2PNSA

1.9 angstrom resolution crystal structure of a plant cysteine protease ervatamin-c refinement with cdna derived amino acid sequence
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
208
structure length
208
Chain Sequence
LPEQIDWRKKGAVTPVKNQGKCGSCWAFSTVSTVESINQIRTGNLISLSEQQLVDCNKKNHGCKGGAFVYAYQYIIDNGGIDTEANYPYKAVQGPCRAAKKVVRIDGYKGVPHCNENALKKAVASQPSVVAIDASSKQFQHYKSGIFSGPCGTKLNHGVVIVGYWKDYWIVRNSWGRYWGEQGYIRMKRVGGCGLCGIARLPYYPTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ervatamin-C, a papain-like plant cysteine protease
publication title A thermostable cysteine protease precursor from a tropical plant contains an unusual C-terminal propeptide: cDNA cloning, sequence comparison and molecular modeling studies.
pubmed doi rcsb
molecule tags Hydrolase
total genus 64
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2pnsA00
3I3TA 3IV2A 7PCKA 2PNSA 1QOLA 4PP1A 4QRGA 2FUDA 1PE6A 3H8BA 4X6IA 1GCBA 1KFXL 1KXRA 1NL6A 2BDZA 1KHPA 1EWMA 2DC7A 1AU4A 2F7DA 1O0EA 2ATOA 1MS6A 1GLOA 3K8UA 3BOWA 3H8CA 3OVXA 4BPVA 3RVVA 3CH2X 1ATKA 2PREA 3HHIA 1Q6KA 2AVWA 1KFUL 2BDLA 5A24A 1PPDA 2CB5A 2E02A 2NQAA 1ME3A 5PADA 3MTNA 4DMYA 4DMXA 2ARYA 1PCIA 4KLBA 3MHHA 1SNKA 1PXVA 1U9XA 1TLOA 3DF0A 3IEJA 3CBJA 3BPMA 1MEGA 2CIOA 1U9WA 4PP2E 1CPJA 2G7YA 4W5CA 3KWBX 1ITOA 1TL9A 5F02A 1S4VA 1BY8A 2IBIA 1GECE 2G8EA 2DZYA 2YJ8A 4YV8A 4MZSA 3LXSA 5CVOB 4QH6A 5CVMA 2FRQA 1QXPA 2AU1A 1PPOA 2PADA 2JQFR 2YJ9A 2G6DA 1ZCMA 2Y6EA 4AXMA 3H6SA 3USVA 1AU2A 1Y08A 1QDQA 2VHSA 4CZWA 8PCHA 4MSXA 5CHVA 2HD5A 2HH5A 1AYWA 3I06A 3V6EA 2DJFB 4PI3A 2R6NA 2DC6A 4YYVA 3PBHA 3D6SA 4CDFB 2B1NA 2P86A 3M99A 3KFQA 1PADA 2NQIA 1CSBB 2OZ2A 1BGOA 2R9OA 4X6HA 4QBBA 9PAPA 1PPNA 2DCBA 3O0UA 1U9VA 5J94A 2FT2A 3C9EA 2GHUA 1AYVA 2XU1A 1AU3A 3S3QA 2NQDB 4K7CA 1THEA 1NQCA 1KHQA 3P5VA 5JA7A 3H7DA 5EGWA 1CQDA 1U5IA 2NQGA 1F29A 4AXLA 1NB3A 3HHAA 4PADA 3TNXA 1YT7A 3K24A 1YVBA 3GCBA 2R9FA 3O1GA 4N4ZA 1CV8A 1MEMA 1GMYA 1VJVA 1XKGA 2P7UA 3WXFA 1BQIA 3CBKA 4QRXA 1CJLA 2E00A 1AECA 1TU6A 1X9YA 3QJ3A 2AUXA 2DCDA 2DCCA 1DEUA 3LFYA 3H89A 1K3BB 4RY2A 3P5WA 5JH3A 2DCAA 3OVZA 4BS6A 1POPA 3AI8A 2OULA 2AS8A 3N3KA 1AIMA 2F1GA 2HXZA 2FTDA 1ICFA 2WBFX 1M6DA 1MDWA 1STFE 1QMYA 2FRAA 1NPZA 3KWZA 2OP3A 2H7JA 4XUIA 3N3GA 3ERVA 2R9NA 3P5UA 1SP4B 3WXEA 3HD3A 4YYRA 4W5BA 3S3RA 2FQ9A 3IMAA 2FO5A 5FPWA 2FYEA 3KW9A 2JQGR 2G8JA 4I05A 4MZOA 1CB5A 1F2AA 2XU4A 3F75A 4QRVA 1ZIVA 4YYSA 1FH0A 1NLJA 1F2BA 3KSEA 4FIPA 1AU0A 1ME4A 1U9QX 2AUZA 2B1MA 2YJBA 2XU3A 4N8WA 2DJGB 1YALA 1CS8A 4OEMA 4HWYA 4BSQA 4YYUA 3PW3A 3U8EA 4WA6A 1PPPA 1A6RA 3QT4A 1DF0A 3PNRA 3MHSA 2E01A 2Y5BA 2DZZA 3E1ZB 1EWPA 2C0YA 3OF8A 2AIMA 1YK8A 4BQVA 4XR7A 3RVXA 1CTEA 2AYNA 2GFOA 1PBHA 4BS5A 2XU5A 2DC9A 4FK5A 4I04A 1BP4A 4ZUXU 1NB5A 4YYQA 1HUCB 1Y4HA 3BC3A 4G54A 2P0RA 5CHTA 3OF9A 3IOQA 6PADA 2VHFA 5CVNB 1EF7A 3IHPA 4Q8HA 2DC8A 4P6EA 4CDDB 1MIRA 3NHEA 3WXGA 1MHWA 5EF4A 1YK7A 3QSDA 4N79A 4FJCA 3N4CA 1JQPA 4CDCB 2E03A 3OISA 2O6XA 2YJCA 3V6CA 1PIPA 3CH3X 2PBHA 3PDFA 4OELA 1VSNA 4I07A 2ACTA 2HHNA 4X6JA 3BWKA 3BPFA 2IPPB 2R9CA 3F5VA 5K16A 2AYOA 2YJ2A 1EWLA 4P6GA 3KKUA 1F2CA 3HWNA 3KX1A 4YYWA 4W4UA 3RVWA 3MORA 4CDEB 4YVAA 3K9MA 3P5XA 1CVZA 3IUTA 1IWDA 3BCNA 2R9MA 4Q8GA 3ZUAA 3B79A 1AYUA 1EWOA
chains in the Genus database with same CATH superfamily
3I3TA 3IV2A 7PCKA 2PNSA 1QOLA 4PP1A 4QRGA 2FUDA 1PE6A 4A5UA 3H8BA 4X6IA 1GCBA 1KFXL 1KXRA 1NL6A 2BDZA 1KHPA 3W31A 2JTCA 1EWMA 2DC7A 2BTWB 3MJ5A 4D8EA 1AU4A 2F7DA 3IFUA 1O0EA 2ATOA 1MS6A 1GLOA 3K8UA 3BOWA 3H8CA 3OVXA 4BPVA 3RVVA 3CH2X 1ATKA 2PREA 3HHIA 1Q6KA 2AVWA 1KFUL 2BDLA 5E6JA 5A24A 1PPDA 4MM3B 4GUAA 2CB5A 2E02A 2NQAA 3B21A 1ME3A 5PADA 3MTNA 4DMYA 4DMXA 2ARYA 1PCIA 4KLBA 3MHHA 1SNKA 1PXVA 4RF1A 1U9XA 1TLOA 3DF0A 3IEJA 2DOSA 3CBJA 3BPMA 1MEGA 2CIOA 1U9WA 4PP2E 1CPJA 2G7YA 4RKXA 4W5CA 3KWBX 1ITOA 1TL9A 4OW0A 5F02A 1S4VA 1BY8A 4ZTBA 2IBIA 1GECE 2G8EA 2DZYA 1PVJA 2YJ8A 4IUMA 4YV8A 4MZSA 3LXSA 5CVOB 4QH6A 5CVMA 2FRQA 1QXPA 2AU1A 1PPOA 2PADA 2JQFR 2YJ9A 2G6DA 1ZCMA 2Y6EA 4AXMA 3H6SA 3USVA 1AU2A 1Y08A 1QDQA 2VHSA 4CZWA 2BTWA 8PCHA 4MSXA 5CHVA 3PRPA 2HD5A 2HH5A 1AYWA 3I06A 3V6EA 2DJFB 4PI3A 3ZNHA 2R6NA 2DC6A 4M0WA 4YYVA 1UKFA 3PBHA 4XZXA 3D6SA 4CDFB 2B1NA 2P86A 3M99A 3KFQA 1PADA 2NQIA 1CSBB 2OZ2A 1BGOA 2R9OA 4X6HA 4QBBA 9PAPA 1PPNA 2DCBA 3O0UA 3TMPA 4BOSA 5JZEA 1U9VA 5J94A 2FT2A 3PSEA 3C9EA 2GHUA 1AYVA 2XU1A 1AU3A 3W30A 4R3DA 1YZBA 2NQDB 3S3QA 1DKIA 4WURA 4K7CA 1THEA 1NQCA 1KHQA 3PHWA 3P5VA 5JA7A 3H7DA 5EGWA 1CQDA 1U5IA 2NQGA 1F29A 4AXLA 1NB3A 3BY4A 3HHAA 3BBAA 4PADA 3TNXA 1YT7A 3MP2A 4D8IA 3K24A 1YVBA 3GCBA 2R9FA 3O1GA 4N4ZA 1CV8A 1MEMA 1GMYA 1VJVA 1XKGA 2P7UA 3WXFA 1BQIA 3CBKA 4QRXA 3PT2A 1CJLA 2E00A 1AECA 1TU6A 1X9YA 3QJ3A 2AUXA 2DCDA 2DCCA 1DEUA 3LFYA 3H89A 1K3BB 4RY2A 3P5WA 5JH3A 2DCAA 3OVZA 4BS6A 1POPA 3AI8A 2OULA 2AGAA 2AS8A 3N3KA 1AIMA 2F1GA 2HXZA 2FTDA 1ICFA 2J7QA 2WBFX 1M6DA 1MDWA 1STFE 1QMYA 2FRAA 1NPZA 3KWZA 2OP3A 2H7JA 4XUIA 3N3GA 3ERVA 2R9NA 3P5UA 1SP4B 4BOPA 3WXEA 3HD3A 2UZJA 4YYRA 4W5BA 3S3RA 3MTVA 2FQ9A 3IMAA 2FO5A 5FPWA 5EZSA 2FYEA 3KW9A 2JQGR 2G8JA 4I05A 3C0RA 4MZOA 1CB5A 1F2AA 2XU4A 3F75A 4BOUA 4QRVA 1ZIVA 4YYSA 1FH0A 1NLJA 1F2BA 3KSEA 4FIPA 1AU0A 1ME4A 1U9QX 2AUZA 2B1MA 2HWKA 2YJBA 2XU3A 4N8WA 3OQCA 2DJGB 1YALA 1CS8A 4OEMA 4HWYA 4BSQA 4YYUA 4P16A 3PW3A 3U8EA 4D8BA 4REZA 1PPPA 4WA6A 4IP3A 4BOQA 1A6RA 2JRIA 3QT4A 1DF0A 3PNRA 4HXDB 4MI7A 2BU3A 3MHSA 4RNAA 2E01A 2Y5BA 2DZZA 2J7QC 3E1ZB 4RF0A 1EWPA 2C0YA 3OF8A 3PRMA 2AIMA 1YK8A 3RNVA 4BQVA 4XR7A 3RVXA 1CTEA 2AYNA 2GFOA 1PBHA 4BS5A 2XU5A 2DC9A 4FK5A 4I04A 1BP4A 4ZUXU 1NB5A 4YYQA 1HUCB 1Y4HA 3BC3A 4G54A 2P0RA 5CHTA 3E9SA 3OF9A 3IOQA 6PADA 2VHFA 4OVZA 5CVNB 1EF7A 5KO3A 3IHPA 4Q8HA 3BB7A 2Z84A 2DC8A 4PT5A 5EZQA 4P6EA 4CDDB 1MIRA 3PHXA 3NHEA 3WXGA 1MHWA 5EF4A 1YK7A 3QSDA 4N79A 4FJCA 3N4CA 1JQPA 4CDCB 2E03A 3OISA 2O6XA 2YJCA 3V6CA 1PIPA 3CH3X 2PBHA 3PDFA 4OELA 1VSNA 4I07A 2ACTA 2HHNA 4X6JA 3BWKA 3BPFA 2IPPB 2R9CA 3F5VA 5K16A 4OVZB 2AYOA 2YJ2A 1EWLA 4P6GA 4BOZA 3KKUA 3O65A 1F2CA 3HWNA 3KX1A 4YYWA 4W4UA 3RVWA 3MORA 4CDEB 4YVAA 3K9MA 3P5XA 2FE8A 1CVZA 3IUTA 1IWDA 3BCNA 2R9MA 4Q8GA 3ZUAA 3B79A 1AYUA 3TRKA 3PHUA 1EWOA
chains in the Genus database with same CATH topology
3I3TA 3IV2A 7PCKA 2PNSA 1QOLA 4PP1A 4QRGA 2FUDA 1PE6A 3H8BA 4X6IA 1GCBA 4NV8A 1KFXL 1KXRA 1NL6A 2BDZA 1KHPA 1EWMA 2DC7A 1AU4A 2F7DA 1O0EA 2ATOA 1MS6A 1W5RA 1GLOA 3K8UA 3BOWA 3H8CA 3OVXA 4BPVA 3RVVA 3CH2X 1ATKA 4NV7A 2PREA 3HHIA 1Q6KA 2AVWA 1KFUL 2BDLA 5A24A 1PPDA 2CB5A 2E02A 2NQAA 1ME3A 5PADA 3MTNA 4DMYA 4DMXA 2ARYA 1PCIA 4BGFA 4KLBA 2BSZA 3MHHA 1SNKA 1PXVA 1U9XA 1TLOA 3DF0A 3IEJA 3CBJA 3BPMA 1MEGA 2CIOA 1U9WA 4PP2E 1CPJA 2G7YA 4W5CA 3KWBX 1ITOA 1TL9A 5F02A 1S4VA 1BY8A 2IBIA 1GECE 2G8EA 2DZYA 2YJ8A 4YV8A 4MZSA 3LXSA 3D9WA 5CVOB 4QH6A 5CVMA 2FRQA 1QXPA 2AU1A 1PPOA 2PADA 2JQFR 2YJ9A 2G6DA 1ZCMA 2Y6EA 4AXMA 3H6SA 3USVA 1AU2A 1Y08A 1QDQA 2VHSA 4CZWA 8PCHA 4MSXA 4GUZA 5CHVA 2HD5A 2HH5A 1AYWA 3I06A 3V6EA 2DJFB 4PI3A 2R6NA 2DC6A 4YYVA 3PBHA 2VFCA 3D6SA 4CDFB 2B1NA 2P86A 1W4TA 3M99A 1PADA 2NQIA 1CSBB 2OZ2A 1BGOA 2R9OA 3KFQA 4X6HA 4QBBA 9PAPA 1PPNA 2DCBA 3O0UA 1U9VA 5J94A 2FT2A 3C9EA 2GHUA 1AYVA 2XU1A 1AU3A 1GX3A 3S3QA 2NQDB 4K7CA 1THEA 1NQCA 1KHQA 3P5VA 5JA7A 3H7DA 5EGWA 1CQDA 1U5IA 2NQGA 1F29A 4AXLA 1NB3A 3HHAA 4PADA 3TNXA 1YT7A 3K24A 1YVBA 3GCBA 2R9FA 3O1GA 4N4ZA 1CV8A 1MEMA 1GMYA 1VJVA 1XKGA 2P7UA 3WXFA 1BQIA 3CBKA 4QRXA 1CJLA 2E00A 1AECA 1TU6A 1X9YA 3QJ3A 2AUXA 2DCDA 2DCCA 1DEUA 3LFYA 3H89A 1K3BB 4RY2A 3P5WA 5JH3A 2DCAA 3OVZA 4C5PA 4BS6A 1POPA 3AI8A 2OULA 2AS8A 3N3KA 1AIMA 2F1GA 2HXZA 2FTDA 1ICFA 2WBFX 1M6DA 1MDWA 1STFE 1QMYA 2FRAA 1NPZA 3KWZA 2OP3A 4B55A 2H7JA 4XUIA 3N3GA 3ERVA 2R9NA 3P5UA 1SP4B 3WXEA 3HD3A 4YYRA 4W5BA 3S3RA 2FQ9A 3LTWA 3IMAA 2FO5A 5FPWA 2FYEA 3KW9A 2JQGR 2G8JA 4I05A 4MZOA 1CB5A 1F2AA 2XU4A 3F75A 4QRVA 1ZIVA 4YYSA 1FH0A 1NLJA 1F2BA 3KSEA 4FIPA 1AU0A 1ME4A 1U9QX 2AUZA 2B1MA 2VFBA 2YJBA 2XU3A 4N8WA 2DJGB 1YALA 1CS8A 4OEMA 4HWYA 4BSQA 4YYUA 3PW3A 3U8EA 4WA6A 1PPPA 1A6RA 3QT4A 1DF0A 3PNRA 3MHSA 2E01A 2Y5BA 2DZZA 3E1ZB 1EWPA 2C0YA 3OF8A 2AIMA 1YK8A 4BQVA 4XR7A 3RVXA 1CTEA 2AYNA 2GFOA 1PBHA 4BS5A 2XU5A 2DC9A 4FK5A 4I04A 1BP4A 4ZUXU 1NB5A 4YYQA 1HUCB 1Y4HA 3BC3A 4G54A 2P0RA 5CHTA 3OF9A 3IOQA 6PADA 2VHFA 5CVNB 1EF7A 3IHPA 4Q8HA 2DC8A 4P6EA 4CDDB 1MIRA 3NHEA 3WXGA 1MHWA 5EF4A 1YK7A 3QSDA 4N79A 4FJCA 3N4CA 1JQPA 4CDCB 2E03A 3OISA 2O6XA 2YJCA 3V6CA 1W6FA 1PIPA 3CH3X 2PBHA 3PDFA 4OELA 1VSNA 4I07A 2ACTA 2HHNA 4X6JA 3BWKA 3BPFA 2IPPB 2R9CA 3F5VA 5K16A 2AYOA 2YJ2A 1EWLA 4P6GA 3KKUA 1F2CA 3HWNA 3KX1A 4YYWA 4W4UA 3RVWA 3MORA 4CDEB 4YVAA 3K9MA 3P5XA 1CVZA 3IUTA 1IWDA 3BCNA 2R9MA 4Q8GA 3ZUAA 3B79A 1AYUA 1EWOA 1E2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I3T A;  3IV2 A;  7PCK A;  2PNS A;  1QOL A;  4PP1 A;  4QRG A;  2FUD A;  1PE6 A;  3H8B A;  4X6I A;  1GCB A;  1KFX L;  1KXR A;  1NL6 A;  2BDZ A;  1KHP A;  1EWM A;  2DC7 A;  1AU4 A;  2F7D A;  1O0E A;  2ATO A;  1MS6 A;  1GLO A;  3K8U A;  3BOW A;  3H8C A;  3OVX A;  4BPV A;  3RVV A;  3CH2 X;  1ATK A;  2PRE A;  3HHI A;  1Q6K A;  2AVW A;  1KFU L;  2BDL A;  5A24 A;  1PPD A;  2CB5 A;  2E02 A;  2NQA A;  1ME3 A;  5PAD A;  3MTN A;  4DMY A;  4DMX A;  2ARY A;  1PCI A;  4KLB A;  3MHH A;  1SNK A;  1PXV A;  1U9X A;  1TLO A;  3DF0 A;  3IEJ A;  3CBJ A;  3BPM A;  1MEG A;  2CIO A;  1U9W A;  4PP2 E;  1CPJ A;  2G7Y A;  4W5C A;  3KWB X;  1ITO A;  1TL9 A;  5F02 A;  1S4V A;  1BY8 A;  2IBI A;  1GEC E;  2G8E A;  2DZY A;  2YJ8 A;  4YV8 A;  4MZS A;  3LXS A;  5CVO B;  4QH6 A;  5CVM A;  2FRQ A;  1QXP A;  2AU1 A;  1PPO A;  2PAD A;  2JQF R;  2YJ9 A;  2G6D A;  1ZCM A;  2Y6E A;  4AXM A;  3H6S A;  3USV A;  1AU2 A;  1Y08 A;  1QDQ A;  2VHS A;  4CZW A;  8PCH A;  4MSX A;  5CHV A;  2HD5 A;  2HH5 A;  1AYW A;  3I06 A;  3V6E A;  2DJF B;  4PI3 A;  2R6N A;  2DC6 A;  4YYV A;  3PBH A;  3D6S A;  4CDF B;  2B1N A;  2P86 A;  3M99 A;  3KFQ A;  1PAD A;  2NQI A;  1CSB B;  2OZ2 A;  1BGO A;  2R9O A;  4X6H A;  4QBB A;  9PAP A;  1PPN A;  2DCB A;  3O0U A;  1U9V A;  5J94 A;  2FT2 A;  3C9E A;  2GHU A;  1AYV A;  2XU1 A;  1AU3 A;  3S3Q A;  2NQD B;  4K7C A;  1THE A;  1NQC A;  1KHQ A;  3P5V A;  5JA7 A;  3H7D A;  5EGW A;  1CQD A;  1U5I A;  2NQG A;  1F29 A;  4AXL A;  1NB3 A;  3HHA A;  4PAD A;  3TNX A;  1YT7 A;  3K24 A;  1YVB A;  3GCB A;  2R9F A;  3O1G A;  4N4Z A;  1CV8 A;  1MEM A;  1GMY A;  1VJV A;  1XKG A;  2P7U A;  3WXF A;  1BQI A;  3CBK A;  4QRX A;  1CJL A;  2E00 A;  1AEC A;  1TU6 A;  1X9Y A;  3QJ3 A;  2AUX A;  2DCD A;  2DCC A;  1DEU A;  3LFY A;  3H89 A;  1K3B B;  4RY2 A;  3P5W A;  5JH3 A;  2DCA A;  3OVZ A;  4BS6 A;  1POP A;  3AI8 A;  2OUL A;  2AS8 A;  3N3K A;  1AIM A;  2F1G A;  2HXZ A;  2FTD A;  1ICF A;  2WBF X;  1M6D A;  1MDW A;  1STF E;  1QMY A;  2FRA A;  1NPZ A;  3KWZ A;  2OP3 A;  2H7J A;  4XUI A;  3N3G A;  3ERV A;  2R9N A;  3P5U A;  1SP4 B;  3WXE A;  3HD3 A;  4YYR A;  4W5B A;  3S3R A;  2FQ9 A;  3IMA A;  2FO5 A;  5FPW A;  2FYE A;  3KW9 A;  2JQG R;  2G8J A;  4I05 A;  4MZO A;  1CB5 A;  1F2A A;  2XU4 A;  3F75 A;  4QRV A;  1ZIV A;  4YYS A;  1FH0 A;  1NLJ A;  1F2B A;  3KSE A;  4FIP A;  1AU0 A;  1ME4 A;  1U9Q X;  2AUZ A;  2B1M A;  2YJB A;  2XU3 A;  4N8W A;  2DJG B;  1YAL A;  1CS8 A;  4OEM A;  4HWY A;  4BSQ A;  4YYU A;  3PW3 A;  3U8E A;  4WA6 A;  1PPP A;  1A6R A;  3QT4 A;  1DF0 A;  3PNR A;  3MHS A;  2E01 A;  2Y5B A;  2DZZ A;  3E1Z B;  1EWP A;  2C0Y A;  3OF8 A;  2AIM A;  1YK8 A;  4BQV A;  4XR7 A;  3RVX A;  1CTE A;  2AYN A;  2GFO A;  1PBH A;  4BS5 A;  2XU5 A;  2DC9 A;  4FK5 A;  4I04 A;  1BP4 A;  4ZUX U;  1NB5 A;  4YYQ A;  1HUC B;  1Y4H A;  3BC3 A;  4G54 A;  2P0R A;  5CHT A;  3OF9 A;  3IOQ A;  6PAD A;  2VHF A;  5CVN B;  1EF7 A;  3IHP A;  4Q8H A;  2DC8 A;  4P6E A;  4CDD B;  1MIR A;  3NHE A;  3WXG A;  1MHW A;  5EF4 A;  1YK7 A;  3QSD A;  4N79 A;  4FJC A;  3N4C A;  1JQP A;  4CDC B;  2E03 A;  3OIS A;  2O6X A;  2YJC A;  3V6C A;  1PIP A;  3CH3 X;  2PBH A;  3PDF A;  4OEL A;  1VSN A;  4I07 A;  2ACT A;  2HHN A;  4X6J A;  3BWK A;  3BPF A;  2IPP B;  2R9C A;  3F5V A;  5K16 A;  2AYO A;  2YJ2 A;  1EWL A;  4P6G A;  3KKU A;  1F2C A;  3HWN A;  3KX1 A;  4YYW A;  4W4U A;  3RVW A;  3MOR A;  4CDE B;  4YVA A;  3K9M A;  3P5X A;  1CVZ A;  3IUT A;  1IWD A;  3BCN A;  2R9M A;  4Q8G A;  3ZUA A;  3B79 A;  1AYU A;  1EWO A; 
#chains in the Genus database with same CATH topology
 3I3T A;  3IV2 A;  7PCK A;  2PNS A;  1QOL A;  4PP1 A;  4QRG A;  2FUD A;  1PE6 A;  4A5U A;  3H8B A;  4X6I A;  1GCB A;  1KFX L;  1KXR A;  1NL6 A;  2BDZ A;  1KHP A;  3W31 A;  2JTC A;  1EWM A;  2DC7 A;  2BTW B;  3MJ5 A;  4D8E A;  1AU4 A;  2F7D A;  3IFU A;  1O0E A;  2ATO A;  1MS6 A;  1GLO A;  3K8U A;  3BOW A;  3H8C A;  3OVX A;  4BPV A;  3RVV A;  3CH2 X;  1ATK A;  2PRE A;  3HHI A;  1Q6K A;  2AVW A;  1KFU L;  2BDL A;  5E6J A;  5A24 A;  1PPD A;  4MM3 B;  4GUA A;  2CB5 A;  2E02 A;  2NQA A;  3B21 A;  1ME3 A;  5PAD A;  3MTN A;  4DMY A;  4DMX A;  2ARY A;  1PCI A;  4KLB A;  3MHH A;  1SNK A;  1PXV A;  4RF1 A;  1U9X A;  1TLO A;  3DF0 A;  3IEJ A;  2DOS A;  3CBJ A;  3BPM A;  1MEG A;  2CIO A;  1U9W A;  4PP2 E;  1CPJ A;  2G7Y A;  4RKX A;  4W5C A;  3KWB X;  1ITO A;  1TL9 A;  4OW0 A;  5F02 A;  1S4V A;  1BY8 A;  4ZTB A;  2IBI A;  1GEC E;  2G8E A;  2DZY A;  1PVJ A;  2YJ8 A;  4IUM A;  4YV8 A;  4MZS A;  3LXS A;  5CVO B;  4QH6 A;  5CVM A;  2FRQ A;  1QXP A;  2AU1 A;  1PPO A;  2PAD A;  2JQF R;  2YJ9 A;  2G6D A;  1ZCM A;  2Y6E A;  4AXM A;  3H6S A;  3USV A;  1AU2 A;  1Y08 A;  1QDQ A;  2VHS A;  4CZW A;  2BTW A;  8PCH A;  4MSX A;  5CHV A;  3PRP A;  2HD5 A;  2HH5 A;  1AYW A;  3I06 A;  3V6E A;  2DJF B;  4PI3 A;  3ZNH A;  2R6N A;  2DC6 A;  4M0W A;  4YYV A;  1UKF A;  3PBH A;  4XZX A;  3D6S A;  4CDF B;  2B1N A;  2P86 A;  3M99 A;  3KFQ A;  1PAD A;  2NQI A;  1CSB B;  2OZ2 A;  1BGO A;  2R9O A;  4X6H A;  4QBB A;  9PAP A;  1PPN A;  2DCB A;  3O0U A;  3TMP A;  4BOS A;  5JZE A;  1U9V A;  5J94 A;  2FT2 A;  3PSE A;  3C9E A;  2GHU A;  1AYV A;  2XU1 A;  1AU3 A;  3W30 A;  4R3D A;  1YZB A;  2NQD B;  3S3Q A;  1DKI A;  4WUR A;  4K7C A;  1THE A;  1NQC A;  1KHQ A;  3PHW A;  3P5V A;  5JA7 A;  3H7D A;  5EGW A;  1CQD A;  1U5I A;  2NQG A;  1F29 A;  4AXL A;  1NB3 A;  3BY4 A;  3HHA A;  3BBA A;  4PAD A;  3TNX A;  1YT7 A;  3MP2 A;  4D8I A;  3K24 A;  1YVB A;  3GCB A;  2R9F A;  3O1G A;  4N4Z A;  1CV8 A;  1MEM A;  1GMY A;  1VJV A;  1XKG A;  2P7U A;  3WXF A;  1BQI A;  3CBK A;  4QRX A;  3PT2 A;  1CJL A;  2E00 A;  1AEC A;  1TU6 A;  1X9Y A;  3QJ3 A;  2AUX A;  2DCD A;  2DCC A;  1DEU A;  3LFY A;  3H89 A;  1K3B B;  4RY2 A;  3P5W A;  5JH3 A;  2DCA A;  3OVZ A;  4BS6 A;  1POP A;  3AI8 A;  2OUL A;  2AGA A;  2AS8 A;  3N3K A;  1AIM A;  2F1G A;  2HXZ A;  2FTD A;  1ICF A;  2J7Q A;  2WBF X;  1M6D A;  1MDW A;  1STF E;  1QMY A;  2FRA A;  1NPZ A;  3KWZ A;  2OP3 A;  2H7J A;  4XUI A;  3N3G A;  3ERV A;  2R9N A;  3P5U A;  1SP4 B;  4BOP A;  3WXE A;  3HD3 A;  2UZJ A;  4YYR A;  4W5B A;  3S3R A;  3MTV A;  2FQ9 A;  3IMA A;  2FO5 A;  5FPW A;  5EZS A;  2FYE A;  3KW9 A;  2JQG R;  2G8J A;  4I05 A;  3C0R A;  4MZO A;  1CB5 A;  1F2A A;  2XU4 A;  3F75 A;  4BOU A;  4QRV A;  1ZIV A;  4YYS A;  1FH0 A;  1NLJ A;  1F2B A;  3KSE A;  4FIP A;  1AU0 A;  1ME4 A;  1U9Q X;  2AUZ A;  2B1M A;  2HWK A;  2YJB A;  2XU3 A;  4N8W A;  3OQC A;  2DJG B;  1YAL A;  1CS8 A;  4OEM A;  4HWY A;  4BSQ A;  4YYU A;  4P16 A;  3PW3 A;  3U8E A;  4D8B A;  4REZ A;  1PPP A;  4WA6 A;  4IP3 A;  4BOQ A;  1A6R A;  2JRI A;  3QT4 A;  1DF0 A;  3PNR A;  4HXD B;  4MI7 A;  2BU3 A;  3MHS A;  4RNA A;  2E01 A;  2Y5B A;  2DZZ A;  2J7Q C;  3E1Z B;  4RF0 A;  1EWP A;  2C0Y A;  3OF8 A;  3PRM A;  2AIM A;  1YK8 A;  3RNV A;  4BQV A;  4XR7 A;  3RVX A;  1CTE A;  2AYN A;  2GFO A;  1PBH A;  4BS5 A;  2XU5 A;  2DC9 A;  4FK5 A;  4I04 A;  1BP4 A;  4ZUX U;  1NB5 A;  4YYQ A;  1HUC B;  1Y4H A;  3BC3 A;  4G54 A;  2P0R A;  5CHT A;  3E9S A;  3OF9 A;  3IOQ A;  6PAD A;  2VHF A;  4OVZ A;  5CVN B;  1EF7 A;  5KO3 A;  3IHP A;  4Q8H A;  3BB7 A;  2Z84 A;  2DC8 A;  4PT5 A;  5EZQ A;  4P6E A;  4CDD B;  1MIR A;  3PHX A;  3NHE A;  3WXG A;  1MHW A;  5EF4 A;  1YK7 A;  3QSD A;  4N79 A;  4FJC A;  3N4C A;  1JQP A;  4CDC B;  2E03 A;  3OIS A;  2O6X A;  2YJC A;  3V6C A;  1PIP A;  3CH3 X;  2PBH A;  3PDF A;  4OEL A;  1VSN A;  4I07 A;  2ACT A;  2HHN A;  4X6J A;  3BWK A;  3BPF A;  2IPP B;  2R9C A;  3F5V A;  5K16 A;  4OVZ B;  2AYO A;  2YJ2 A;  1EWL A;  4P6G A;  4BOZ A;  3KKU A;  3O65 A;  1F2C A;  3HWN A;  3KX1 A;  4YYW A;  4W4U A;  3RVW A;  3MOR A;  4CDE B;  4YVA A;  3K9M A;  3P5X A;  2FE8 A;  1CVZ A;  3IUT A;  1IWD A;  3BCN A;  2R9M A;  4Q8G A;  3ZUA A;  3B79 A;  1AYU A;  3TRK A;  3PHU A;  1EWO A; 
#chains in the Genus database with same CATH homology
 3I3T A;  3IV2 A;  7PCK A;  2PNS A;  1QOL A;  4PP1 A;  4QRG A;  2FUD A;  1PE6 A;  3H8B A;  4X6I A;  1GCB A;  4NV8 A;  1KFX L;  1KXR A;  1NL6 A;  2BDZ A;  1KHP A;  1EWM A;  2DC7 A;  1AU4 A;  2F7D A;  1O0E A;  2ATO A;  1MS6 A;  1W5R A;  1GLO A;  3K8U A;  3BOW A;  3H8C A;  3OVX A;  4BPV A;  3RVV A;  3CH2 X;  1ATK A;  4NV7 A;  2PRE A;  3HHI A;  1Q6K A;  2AVW A;  1KFU L;  2BDL A;  5A24 A;  1PPD A;  2CB5 A;  2E02 A;  2NQA A;  1ME3 A;  5PAD A;  3MTN A;  4DMY A;  4DMX A;  2ARY A;  1PCI A;  4BGF A;  4KLB A;  2BSZ A;  3MHH A;  1SNK A;  1PXV A;  1U9X A;  1TLO A;  3DF0 A;  3IEJ A;  3CBJ A;  3BPM A;  1MEG A;  2CIO A;  1U9W A;  4PP2 E;  1CPJ A;  2G7Y A;  4W5C A;  3KWB X;  1ITO A;  1TL9 A;  5F02 A;  1S4V A;  1BY8 A;  2IBI A;  1GEC E;  2G8E A;  2DZY A;  2YJ8 A;  4YV8 A;  4MZS A;  3LXS A;  3D9W A;  5CVO B;  4QH6 A;  5CVM A;  2FRQ A;  1QXP A;  2AU1 A;  1PPO A;  2PAD A;  2JQF R;  2YJ9 A;  2G6D A;  1ZCM A;  2Y6E A;  4AXM A;  3H6S A;  3USV A;  1AU2 A;  1Y08 A;  1QDQ A;  2VHS A;  4CZW A;  8PCH A;  4MSX A;  4GUZ A;  5CHV A;  2HD5 A;  2HH5 A;  1AYW A;  3I06 A;  3V6E A;  2DJF B;  4PI3 A;  2R6N A;  2DC6 A;  4YYV A;  3PBH A;  2VFC A;  3D6S A;  4CDF B;  2B1N A;  2P86 A;  1W4T A;  3M99 A;  1PAD A;  2NQI A;  1CSB B;  2OZ2 A;  1BGO A;  2R9O A;  3KFQ A;  4X6H A;  4QBB A;  9PAP A;  1PPN A;  2DCB A;  3O0U A;  1U9V A;  5J94 A;  2FT2 A;  3C9E A;  2GHU A;  1AYV A;  2XU1 A;  1AU3 A;  1GX3 A;  3S3Q A;  2NQD B;  4K7C A;  1THE A;  1NQC A;  1KHQ A;  3P5V A;  5JA7 A;  3H7D A;  5EGW A;  1CQD A;  1U5I A;  2NQG A;  1F29 A;  4AXL A;  1NB3 A;  3HHA A;  4PAD A;  3TNX A;  1YT7 A;  3K24 A;  1YVB A;  3GCB A;  2R9F A;  3O1G A;  4N4Z A;  1CV8 A;  1MEM A;  1GMY A;  1VJV A;  1XKG A;  2P7U A;  3WXF A;  1BQI A;  3CBK A;  4QRX A;  1CJL A;  2E00 A;  1AEC A;  1TU6 A;  1X9Y A;  3QJ3 A;  2AUX A;  2DCD A;  2DCC A;  1DEU A;  3LFY A;  3H89 A;  1K3B B;  4RY2 A;  3P5W A;  5JH3 A;  2DCA A;  3OVZ A;  4C5P A;  4BS6 A;  1POP A;  3AI8 A;  2OUL A;  2AS8 A;  3N3K A;  1AIM A;  2F1G A;  2HXZ A;  2FTD A;  1ICF A;  2WBF X;  1M6D A;  1MDW A;  1STF E;  1QMY A;  2FRA A;  1NPZ A;  3KWZ A;  2OP3 A;  4B55 A;  2H7J A;  4XUI A;  3N3G A;  3ERV A;  2R9N A;  3P5U A;  1SP4 B;  3WXE A;  3HD3 A;  4YYR A;  4W5B A;  3S3R A;  2FQ9 A;  3LTW A;  3IMA A;  2FO5 A;  5FPW A;  2FYE A;  3KW9 A;  2JQG R;  2G8J A;  4I05 A;  4MZO A;  1CB5 A;  1F2A A;  2XU4 A;  3F75 A;  4QRV A;  1ZIV A;  4YYS A;  1FH0 A;  1NLJ A;  1F2B A;  3KSE A;  4FIP A;  1AU0 A;  1ME4 A;  1U9Q X;  2AUZ A;  2B1M A;  2VFB A;  2YJB A;  2XU3 A;  4N8W A;  2DJG B;  1YAL A;  1CS8 A;  4OEM A;  4HWY A;  4BSQ A;  4YYU A;  3PW3 A;  3U8E A;  4WA6 A;  1PPP A;  1A6R A;  3QT4 A;  1DF0 A;  3PNR A;  3MHS A;  2E01 A;  2Y5B A;  2DZZ A;  3E1Z B;  1EWP A;  2C0Y A;  3OF8 A;  2AIM A;  1YK8 A;  4BQV A;  4XR7 A;  3RVX A;  1CTE A;  2AYN A;  2GFO A;  1PBH A;  4BS5 A;  2XU5 A;  2DC9 A;  4FK5 A;  4I04 A;  1BP4 A;  4ZUX U;  1NB5 A;  4YYQ A;  1HUC B;  1Y4H A;  3BC3 A;  4G54 A;  2P0R A;  5CHT A;  3OF9 A;  3IOQ A;  6PAD A;  2VHF A;  5CVN B;  1EF7 A;  3IHP A;  4Q8H A;  2DC8 A;  4P6E A;  4CDD B;  1MIR A;  3NHE A;  3WXG A;  1MHW A;  5EF4 A;  1YK7 A;  3QSD A;  4N79 A;  4FJC A;  3N4C A;  1JQP A;  4CDC B;  2E03 A;  3OIS A;  2O6X A;  2YJC A;  3V6C A;  1W6F A;  1PIP A;  3CH3 X;  2PBH A;  3PDF A;  4OEL A;  1VSN A;  4I07 A;  2ACT A;  2HHN A;  4X6J A;  3BWK A;  3BPF A;  2IPP B;  2R9C A;  3F5V A;  5K16 A;  2AYO A;  2YJ2 A;  1EWL A;  4P6G A;  3KKU A;  1F2C A;  3HWN A;  3KX1 A;  4YYW A;  4W4U A;  3RVW A;  3MOR A;  4CDE B;  4YVA A;  3K9M A;  3P5X A;  1CVZ A;  3IUT A;  1IWD A;  3BCN A;  2R9M A;  4Q8G A;  3ZUA A;  3B79 A;  1AYU A;  1EWO A;  1E2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...