE 2R9NA 1JQPA 4P6GA 3PRMA 1HUCB 1SP4B 1MIRA 3QT4A 2XU1A 4I05A 4YYQA 1VJVA 3GCBA 3PHWA 2AIMA 3MP2A 2O6XA 2DJFB 2DZYA 4OW0A 4BSQA 3KX1A 1FH0A 1ME4A 2CB5A 3MORA 1UKFA 3E9SA 2AYNA 3S3RA 3WXGA 2BDLA 4Q8HA 3U8EA 1F2AA 3O1GA 3PW3A 4RF0A 3PRPA 2VHFA 2FYEA 1PIPA 2R6NA 5E6JA 2DC9A 1BP4A 5EF4A 3USVA 2G7YA 3QSDA 4X6JA 1CSBB 2FQ9A 3TMPA 4N8WA 5CVMA 4OVZB 1U9XA 2AUZA 2UZJA 1CQDA 1STFE 4XUIA 1XKGA 3RVWA 2XU3A 2DCBA 3S3QA 3H8CA 4QRXA 2R9CA 4BS6A 4D8BA 3WXEA 4AXMA 4BOSA 1KHQA 1AYUA 2FE8A 2OZ2A 5CVOB 4IUMA 3O0UA 1KHPA 1K3BB 2G6DA 2BTWA 4PADA 2P0RA 4PT5A 2AU1A 4IP3A 2E01A 3OVZA 4W5BA 3MHSA 3P5WA 3BB7A 3CH2X 2FRQA 2C0YA 3OVXA 4AXLA 1DKIA 3K8UA 4D8IA 3KW9A 3B79A 3I3TA 2DZZA 4PI3A 2E00A 4CDDB 1S4VA
chains in the Genus database with same CATH topology
1ZCMA 3RVXA 3WXFA 4B55A 1CPJA 1POPA 3KFQA 1ZIVA 1GLOA 3DF0A 1YALA 1A6RA 1DEUA 3H89A 4I04A 3IHPA 7PCKA 1CTEA 3OF9A 1AU3A 3BOWA 3CBJA 4K7CA 4W5CA 2E02A 3NHEA 2P7UA 2F7DA 2VFBA 2F1GA 2B1MA 2AS8A 4W4UA 3QJ3A 4PP1A 3M99A 2PBHA 2E03A 4BS5A 3LFYA 3ZUAA 1PE6A 3N3GA 2HXZA 2DC7A 3CBKA 1SNKA 9PAPA 2FT2A 8PCHA 1AECA 1GCBA 4BPVA 3KKUA 1TU6A 1BQIA 4FIPA 1PCIA 4G54A 5FPWA 5J94A 2YJCA 3HHIA 1VSNA 1ME3A 5PADA 2FUDA 4QBBA 2WBFX 4YV8A 1NB5A 2OULA 2P86A 3BC3A 2YJ2A 4NV7A 4BGFA 2FRAA 3P5XA 1CV8A 1ITOA 1M6DA 3H6SA 2BSZA 3BCNA 1NB3A 1IWDA 2ACTA 5CHTA 4NV8A 3I06A 1PPOA 2PADA 4X6HA 3BPMA 3HWNA 3OISA 5F02A 1PADA 1PPPA 4YYVA 1Y4HA 1U9VA 1E2TA 3E1ZB 4CDFB 2DC8A 2AUXA 1F2CA 4Q8GA 2G8JA 2R9OA 1QOLA 2YJBA 4XR7A 1KXRA 2CIOA 1PBHA 1CJLA 3D6SA 4YYRA 4KLBA 1Q6KA 1GMYA 2NQGA 1U9QX 1NLJA 2DCCA 1MDWA 4YVAA 3TNXA 3PNRA 1PXVA 3CH3X 2JQGR 4P6EA 4QH6A 3OF8A 2R9FA 2NQDB 3V6CA 4BQVA 4MZSA 1KFXL 2H7JA 2DJGB 1AIMA 3N3KA 2GHUA 5EGWA 2NQAA 1DF0A 2HH5A 1QDQA 5JH3A 3P5UA 1CVZA 2R9MA 1EF7A 1YK8A 3K24A 4DMXA 1Y08A 3K9MA 2Y5BA 2HD5A 2PREA 1YK7A 2FO5A 3IOQA 3H7DA 5A24A 2B1NA 1TL9A 4CZWA 1BGOA 3V6EA 1CB5A 1GX3A 2YJ8A 3F5VA 2OP3A 3IUTA 2AYOA 1PPNA 4YYSA 2IBIA 4I07A 1U5IA 3RVVA 3P5VA 1QXPA 4ZUXU 4MZOA 2AVWA 4HWYA 1CS8A 1F29A 3AI8A 2HHNA 1PPDA 4QRVA 1THEA 3D9WA 1AU4A 4RY2A 4PP2E 2DC6A 1NQCA 4OELA 5CHVA 5K16A 1AU2A 1AYVA 1BY8A 1AU0A 2DCAA 4CDEB 1KFUL 3ERVA 1AYWA 3KWBX 2XU5A 1MEMA 3BWKA 1U9WA 1MEGA 3N4CA 4QRGA 3C9EA 2ATOA 2DCDA 3LXSA 1W4TA 3MHHA 1EWMA 3PDFA 4FK5A 2IPPB 1YT7A 3IV2A 1ATKA 1NPZA 4MSXA 2Y6EA 3BPFA 1EWLA 4X6IA 4N4ZA 5JA7A 3KSEA 4OEMA 2ARYA 1ICFA 1EWOA 1X9YA 3PBHA 3KWZA 1MHWA 2YJ9A 3IMAA 2GFOA 2NQIA 4CDCB 1O0EA 1EWPA 3LTWA 4N79A 4DMYA 5CVNB 2JQFR 2XU4A 4GUZA 2G8EA 3HD3A 6PADA 3IEJA 1QMYA 2PNSA 2VHSA 4YYWA 1NL6A 3MTNA 3F75A 1TLOA 4FJCA 1YVBA 4YYUA 2FTDA 3HHAA 2BDZA 4WA6A 1F2BA 1MS6A 3H8BA 1GECE 2R9NA 1JQPA 4P6GA 2VFCA 1HUCB 1SP4B 1MIRA 3QT4A 2XU1A 4I05A 4YYQA 1VJVA 3GCBA 2AIMA 2O6XA 1W5RA 2DJFB 2DZYA 4BSQA 3KX1A 1FH0A 1ME4A 2CB5A 3MORA 2AYNA 3S3RA 3WXGA 2BDLA 4Q8HA 3U8EA 1F2AA 3O1GA 3PW3A 2VHFA 2FYEA 1PIPA 2R6NA 2DC9A 1BP4A 5EF4A 1W6FA 3USVA 2G7YA 3QSDA 4X6JA 1CSBB 2FQ9A 4N8WA 5CVMA 1U9XA 2AUZA 1CQDA 1STFE 4XUIA 1XKGA 3RVWA 2XU3A 2DCBA 3S3QA 3H8CA 4QRXA 2R9CA 4BS6A 3WXEA 4AXMA 4C5PA 1KHQA 1AYUA 2OZ2A 5CVOB 3O0UA 1KHPA 1K3BB 2G6DA 4PADA 2P0RA 2AU1A 2E01A 3OVZA 4W5BA 3MHSA 3P5WA 3CH2X 2FRQA 2C0YA 3OVXA 4AXLA 3K8UA 3KW9A 3B79A 3I3TA 2DZZA 4PI3A 2E00A 4CDDB 1S4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZCM A;  3RVX A;  3WXF A;  1CPJ A;  1POP A;  3KFQ A;  1ZIV A;  1GLO A;  3DF0 A;  1YAL A;  1A6R A;  1DEU A;  3H89 A;  4I04 A;  3IHP A;  7PCK A;  1CTE A;  3OF9 A;  1AU3 A;  3BOW A;  3CBJ A;  4K7C A;  4W5C A;  2E02 A;  3NHE A;  2P7U A;  2F7D A;  2F1G A;  2B1M A;  2AS8 A;  4W4U A;  3QJ3 A;  4PP1 A;  3M99 A;  2PBH A;  2E03 A;  4BS5 A;  3LFY A;  3ZUA A;  1PE6 A;  3N3G A;  2HXZ A;  2DC7 A;  3CBK A;  1SNK A;  9PAP A;  2FT2 A;  8PCH A;  1AEC A;  1GCB A;  4BPV A;  3KKU A;  1TU6 A;  1BQI A;  4FIP A;  1PCI A;  4G54 A;  5FPW A;  5J94 A;  2YJC A;  3HHI A;  1VSN A;  1ME3 A;  5PAD A;  2FUD A;  4QBB A;  2WBF X;  4YV8 A;  1NB5 A;  2OUL A;  2P86 A;  3BC3 A;  2YJ2 A;  2FRA A;  3P5X A;  1CV8 A;  1ITO A;  1M6D A;  3BCN A;  3H6S A;  1NB3 A;  1IWD A;  2ACT A;  5CHT A;  3I06 A;  1PPO A;  2PAD A;  4X6H A;  3BPM A;  3HWN A;  3OIS A;  5F02 A;  1PAD A;  1PPP A;  4YYV A;  1Y4H A;  1U9V A;  3E1Z B;  4CDF B;  2DC8 A;  2AUX A;  1F2C A;  4Q8G A;  2G8J A;  2R9O A;  1QOL A;  2YJB A;  4XR7 A;  1KXR A;  2CIO A;  1PBH A;  1CJL A;  3D6S A;  4YYR A;  4KLB A;  1Q6K A;  1GMY A;  2NQG A;  1U9Q X;  1NLJ A;  2DCC A;  1MDW A;  4YVA A;  3TNX A;  3PNR A;  1PXV A;  3CH3 X;  2JQG R;  4P6E A;  4QH6 A;  3OF8 A;  2R9F A;  2NQD B;  3V6C A;  4BQV A;  4MZS A;  1KFX L;  2H7J A;  2DJG B;  1AIM A;  3N3K A;  2GHU A;  5EGW A;  2NQA A;  1DF0 A;  2HH5 A;  1QDQ A;  5JH3 A;  3P5U A;  1CVZ A;  2R9M A;  1EF7 A;  1YK8 A;  3K24 A;  4DMX A;  1Y08 A;  3K9M A;  2Y5B A;  2HD5 A;  2PRE A;  1YK7 A;  2FO5 A;  3IOQ A;  3H7D A;  5A24 A;  2B1N A;  1TL9 A;  4CZW A;  1BGO A;  3V6E A;  1CB5 A;  2YJ8 A;  3F5V A;  2OP3 A;  3IUT A;  2AYO A;  1PPN A;  4YYS A;  2IBI A;  4I07 A;  1U5I A;  3RVV A;  3P5V A;  1QXP A;  4ZUX U;  4MZO A;  2AVW A;  4HWY A;  1CS8 A;  1F29 A;  3AI8 A;  2HHN A;  1PPD A;  4QRV A;  1THE A;  1AU4 A;  4RY2 A;  4PP2 E;  2DC6 A;  1NQC A;  4OEL A;  5CHV A;  5K16 A;  1AU2 A;  1AYV A;  1BY8 A;  1AU0 A;  2DCA A;  4CDE B;  1KFU L;  3ERV A;  1AYW A;  3KWB X;  2XU5 A;  1MEM A;  3BWK A;  1U9W A;  1MEG A;  3N4C A;  4QRG A;  3C9E A;  2ATO A;  2DCD A;  3LXS A;  3MHH A;  1EWM A;  3PDF A;  4FK5 A;  2IPP B;  1YT7 A;  3IV2 A;  1ATK A;  1NPZ A;  4MSX A;  2Y6E A;  3BPF A;  1EWL A;  4X6I A;  4N4Z A;  5JA7 A;  3KSE A;  4OEM A;  2ARY A;  1ICF A;  1EWO A;  1X9Y A;  3PBH A;  3KWZ A;  1MHW A;  2YJ9 A;  3IMA A;  2GFO A;  2NQI A;  4CDC B;  1O0E A;  1EWP A;  4N79 A;  4DMY A;  5CVN B;  2JQF R;  2XU4 A;  2G8E A;  3HD3 A;  6PAD A;  3IEJ A;  1QMY A;  2PNS A;  2VHS A;  4YYW A;  1NL6 A;  3MTN A;  3F75 A;  1TLO A;  4FJC A;  1YVB A;  4YYU A;  2FTD A;  3HHA A;  2BDZ A;  4WA6 A;  1F2B A;  1MS6 A;  3H8B A;  1GEC E;  2R9N A;  1JQP A;  4P6G A;  1HUC B;  1SP4 B;  1MIR A;  3QT4 A;  2XU1 A;  4I05 A;  4YYQ A;  1VJV A;  3GCB A;  2AIM A;  2O6X A;  2DJF B;  2DZY A;  4BSQ A;  3KX1 A;  1FH0 A;  1ME4 A;  2CB5 A;  3MOR A;  2AYN A;  3S3R A;  3WXG A;  2BDL A;  4Q8H A;  3U8E A;  1F2A A;  3O1G A;  3PW3 A;  2VHF A;  2FYE A;  1PIP A;  2R6N A;  2DC9 A;  1BP4 A;  5EF4 A;  3USV A;  2G7Y A;  3QSD A;  4X6J A;  1CSB B;  2FQ9 A;  4N8W A;  5CVM A;  1U9X A;  2AUZ A;  1CQD A;  1STF E;  4XUI A;  1XKG A;  3RVW A;  2XU3 A;  2DCB A;  3S3Q A;  3H8C A;  4QRX A;  2R9C A;  4BS6 A;  3WXE A;  4AXM A;  1KHQ A;  1AYU A;  2OZ2 A;  5CVO B;  3O0U A;  1KHP A;  1K3B B;  2G6D A;  4PAD A;  2P0R A;  2AU1 A;  2E01 A;  3OVZ A;  4W5B A;  3MHS A;  3P5W A;  3CH2 X;  2FRQ A;  2C0Y A;  3OVX A;  4AXL A;  3K8U A;  3KW9 A;  3B79 A;  3I3T A;  2DZZ A;  4PI3 A;  2E00 A;  4CDD B;  1S4V A; 
#chains in the Genus database with same CATH topology
 1ZCM A;  3RVX A;  3WXF A;  2AGA A;  1CPJ A;  1POP A;  3KFQ A;  1ZIV A;  1GLO A;  3DF0 A;  2HWK A;  1YAL A;  2JTC A;  1A6R A;  1DEU A;  3H89 A;  4I04 A;  3IHP A;  7PCK A;  1CTE A;  3OF9 A;  1AU3 A;  3BOW A;  3CBJ A;  4K7C A;  4W5C A;  2E02 A;  3NHE A;  4BOQ A;  4R3D A;  4RKX A;  2P7U A;  2F7D A;  2F1G A;  2B1M A;  2AS8 A;  4W4U A;  3QJ3 A;  4PP1 A;  3M99 A;  2PBH A;  2E03 A;  3BY4 A;  4BS5 A;  3LFY A;  3ZUA A;  1PE6 A;  3N3G A;  2HXZ A;  2DC7 A;  2BU3 A;  2JRI A;  3CBK A;  1SNK A;  9PAP A;  3O65 A;  2FT2 A;  8PCH A;  1YZB A;  3TRK A;  1AEC A;  1GCB A;  4M0W A;  4BPV A;  3KKU A;  1TU6 A;  1BQI A;  4FIP A;  1PCI A;  4G54 A;  4GUA A;  3PT2 A;  3OQC A;  5FPW A;  3PSE A;  5JZE A;  5J94 A;  2YJC A;  3HHI A;  1VSN A;  1ME3 A;  4A5U A;  3RNV A;  5PAD A;  2FUD A;  4QBB A;  2WBF X;  4YV8 A;  1NB5 A;  2OUL A;  2P86 A;  3BC3 A;  2YJ2 A;  2FRA A;  3P5X A;  1CV8 A;  1ITO A;  1M6D A;  3BCN A;  3H6S A;  1NB3 A;  1IWD A;  3W30 A;  2ACT A;  5CHT A;  3I06 A;  1PPO A;  2PAD A;  4X6H A;  3BPM A;  3HWN A;  3OIS A;  5F02 A;  1PAD A;  1PPP A;  4YYV A;  1Y4H A;  1U9V A;  3E1Z B;  4OVZ A;  4CDF B;  2DC8 A;  2AUX A;  1F2C A;  4Q8G A;  2G8J A;  2R9O A;  1QOL A;  2YJB A;  4XR7 A;  1KXR A;  2CIO A;  1PBH A;  1CJL A;  3D6S A;  4YYR A;  4KLB A;  1Q6K A;  1GMY A;  2NQG A;  2Z84 A;  1U9Q X;  1NLJ A;  2DCC A;  1MDW A;  4YVA A;  3TNX A;  4HXD B;  3PNR A;  1PXV A;  3CH3 X;  2JQG R;  4P6E A;  4QH6 A;  3OF8 A;  2R9F A;  2NQD B;  3V6C A;  4BQV A;  2J7Q A;  4MZS A;  1KFX L;  3B21 A;  4WUR A;  2H7J A;  2DJG B;  1AIM A;  3N3K A;  4D8E A;  2GHU A;  5EGW A;  2NQA A;  4BOP A;  1DF0 A;  2HH5 A;  1QDQ A;  5JH3 A;  3P5U A;  1CVZ A;  2R9M A;  1EF7 A;  1YK8 A;  3K24 A;  4DMX A;  1Y08 A;  3K9M A;  2Y5B A;  2HD5 A;  2PRE A;  1YK7 A;  2FO5 A;  3IOQ A;  3H7D A;  5A24 A;  3MTV A;  2B1N A;  1TL9 A;  4CZW A;  1BGO A;  3V6E A;  1CB5 A;  2YJ8 A;  3F5V A;  2OP3 A;  3IUT A;  2AYO A;  1PPN A;  4YYS A;  2IBI A;  3C0R A;  1U5I A;  4I07 A;  4MI7 A;  3RVV A;  3P5V A;  1QXP A;  4RNA A;  4ZUX U;  4MZO A;  4REZ A;  2AVW A;  4HWY A;  3BBA A;  1CS8 A;  1F29 A;  3AI8 A;  2HHN A;  5EZS A;  1PPD A;  4QRV A;  2BTW B;  1THE A;  1AU4 A;  4XZX A;  4RY2 A;  4PP2 E;  2DC6 A;  1NQC A;  4OEL A;  5CHV A;  5K16 A;  1AU2 A;  4MM3 B;  1AYV A;  1BY8 A;  1AU0 A;  2DCA A;  3ZNH A;  4CDE B;  1KFU L;  2DOS A;  3ERV A;  1AYW A;  3KWB X;  2XU5 A;  4P16 A;  1MEM A;  3BWK A;  1U9W A;  1MEG A;  3N4C A;  4QRG A;  4RF1 A;  3PHU A;  3C9E A;  4BOZ A;  2ATO A;  5EZQ A;  2DCD A;  3LXS A;  3MHH A;  1EWM A;  2J7Q C;  3PDF A;  4FK5 A;  2IPP B;  3MJ5 A;  1YT7 A;  3IV2 A;  1ATK A;  3PHX A;  3W31 A;  1NPZ A;  4MSX A;  2Y6E A;  3BPF A;  1EWL A;  4X6I A;  4N4Z A;  5JA7 A;  3KSE A;  4OEM A;  2ARY A;  1ICF A;  1EWO A;  1X9Y A;  3PBH A;  3KWZ A;  1MHW A;  4ZTB A;  2YJ9 A;  3IMA A;  5KO3 A;  2GFO A;  2NQI A;  4CDC B;  1O0E A;  1EWP A;  4N79 A;  4DMY A;  4BOU A;  5CVN B;  2JQF R;  2XU4 A;  3IFU A;  2G8E A;  3HD3 A;  6PAD A;  3IEJ A;  1QMY A;  2PNS A;  2VHS A;  4YYW A;  1NL6 A;  3MTN A;  3F75 A;  1TLO A;  4FJC A;  1YVB A;  1PVJ A;  4YYU A;  2FTD A;  3HHA A;  2BDZ A;  4WA6 A;  1F2B A;  1MS6 A;  3H8B A;  1GEC E;  2R9N A;  1JQP A;  4P6G A;  3PRM A;  1HUC B;  1SP4 B;  1MIR A;  3QT4 A;  2XU1 A;  4I05 A;  4YYQ A;  1VJV A;  3GCB A;  3PHW A;  2AIM A;  3MP2 A;  2O6X A;  2DJF B;  2DZY A;  4OW0 A;  4BSQ A;  3KX1 A;  1FH0 A;  1ME4 A;  2CB5 A;  3MOR A;  1UKF A;  3E9S A;  2AYN A;  3S3R A;  3WXG A;  2BDL A;  4Q8H A;  3U8E A;  1F2A A;  3O1G A;  3PW3 A;  4RF0 A;  3PRP A;  2VHF A;  2FYE A;  1PIP A;  2R6N A;  5E6J A;  2DC9 A;  1BP4 A;  5EF4 A;  3USV A;  2G7Y A;  3QSD A;  4X6J A;  1CSB B;  2FQ9 A;  3TMP A;  4N8W A;  5CVM A;  4OVZ B;  1U9X A;  2AUZ A;  2UZJ A;  1CQD A;  1STF E;  4XUI A;  1XKG A;  3RVW A;  2XU3 A;  2DCB A;  3S3Q A;  3H8C A;  4QRX A;  2R9C A;  4BS6 A;  4D8B A;  3WXE A;  4AXM A;  4BOS A;  1KHQ A;  1AYU A;  2FE8 A;  2OZ2 A;  5CVO B;  4IUM A;  3O0U A;  1KHP A;  1K3B B;  2G6D A;  2BTW A;  4PAD A;  2P0R A;  4PT5 A;  2AU1 A;  4IP3 A;  2E01 A;  3OVZ A;  4W5B A;  3MHS A;  3P5W A;  3BB7 A;  3CH2 X;  2FRQ A;  2C0Y A;  3OVX A;  4AXL A;  1DKI A;  3K8U A;  4D8I A;  3KW9 A;  3B79 A;  3I3T A;  2DZZ A;  4PI3 A;  2E00 A;  4CDD B;  1S4V A; 
#chains in the Genus database with same CATH homology
 1ZCM A;  3RVX A;  3WXF A;  4B55 A;  1CPJ A;  1POP A;  3KFQ A;  1ZIV A;  1GLO A;  3DF0 A;  1YAL A;  1A6R A;  1DEU A;  3H89 A;  4I04 A;  3IHP A;  7PCK A;  1CTE A;  3OF9 A;  1AU3 A;  3BOW A;  3CBJ A;  4K7C A;  4W5C A;  2E02 A;  3NHE A;  2P7U A;  2F7D A;  2VFB A;  2F1G A;  2B1M A;  2AS8 A;  4W4U A;  3QJ3 A;  4PP1 A;  3M99 A;  2PBH A;  2E03 A;  4BS5 A;  3LFY A;  3ZUA A;  1PE6 A;  3N3G A;  2HXZ A;  2DC7 A;  3CBK A;  1SNK A;  9PAP A;  2FT2 A;  8PCH A;  1AEC A;  1GCB A;  4BPV A;  3KKU A;  1TU6 A;  1BQI A;  4FIP A;  1PCI A;  4G54 A;  5FPW A;  5J94 A;  2YJC A;  3HHI A;  1VSN A;  1ME3 A;  5PAD A;  2FUD A;  4QBB A;  2WBF X;  4YV8 A;  1NB5 A;  2OUL A;  2P86 A;  3BC3 A;  2YJ2 A;  4NV7 A;  4BGF A;  2FRA A;  3P5X A;  1CV8 A;  1ITO A;  1M6D A;  3H6S A;  2BSZ A;  3BCN A;  1NB3 A;  1IWD A;  2ACT A;  5CHT A;  4NV8 A;  3I06 A;  1PPO A;  2PAD A;  4X6H A;  3BPM A;  3HWN A;  3OIS A;  5F02 A;  1PAD A;  1PPP A;  4YYV A;  1Y4H A;  1U9V A;  1E2T A;  3E1Z B;  4CDF B;  2DC8 A;  2AUX A;  1F2C A;  4Q8G A;  2G8J A;  2R9O A;  1QOL A;  2YJB A;  4XR7 A;  1KXR A;  2CIO A;  1PBH A;  1CJL A;  3D6S A;  4YYR A;  4KLB A;  1Q6K A;  1GMY A;  2NQG A;  1U9Q X;  1NLJ A;  2DCC A;  1MDW A;  4YVA A;  3TNX A;  3PNR A;  1PXV A;  3CH3 X;  2JQG R;  4P6E A;  4QH6 A;  3OF8 A;  2R9F A;  2NQD B;  3V6C A;  4BQV A;  4MZS A;  1KFX L;  2H7J A;  2DJG B;  1AIM A;  3N3K A;  2GHU A;  5EGW A;  2NQA A;  1DF0 A;  2HH5 A;  1QDQ A;  5JH3 A;  3P5U A;  1CVZ A;  2R9M A;  1EF7 A;  1YK8 A;  3K24 A;  4DMX A;  1Y08 A;  3K9M A;  2Y5B A;  2HD5 A;  2PRE A;  1YK7 A;  2FO5 A;  3IOQ A;  3H7D A;  5A24 A;  2B1N A;  1TL9 A;  4CZW A;  1BGO A;  3V6E A;  1CB5 A;  1GX3 A;  2YJ8 A;  3F5V A;  2OP3 A;  3IUT A;  2AYO A;  1PPN A;  4YYS A;  2IBI A;  4I07 A;  1U5I A;  3RVV A;  3P5V A;  1QXP A;  4ZUX U;  4MZO A;  2AVW A;  4HWY A;  1CS8 A;  1F29 A;  3AI8 A;  2HHN A;  1PPD A;  4QRV A;  1THE A;  3D9W A;  1AU4 A;  4RY2 A;  4PP2 E;  2DC6 A;  1NQC A;  4OEL A;  5CHV A;  5K16 A;  1AU2 A;  1AYV A;  1BY8 A;  1AU0 A;  2DCA A;  4CDE B;  1KFU L;  3ERV A;  1AYW A;  3KWB X;  2XU5 A;  1MEM A;  3BWK A;  1U9W A;  1MEG A;  3N4C A;  4QRG A;  3C9E A;  2ATO A;  2DCD A;  3LXS A;  1W4T A;  3MHH A;  1EWM A;  3PDF A;  4FK5 A;  2IPP B;  1YT7 A;  3IV2 A;  1ATK A;  1NPZ A;  4MSX A;  2Y6E A;  3BPF A;  1EWL A;  4X6I A;  4N4Z A;  5JA7 A;  3KSE A;  4OEM A;  2ARY A;  1ICF A;  1EWO A;  1X9Y A;  3PBH A;  3KWZ A;  1MHW A;  2YJ9 A;  3IMA A;  2GFO A;  2NQI A;  4CDC B;  1O0E A;  1EWP A;  3LTW A;  4N79 A;  4DMY A;  5CVN B;  2JQF R;  2XU4 A;  4GUZ A;  2G8E A;  3HD3 A;  6PAD A;  3IEJ A;  1QMY A;  2PNS A;  2VHS A;  4YYW A;  1NL6 A;  3MTN A;  3F75 A;  1TLO A;  4FJC A;  1YVB A;  4YYU A;  2FTD A;  3HHA A;  2BDZ A;  4WA6 A;  1F2B A;  1MS6 A;  3H8B A;  1GEC E;  2R9N A;  1JQP A;  4P6G A;  2VFC A;  1HUC B;  1SP4 B;  1MIR A;  3QT4 A;  2XU1 A;  4I05 A;  4YYQ A;  1VJV A;  3GCB A;  2AIM A;  2O6X A;  1W5R A;  2DJF B;  2DZY A;  4BSQ A;  3KX1 A;  1FH0 A;  1ME4 A;  2CB5 A;  3MOR A;  2AYN A;  3S3R A;  3WXG A;  2BDL A;  4Q8H A;  3U8E A;  1F2A A;  3O1G A;  3PW3 A;  2VHF A;  2FYE A;  1PIP A;  2R6N A;  2DC9 A;  1BP4 A;  5EF4 A;  1W6F A;  3USV A;  2G7Y A;  3QSD A;  4X6J A;  1CSB B;  2FQ9 A;  4N8W A;  5CVM A;  1U9X A;  2AUZ A;  1CQD A;  1STF E;  4XUI A;  1XKG A;  3RVW A;  2XU3 A;  2DCB A;  3S3Q A;  3H8C A;  4QRX A;  2R9C A;  4BS6 A;  3WXE A;  4AXM A;  4C5P A;  1KHQ A;  1AYU A;  2OZ2 A;  5CVO B;  3O0U A;  1KHP A;  1K3B B;  2G6D A;  4PAD A;  2P0R A;  2AU1 A;  2E01 A;  3OVZ A;  4W5B A;  3MHS A;  3P5W A;  3CH2 X;  2FRQ A;  2C0Y A;  3OVX A;  4AXL A;  3K8U A;  3KW9 A;  3B79 A;  3I3T A;  2DZZ A;  4PI3 A;  2E00 A;  4CDD B;  1S4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...