2ATOA

Crystal structure of human cathepsin k in complex with myocrisin
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin K
publication title Effects of disease-modifying anti-rheumatic drugs (DMARDs) on the activities of rheumatoid arthritis-associated cathepsins K and S.
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2005-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2atoA00
1BY8A 3ZUAA 3OVZA 3DF0A 2R9CA 4CDFB 2DZYA 1NB3A 1AECA 1KFUL 4QRGA 4Q8HA 2XU5A 4X6HA 1PCIA 4PP1A 3N3GA 1CPJA 1QOLA 3K24A 1PPDA 3ERVA 4BQVA 4CZWA 1BP4A 2BDLA 4AXLA 3PNRA 1TLOA 3H89A 4W4UA 3U8EA 2IPPB 1GCBA 4QH6A 2FYEA 2JQGR 2DC9A 4RY2A 6PADA 2DCCA 1MS6A 1AU0A 4I07A 2C0YA 2DC7A 1BGOA 4HWYA 3M99A 1AU4A 1EWLA 2DCDA 1QMYA 3IHPA 2E01A 1YALA 2AYNA 2PADA 3KWBX 1PIPA 2E02A 3RVWA 2P7UA 2B1NA 1CB5A 1PBHA 2G8JA 3QSDA 3KW9A 1PPNA 3H8CA 2R9FA 3WXGA 3H6SA 1ITOA 3MHHA 3CBKA 2AU1A 3OISA 4YYVA 3TNXA 4X6IA 3O0UA 1ZIVA 2P0RA 3USVA 1TL9A 2NQGA 2O6XA 1YVBA 4KLBA 2NQAA 4QBBA 2AIMA 4ZUXU 1NPZA 5PADA 1DF0A 3KSEA 3MORA 3CH3X 2B1MA 1YT7A 2XU4A 4FJCA 1AYUA 4PP2E 1EWMA 1GMYA 2GFOA 1PE6A 1PPOA 1THEA 1S4VA 2AUXA 5CHVA 4AXMA 3B79A 2DZZA 1Y4HA 2CIOA 1F2CA 5CVOB 2NQIA 2OULA 2OZ2A 2YJ8A 3IUTA 3BWKA 1X9YA 3O1GA 2VHSA 2G7YA 4N8WA 1FH0A 2FQ9A 4DMXA 4I04A 1EWPA 1U9QX 1KHQA 5A24A 2F7DA 3N4CA 2FRAA 3KKUA 9PAPA 2DC6A 1PXVA 2Y6EA 4BSQA 4FK5A 4I05A 3BCNA 3KWZA 3V6CA 2JQFR 1K3BB 1CS8A 1HUCB 4OELA 2HH5A 2R9NA 4W5CA 1CSBB 3IV2A 3I3TA 2H7JA 3AI8A 1ME3A 2YJ9A 1MHWA 5J94A 2GHUA 4N79A 1VSNA 2VHFA 3BOWA 2FRQA 3HWNA 2IBIA 1NLJA 1NQCA 1TU6A 1MIRA 2R9OA 4BPVA 3P5VA 3PW3A 1AU2A 2FUDA 2R9MA 2AS8A 2F1GA 2E03A 3HHAA 4K7CA 3H8BA 1XKGA 1STFE 1VJVA 1KFXL 3OF8A 1AIMA 1NB5A 2DCBA 5JA7A 2HXZA 2ARYA 3GCBA 4XR7A 3LFYA 5K16A 1MDWA 3HHIA 3D6SA 3BC3A 1Y08A 1F2AA 4YYRA 2E00A 3QJ3A 2OP3A 1AYWA 1CQDA 2YJCA 1CV8A 4CDEB 3OVXA 2Y5BA 3CBJA 2XU3A 4PADA 1DEUA 4MZSA 3P5XA 4QRVA 5EF4A 3PDFA 4XUIA 1EWOA 1QDQA 1YK8A 3K9MA 3I06A 2AUZA 1GLOA 3QT4A 3LXSA 2ATOA 1SP4B 2NQDB 2HD5A 2BDZA 1CJLA 4PI3A 4N4ZA 3RVVA 1A6RA 3NHEA 2WBFX 1PADA 4P6GA 2ACTA 3K8UA 2P86A 4W5BA 3MTNA 3OF9A 8PCHA 1GECE 1U9XA 4BS5A 3RVXA 1ME4A 1F29A 1KHPA 4Q8GA 4FIPA 4YVAA 1MEGA 4QRXA 4YYUA 1ATKA 2CB5A 1SNKA 1POPA 2AYOA 1NL6A 3N3KA 5FPWA 5EGWA 2PBHA 1BQIA 1KXRA 1U9WA 1ICFA 4MZOA 1AYVA 3BPFA 3KFQA 4YV8A 3IOQA 4MSXA 3PBHA 3CH2X 1PPPA 3WXFA 1O0EA 4G54A 5F02A 2DJFB 2R6NA 1CVZA 1M6DA 4OEMA 2DC8A 2YJ2A 2HHNA 3WXEA 2FTDA 1YK7A 4CDCB 4YYQA 4BS6A 3V6EA 5CVMA 3E1ZB 3S3QA 3MHSA 1CTEA 5CHTA 2XU1A 1AU3A 3F75A 2DJGB 2PNSA 4YYWA 2G6DA 3IEJA 5CVNB 4CDDB 4DMYA 2G8EA 1EF7A 3F5VA 2FT2A 3HD3A 7PCKA 4WA6A 2YJBA 4X6JA 3P5WA 2DCAA 3S3RA 1U5IA 1IWDA 1Q6KA 1MEMA 3H7DA 1JQPA 4YYSA 2FO5A 1QXPA 1ZCMA 1F2BA 3KX1A 3P5UA 2AVWA 1U9VA 5JH3A 2PREA 4P6EA 3IMAA 3BPMA 3C9EA
chains in the Genus database with same CATH superfamily
1BY8A 3ZUAA 3OVZA 3DF0A 2R9CA 4CDFB 2DZYA 1NB3A 1AECA 1KFUL 4QRGA 2BTWA 3PRMA 4Q8HA 2XU5A 4X6HA 1PCIA 4PP1A 3N3GA 1CPJA 1QOLA 3K24A 1PPDA 3ERVA 4RF0A 4BQVA 3MJ5A 4CZWA 1BP4A 2BDLA 4AXLA 3PNRA 1TLOA 3H89A 4W4UA 3U8EA 2IPPB 1GCBA 5KO3A 2FYEA 2JQGR 4QH6A 4MM3B 4BOQA 2DC9A 4RY2A 4D8IA 6PADA 2DCCA 1MS6A 1AU0A 3BY4A 4I07A 2C0YA 2DC7A 1BGOA 4HWYA 5E6JA 3M99A 1AU4A 1DKIA 1EWLA 2DCDA 3C0RA 1QMYA 3IHPA 2E01A 1YALA 2AYNA 2PADA 3KWBX 1PIPA 3MP2A 2E02A 3RVWA 2P7UA 2B1NA 1CB5A 2BU3A 1PBHA 2G8JA 3QSDA 3KW9A 1PPNA 3H8CA 2R9FA 2FE8A 3WXGA 3H6SA 1ITOA 3MHHA 3CBKA 2AU1A 3OISA 4YYVA 3TNXA 4X6IA 3O0UA 1ZIVA 2P0RA 3USVA 1TL9A 2NQGA 3OQCA 2O6XA 1YVBA 4KLBA 2NQAA 4RKXA 1YZBA 4IUMA 4QBBA 2AIMA 4ZUXU 1NPZA 5PADA 1DF0A 4BOSA 3KSEA 3MORA 3CH3X 2B1MA 5EZQA 1YT7A 3W31A 2XU4A 4FJCA 1AYUA 3PHUA 4PP2E 1EWMA 1GMYA 2GFOA 1PE6A 2AGAA 1PPOA 1THEA 4GUAA 1S4VA 2AUXA 5CHVA 4AXMA 3B79A 2DZZA 1Y4HA 2CIOA 1F2CA 5CVOB 3PRPA 2NQIA 2OULA 2OZ2A 2J7QC 2YJ8A 1UKFA 3IUTA 3BWKA 1X9YA 3MTVA 3O1GA 4D8EA 2VHSA 2G7YA 3W30A 4N8WA 1FH0A 2FQ9A 4DMXA 4I04A 4PT5A 1EWPA 1U9QX 4HXDB 1KHQA 3ZNHA 5A24A 2F7DA 2J7QA 3N4CA 3O65A 2FRAA 3TMPA 3KKUA 4OVZA 9PAPA 2DC6A 4XZXA 1PXVA 2Y6EA 4BSQA 4FK5A 4I05A 3BCNA 4BOZA 2DOSA 3KWZA 3V6CA 2JQFR 1K3BB 4OW0A 1CS8A 1HUCB 4OELA 2HH5A 2R9NA 4W5CA 3TRKA 1CSBB 3IV2A 3I3TA 2H7JA 3AI8A 4BOPA 1ME3A 2YJ9A 1MHWA 4D8BA 5J94A 2GHUA 1VSNA 2VHFA 3BOWA 4N79A 2FRQA 3HWNA 2IBIA 1NLJA 1NQCA 1TU6A 2HWKA 1MIRA 2R9OA 4BPVA 3P5VA 3PW3A 1AU2A 2FUDA 2R9MA 4MI7A 2AS8A 4REZA 2F1GA 2E03A 3HHAA 4K7CA 3H8BA 1XKGA 2JTCA 1STFE 1VJVA 1KFXL 3OF8A 1AIMA 1NB5A 2DCBA 5JA7A 2HXZA 3PHXA 2ARYA 3GCBA 4XR7A 3LFYA 5K16A 1MDWA 3HHIA 4WURA 3D6SA 3BC3A 1Y08A 1F2AA 3B21A 4YYRA 2E00A 3QJ3A 2OP3A 1AYWA 2BTWB 1CQDA 2YJCA 4P16A 1CV8A 4CDEB 3OVXA 2Y5BA 3CBJA 2XU3A 4ZTBA 4PADA 1DEUA 4MZSA 3P5XA 2JRIA 4QRVA 5EF4A 3PDFA 4XUIA 1EWOA 3PHWA 1QDQA 1YK8A 3K9MA 3I06A 2AUZA 1PVJA 1GLOA 3QT4A 3LXSA 2ATOA 1SP4B 3E9SA 2NQDB 2HD5A 2BDZA 1CJLA 4PI3A 4N4ZA 3RVVA 1A6RA 3NHEA 2WBFX 1PADA 4P6GA 3RNVA 2ACTA 3K8UA 2P86A 4W5BA 3MTNA 3OF9A 8PCHA 1GECE 4A5UA 1U9XA 4BS5A 4BOUA 3RVXA 1ME4A 1F29A 1KHPA 4Q8GA 4FIPA 4YVAA 1MEGA 4QRXA 4YYUA 1ATKA 2CB5A 1SNKA 1POPA 2AYOA 1NL6A 3N3KA 5FPWA 5EGWA 2PBHA 1BQIA 1KXRA 3PSEA 3PT2A 1U9WA 1ICFA 4RNAA 3BB7A 4MZOA 1AYVA 3BPFA 3KFQA 4YV8A 3IOQA 4MSXA 3PBHA 3CH2X 1PPPA 4M0WA 3WXFA 1O0EA 4G54A 5F02A 2DJFB 2R6NA 1CVZA 4RF1A 1M6DA 2Z84A 4OEMA 2DC8A 2YJ2A 2HHNA 3WXEA 2FTDA 4IP3A 1YK7A 4CDCB 3IFUA 4YYQA 5EZSA 4BS6A 3V6EA 5CVMA 3E1ZB 3S3QA 3MHSA 1CTEA 2UZJA 5CHTA 2XU1A 1AU3A 3F75A 2DJGB 2PNSA 4YYWA 2G6DA 3IEJA 5CVNB 4CDDB 4DMYA 5JZEA 2G8EA 1EF7A 3F5VA 2FT2A 3HD3A 7PCKA 4WA6A 2YJBA 4X6JA 3P5WA 2DCAA 3S3RA 1U5IA 1IWDA 1Q6KA 1MEMA 3H7DA 4OVZB 1JQPA 4YYSA 2FO5A 1QXPA 1ZCMA 1F2BA 3KX1A 3P5UA 2AVWA 1U9VA 3BBAA 5JH3A 2PREA 4P6EA 3IMAA 4R3DA 3BPMA 3C9EA
chains in the Genus database with same CATH topology
1BY8A 3ZUAA 3OVZA 3DF0A 2R9CA 4CDFB 2DZYA 1NB3A 1AECA 1W6FA 1KFUL 4QRGA 4Q8HA 2XU5A 4X6HA 1PCIA 4PP1A 3N3GA 1CPJA 1QOLA 1GX3A 3K24A 1PPDA 3ERVA 4BQVA 4CZWA 1BP4A 2BDLA 4AXLA 3PNRA 1TLOA 3H89A 4W4UA 3U8EA 2IPPB 1GCBA 2FYEA 2JQGR 4QH6A 2DC9A 4RY2A 6PADA 2DCCA 1MS6A 1AU0A 4B55A 4I07A 2C0YA 2DC7A 1BGOA 4HWYA 3M99A 1AU4A 1EWLA 2DCDA 1QMYA 3IHPA 2E01A 1YALA 2AYNA 2PADA 3KWBX 1PIPA 2E02A 3RVWA 2P7UA 2B1NA 1CB5A 1PBHA 2G8JA 3QSDA 3KW9A 2VFBA 3LTWA 1PPNA 3H8CA 2R9FA 1W4TA 3WXGA 3H6SA 1ITOA 1E2TA 3MHHA 3CBKA 2AU1A 3OISA 4YYVA 3TNXA 4X6IA 3O0UA 1ZIVA 2P0RA 3USVA 1TL9A 2NQGA 2O6XA 1YVBA 4KLBA 2NQAA 4QBBA 2AIMA 4ZUXU 1NPZA 5PADA 1DF0A 3KSEA 3MORA 3CH3X 2B1MA 1YT7A 4C5PA 2XU4A 4FJCA 1AYUA 4PP2E 1EWMA 1GMYA 2GFOA 1PE6A 1PPOA 1THEA 1S4VA 2AUXA 5CHVA 4AXMA 3B79A 2DZZA 4BGFA 1Y4HA 2CIOA 1F2CA 5CVOB 2NQIA 2OULA 2OZ2A 2YJ8A 3IUTA 3BWKA 1X9YA 3O1GA 2VHSA 2G7YA 4NV7A 4N8WA 1FH0A 2FQ9A 4DMXA 4I04A 1EWPA 1U9QX 1KHQA 5A24A 2F7DA 3N4CA 2FRAA 3KKUA 9PAPA 2DC6A 1PXVA 2Y6EA 4BSQA 4FK5A 4I05A 3BCNA 3KWZA 3V6CA 2JQFR 1K3BB 1CS8A 1HUCB 4OELA 2BSZA 2HH5A 2R9NA 4W5CA 1CSBB 3IV2A 3I3TA 2H7JA 3AI8A 1ME3A 2YJ9A 1MHWA 5J94A 2GHUA 4N79A 1VSNA 2VHFA 3BOWA 2FRQA 3HWNA 2IBIA 1NLJA 1NQCA 1TU6A 1MIRA 2R9OA 4BPVA 3P5VA 3PW3A 1AU2A 2FUDA 2R9MA 2AS8A 2F1GA 2E03A 3HHAA 4K7CA 3H8BA 1XKGA 1STFE 1VJVA 1KFXL 3OF8A 1AIMA 1NB5A 2DCBA 5JA7A 2HXZA 2ARYA 3GCBA 4XR7A 3LFYA 5K16A 1MDWA 3HHIA 3D6SA 3BC3A 1Y08A 1F2AA 4YYRA 2E00A 3QJ3A 2OP3A 1AYWA 1CQDA 2YJCA 1CV8A 4CDEB 3OVXA 4NV8A 2Y5BA 3CBJA 2XU3A 4PADA 1DEUA 4MZSA 3P5XA 4QRVA 5EF4A 3PDFA 4XUIA 1EWOA 1QDQA 1YK8A 3K9MA 3I06A 2AUZA 1GLOA 4GUZA 3QT4A 3LXSA 2ATOA 1SP4B 2NQDB 2HD5A 2BDZA 1CJLA 4PI3A 4N4ZA 3RVVA 1A6RA 3NHEA 2WBFX 1PADA 4P6GA 2ACTA 3K8UA 2P86A 4W5BA 3MTNA 3OF9A 8PCHA 1GECE 1U9XA 4BS5A 3RVXA 1ME4A 1F29A 1KHPA 4Q8GA 4FIPA 4YVAA 1MEGA 4QRXA 4YYUA 1ATKA 2CB5A 1SNKA 1POPA 2AYOA 1NL6A 3N3KA 5FPWA 5EGWA 2PBHA 3D9WA 1BQIA 1KXRA 1U9WA 1ICFA 4MZOA 1AYVA 3BPFA 3KFQA 4YV8A 3IOQA 4MSXA 3PBHA 3CH2X 1PPPA 3WXFA 1O0EA 4G54A 5F02A 2DJFB 2R6NA 1CVZA 1M6DA 4OEMA 2DC8A 2YJ2A 2HHNA 3WXEA 2FTDA 1YK7A 4CDCB 4YYQA 2VFCA 4BS6A 3V6EA 1W5RA 5CVMA 3E1ZB 3S3QA 3MHSA 1CTEA 5CHTA 2XU1A 1AU3A 3F75A 2DJGB 2PNSA 4YYWA 2G6DA 3IEJA 5CVNB 4CDDB 4DMYA 2G8EA 1EF7A 3F5VA 2FT2A 3HD3A 7PCKA 4WA6A 2YJBA 4X6JA 3P5WA 2DCAA 3S3RA 1U5IA 1IWDA 1Q6KA 1MEMA 3H7DA 1JQPA 4YYSA 2FO5A 1QXPA 1ZCMA 1F2BA 3KX1A 3P5UA 2AVWA 1U9VA 5JH3A 2PREA 4P6EA 3IMAA 3BPMA 3C9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BY8 A;  3ZUA A;  3OVZ A;  3DF0 A;  2R9C A;  4CDF B;  2DZY A;  1NB3 A;  1AEC A;  1KFU L;  4QRG A;  4Q8H A;  2XU5 A;  4X6H A;  1PCI A;  4PP1 A;  3N3G A;  1CPJ A;  1QOL A;  3K24 A;  1PPD A;  3ERV A;  4BQV A;  4CZW A;  1BP4 A;  2BDL A;  4AXL A;  3PNR A;  1TLO A;  3H89 A;  4W4U A;  3U8E A;  2IPP B;  1GCB A;  4QH6 A;  2FYE A;  2JQG R;  2DC9 A;  4RY2 A;  6PAD A;  2DCC A;  1MS6 A;  1AU0 A;  4I07 A;  2C0Y A;  2DC7 A;  1BGO A;  4HWY A;  3M99 A;  1AU4 A;  1EWL A;  2DCD A;  1QMY A;  3IHP A;  2E01 A;  1YAL A;  2AYN A;  2PAD A;  3KWB X;  1PIP A;  2E02 A;  3RVW A;  2P7U A;  2B1N A;  1CB5 A;  1PBH A;  2G8J A;  3QSD A;  3KW9 A;  1PPN A;  3H8C A;  2R9F A;  3WXG A;  3H6S A;  1ITO A;  3MHH A;  3CBK A;  2AU1 A;  3OIS A;  4YYV A;  3TNX A;  4X6I A;  3O0U A;  1ZIV A;  2P0R A;  3USV A;  1TL9 A;  2NQG A;  2O6X A;  1YVB A;  4KLB A;  2NQA A;  4QBB A;  2AIM A;  4ZUX U;  1NPZ A;  5PAD A;  1DF0 A;  3KSE A;  3MOR A;  3CH3 X;  2B1M A;  1YT7 A;  2XU4 A;  4FJC A;  1AYU A;  4PP2 E;  1EWM A;  1GMY A;  2GFO A;  1PE6 A;  1PPO A;  1THE A;  1S4V A;  2AUX A;  5CHV A;  4AXM A;  3B79 A;  2DZZ A;  1Y4H A;  2CIO A;  1F2C A;  5CVO B;  2NQI A;  2OUL A;  2OZ2 A;  2YJ8 A;  3IUT A;  3BWK A;  1X9Y A;  3O1G A;  2VHS A;  2G7Y A;  4N8W A;  1FH0 A;  2FQ9 A;  4DMX A;  4I04 A;  1EWP A;  1U9Q X;  1KHQ A;  5A24 A;  2F7D A;  3N4C A;  2FRA A;  3KKU A;  9PAP A;  2DC6 A;  1PXV A;  2Y6E A;  4BSQ A;  4FK5 A;  4I05 A;  3BCN A;  3KWZ A;  3V6C A;  2JQF R;  1K3B B;  1CS8 A;  1HUC B;  4OEL A;  2HH5 A;  2R9N A;  4W5C A;  1CSB B;  3IV2 A;  3I3T A;  2H7J A;  3AI8 A;  1ME3 A;  2YJ9 A;  1MHW A;  5J94 A;  2GHU A;  4N79 A;  1VSN A;  2VHF A;  3BOW A;  2FRQ A;  3HWN A;  2IBI A;  1NLJ A;  1NQC A;  1TU6 A;  1MIR A;  2R9O A;  4BPV A;  3P5V A;  3PW3 A;  1AU2 A;  2FUD A;  2R9M A;  2AS8 A;  2F1G A;  2E03 A;  3HHA A;  4K7C A;  3H8B A;  1XKG A;  1STF E;  1VJV A;  1KFX L;  3OF8 A;  1AIM A;  1NB5 A;  2DCB A;  5JA7 A;  2HXZ A;  2ARY A;  3GCB A;  4XR7 A;  3LFY A;  5K16 A;  1MDW A;  3HHI A;  3D6S A;  3BC3 A;  1Y08 A;  1F2A A;  4YYR A;  2E00 A;  3QJ3 A;  2OP3 A;  1AYW A;  1CQD A;  2YJC A;  1CV8 A;  4CDE B;  3OVX A;  2Y5B A;  3CBJ A;  2XU3 A;  4PAD A;  1DEU A;  4MZS A;  3P5X A;  4QRV A;  5EF4 A;  3PDF A;  4XUI A;  1EWO A;  1QDQ A;  1YK8 A;  3K9M A;  3I06 A;  2AUZ A;  1GLO A;  3QT4 A;  3LXS A;  2ATO A;  1SP4 B;  2NQD B;  2HD5 A;  2BDZ A;  1CJL A;  4PI3 A;  4N4Z A;  3RVV A;  1A6R A;  3NHE A;  2WBF X;  1PAD A;  4P6G A;  2ACT A;  3K8U A;  2P86 A;  4W5B A;  3MTN A;  3OF9 A;  8PCH A;  1GEC E;  1U9X A;  4BS5 A;  3RVX A;  1ME4 A;  1F29 A;  1KHP A;  4Q8G A;  4FIP A;  4YVA A;  1MEG A;  4QRX A;  4YYU A;  1ATK A;  2CB5 A;  1SNK A;  1POP A;  2AYO A;  1NL6 A;  3N3K A;  5FPW A;  5EGW A;  2PBH A;  1BQI A;  1KXR A;  1U9W A;  1ICF A;  4MZO A;  1AYV A;  3BPF A;  3KFQ A;  4YV8 A;  3IOQ A;  4MSX A;  3PBH A;  3CH2 X;  1PPP A;  3WXF A;  1O0E A;  4G54 A;  5F02 A;  2DJF B;  2R6N A;  1CVZ A;  1M6D A;  4OEM A;  2DC8 A;  2YJ2 A;  2HHN A;  3WXE A;  2FTD A;  1YK7 A;  4CDC B;  4YYQ A;  4BS6 A;  3V6E A;  5CVM A;  3E1Z B;  3S3Q A;  3MHS A;  1CTE A;  5CHT A;  2XU1 A;  1AU3 A;  3F75 A;  2DJG B;  2PNS A;  4YYW A;  2G6D A;  3IEJ A;  5CVN B;  4CDD B;  4DMY A;  2G8E A;  1EF7 A;  3F5V A;  2FT2 A;  3HD3 A;  7PCK A;  4WA6 A;  2YJB A;  4X6J A;  3P5W A;  2DCA A;  3S3R A;  1U5I A;  1IWD A;  1Q6K A;  1MEM A;  3H7D A;  1JQP A;  4YYS A;  2FO5 A;  1QXP A;  1ZCM A;  1F2B A;  3KX1 A;  3P5U A;  2AVW A;  1U9V A;  5JH3 A;  2PRE A;  4P6E A;  3IMA A;  3BPM A;  3C9E A; 
#chains in the Genus database with same CATH topology
 1BY8 A;  3ZUA A;  3OVZ A;  3DF0 A;  2R9C A;  4CDF B;  2DZY A;  1NB3 A;  1AEC A;  1KFU L;  4QRG A;  2BTW A;  3PRM A;  4Q8H A;  2XU5 A;  4X6H A;  1PCI A;  4PP1 A;  3N3G A;  1CPJ A;  1QOL A;  3K24 A;  1PPD A;  3ERV A;  4RF0 A;  4BQV A;  3MJ5 A;  4CZW A;  1BP4 A;  2BDL A;  4AXL A;  3PNR A;  1TLO A;  3H89 A;  4W4U A;  3U8E A;  2IPP B;  1GCB A;  5KO3 A;  2FYE A;  2JQG R;  4QH6 A;  4MM3 B;  4BOQ A;  2DC9 A;  4RY2 A;  4D8I A;  6PAD A;  2DCC A;  1MS6 A;  1AU0 A;  3BY4 A;  4I07 A;  2C0Y A;  2DC7 A;  1BGO A;  4HWY A;  5E6J A;  3M99 A;  1AU4 A;  1DKI A;  1EWL A;  2DCD A;  3C0R A;  1QMY A;  3IHP A;  2E01 A;  1YAL A;  2AYN A;  2PAD A;  3KWB X;  1PIP A;  3MP2 A;  2E02 A;  3RVW A;  2P7U A;  2B1N A;  1CB5 A;  2BU3 A;  1PBH A;  2G8J A;  3QSD A;  3KW9 A;  1PPN A;  3H8C A;  2R9F A;  2FE8 A;  3WXG A;  3H6S A;  1ITO A;  3MHH A;  3CBK A;  2AU1 A;  3OIS A;  4YYV A;  3TNX A;  4X6I A;  3O0U A;  1ZIV A;  2P0R A;  3USV A;  1TL9 A;  2NQG A;  3OQC A;  2O6X A;  1YVB A;  4KLB A;  2NQA A;  4RKX A;  1YZB A;  4IUM A;  4QBB A;  2AIM A;  4ZUX U;  1NPZ A;  5PAD A;  1DF0 A;  4BOS A;  3KSE A;  3MOR A;  3CH3 X;  2B1M A;  5EZQ A;  1YT7 A;  3W31 A;  2XU4 A;  4FJC A;  1AYU A;  3PHU A;  4PP2 E;  1EWM A;  1GMY A;  2GFO A;  1PE6 A;  2AGA A;  1PPO A;  1THE A;  4GUA A;  1S4V A;  2AUX A;  5CHV A;  4AXM A;  3B79 A;  2DZZ A;  1Y4H A;  2CIO A;  1F2C A;  5CVO B;  3PRP A;  2NQI A;  2OUL A;  2OZ2 A;  2J7Q C;  2YJ8 A;  1UKF A;  3IUT A;  3BWK A;  1X9Y A;  3MTV A;  3O1G A;  4D8E A;  2VHS A;  2G7Y A;  3W30 A;  4N8W A;  1FH0 A;  2FQ9 A;  4DMX A;  4I04 A;  4PT5 A;  1EWP A;  1U9Q X;  4HXD B;  1KHQ A;  3ZNH A;  5A24 A;  2F7D A;  2J7Q A;  3N4C A;  3O65 A;  2FRA A;  3TMP A;  3KKU A;  4OVZ A;  9PAP A;  2DC6 A;  4XZX A;  1PXV A;  2Y6E A;  4BSQ A;  4FK5 A;  4I05 A;  3BCN A;  4BOZ A;  2DOS A;  3KWZ A;  3V6C A;  2JQF R;  1K3B B;  4OW0 A;  1CS8 A;  1HUC B;  4OEL A;  2HH5 A;  2R9N A;  4W5C A;  3TRK A;  1CSB B;  3IV2 A;  3I3T A;  2H7J A;  3AI8 A;  4BOP A;  1ME3 A;  2YJ9 A;  1MHW A;  4D8B A;  5J94 A;  2GHU A;  1VSN A;  2VHF A;  3BOW A;  4N79 A;  2FRQ A;  3HWN A;  2IBI A;  1NLJ A;  1NQC A;  1TU6 A;  2HWK A;  1MIR A;  2R9O A;  4BPV A;  3P5V A;  3PW3 A;  1AU2 A;  2FUD A;  2R9M A;  4MI7 A;  2AS8 A;  4REZ A;  2F1G A;  2E03 A;  3HHA A;  4K7C A;  3H8B A;  1XKG A;  2JTC A;  1STF E;  1VJV A;  1KFX L;  3OF8 A;  1AIM A;  1NB5 A;  2DCB A;  5JA7 A;  2HXZ A;  3PHX A;  2ARY A;  3GCB A;  4XR7 A;  3LFY A;  5K16 A;  1MDW A;  3HHI A;  4WUR A;  3D6S A;  3BC3 A;  1Y08 A;  1F2A A;  3B21 A;  4YYR A;  2E00 A;  3QJ3 A;  2OP3 A;  1AYW A;  2BTW B;  1CQD A;  2YJC A;  4P16 A;  1CV8 A;  4CDE B;  3OVX A;  2Y5B A;  3CBJ A;  2XU3 A;  4ZTB A;  4PAD A;  1DEU A;  4MZS A;  3P5X A;  2JRI A;  4QRV A;  5EF4 A;  3PDF A;  4XUI A;  1EWO A;  3PHW A;  1QDQ A;  1YK8 A;  3K9M A;  3I06 A;  2AUZ A;  1PVJ A;  1GLO A;  3QT4 A;  3LXS A;  2ATO A;  1SP4 B;  3E9S A;  2NQD B;  2HD5 A;  2BDZ A;  1CJL A;  4PI3 A;  4N4Z A;  3RVV A;  1A6R A;  3NHE A;  2WBF X;  1PAD A;  4P6G A;  3RNV A;  2ACT A;  3K8U A;  2P86 A;  4W5B A;  3MTN A;  3OF9 A;  8PCH A;  1GEC E;  4A5U A;  1U9X A;  4BS5 A;  4BOU A;  3RVX A;  1ME4 A;  1F29 A;  1KHP A;  4Q8G A;  4FIP A;  4YVA A;  1MEG A;  4QRX A;  4YYU A;  1ATK A;  2CB5 A;  1SNK A;  1POP A;  2AYO A;  1NL6 A;  3N3K A;  5FPW A;  5EGW A;  2PBH A;  1BQI A;  1KXR A;  3PSE A;  3PT2 A;  1U9W A;  1ICF A;  4RNA A;  3BB7 A;  4MZO A;  1AYV A;  3BPF A;  3KFQ A;  4YV8 A;  3IOQ A;  4MSX A;  3PBH A;  3CH2 X;  1PPP A;  4M0W A;  3WXF A;  1O0E A;  4G54 A;  5F02 A;  2DJF B;  2R6N A;  1CVZ A;  4RF1 A;  1M6D A;  2Z84 A;  4OEM A;  2DC8 A;  2YJ2 A;  2HHN A;  3WXE A;  2FTD A;  4IP3 A;  1YK7 A;  4CDC B;  3IFU A;  4YYQ A;  5EZS A;  4BS6 A;  3V6E A;  5CVM A;  3E1Z B;  3S3Q A;  3MHS A;  1CTE A;  2UZJ A;  5CHT A;  2XU1 A;  1AU3 A;  3F75 A;  2DJG B;  2PNS A;  4YYW A;  2G6D A;  3IEJ A;  5CVN B;  4CDD B;  4DMY A;  5JZE A;  2G8E A;  1EF7 A;  3F5V A;  2FT2 A;  3HD3 A;  7PCK A;  4WA6 A;  2YJB A;  4X6J A;  3P5W A;  2DCA A;  3S3R A;  1U5I A;  1IWD A;  1Q6K A;  1MEM A;  3H7D A;  4OVZ B;  1JQP A;  4YYS A;  2FO5 A;  1QXP A;  1ZCM A;  1F2B A;  3KX1 A;  3P5U A;  2AVW A;  1U9V A;  3BBA A;  5JH3 A;  2PRE A;  4P6E A;  3IMA A;  4R3D A;  3BPM A;  3C9E A; 
#chains in the Genus database with same CATH homology
 1BY8 A;  3ZUA A;  3OVZ A;  3DF0 A;  2R9C A;  4CDF B;  2DZY A;  1NB3 A;  1AEC A;  1W6F A;  1KFU L;  4QRG A;  4Q8H A;  2XU5 A;  4X6H A;  1PCI A;  4PP1 A;  3N3G A;  1CPJ A;  1QOL A;  1GX3 A;  3K24 A;  1PPD A;  3ERV A;  4BQV A;  4CZW A;  1BP4 A;  2BDL A;  4AXL A;  3PNR A;  1TLO A;  3H89 A;  4W4U A;  3U8E A;  2IPP B;  1GCB A;  2FYE A;  2JQG R;  4QH6 A;  2DC9 A;  4RY2 A;  6PAD A;  2DCC A;  1MS6 A;  1AU0 A;  4B55 A;  4I07 A;  2C0Y A;  2DC7 A;  1BGO A;  4HWY A;  3M99 A;  1AU4 A;  1EWL A;  2DCD A;  1QMY A;  3IHP A;  2E01 A;  1YAL A;  2AYN A;  2PAD A;  3KWB X;  1PIP A;  2E02 A;  3RVW A;  2P7U A;  2B1N A;  1CB5 A;  1PBH A;  2G8J A;  3QSD A;  3KW9 A;  2VFB A;  3LTW A;  1PPN A;  3H8C A;  2R9F A;  1W4T A;  3WXG A;  3H6S A;  1ITO A;  1E2T A;  3MHH A;  3CBK A;  2AU1 A;  3OIS A;  4YYV A;  3TNX A;  4X6I A;  3O0U A;  1ZIV A;  2P0R A;  3USV A;  1TL9 A;  2NQG A;  2O6X A;  1YVB A;  4KLB A;  2NQA A;  4QBB A;  2AIM A;  4ZUX U;  1NPZ A;  5PAD A;  1DF0 A;  3KSE A;  3MOR A;  3CH3 X;  2B1M A;  1YT7 A;  4C5P A;  2XU4 A;  4FJC A;  1AYU A;  4PP2 E;  1EWM A;  1GMY A;  2GFO A;  1PE6 A;  1PPO A;  1THE A;  1S4V A;  2AUX A;  5CHV A;  4AXM A;  3B79 A;  2DZZ A;  4BGF A;  1Y4H A;  2CIO A;  1F2C A;  5CVO B;  2NQI A;  2OUL A;  2OZ2 A;  2YJ8 A;  3IUT A;  3BWK A;  1X9Y A;  3O1G A;  2VHS A;  2G7Y A;  4NV7 A;  4N8W A;  1FH0 A;  2FQ9 A;  4DMX A;  4I04 A;  1EWP A;  1U9Q X;  1KHQ A;  5A24 A;  2F7D A;  3N4C A;  2FRA A;  3KKU A;  9PAP A;  2DC6 A;  1PXV A;  2Y6E A;  4BSQ A;  4FK5 A;  4I05 A;  3BCN A;  3KWZ A;  3V6C A;  2JQF R;  1K3B B;  1CS8 A;  1HUC B;  4OEL A;  2BSZ A;  2HH5 A;  2R9N A;  4W5C A;  1CSB B;  3IV2 A;  3I3T A;  2H7J A;  3AI8 A;  1ME3 A;  2YJ9 A;  1MHW A;  5J94 A;  2GHU A;  4N79 A;  1VSN A;  2VHF A;  3BOW A;  2FRQ A;  3HWN A;  2IBI A;  1NLJ A;  1NQC A;  1TU6 A;  1MIR A;  2R9O A;  4BPV A;  3P5V A;  3PW3 A;  1AU2 A;  2FUD A;  2R9M A;  2AS8 A;  2F1G A;  2E03 A;  3HHA A;  4K7C A;  3H8B A;  1XKG A;  1STF E;  1VJV A;  1KFX L;  3OF8 A;  1AIM A;  1NB5 A;  2DCB A;  5JA7 A;  2HXZ A;  2ARY A;  3GCB A;  4XR7 A;  3LFY A;  5K16 A;  1MDW A;  3HHI A;  3D6S A;  3BC3 A;  1Y08 A;  1F2A A;  4YYR A;  2E00 A;  3QJ3 A;  2OP3 A;  1AYW A;  1CQD A;  2YJC A;  1CV8 A;  4CDE B;  3OVX A;  4NV8 A;  2Y5B A;  3CBJ A;  2XU3 A;  4PAD A;  1DEU A;  4MZS A;  3P5X A;  4QRV A;  5EF4 A;  3PDF A;  4XUI A;  1EWO A;  1QDQ A;  1YK8 A;  3K9M A;  3I06 A;  2AUZ A;  1GLO A;  4GUZ A;  3QT4 A;  3LXS A;  2ATO A;  1SP4 B;  2NQD B;  2HD5 A;  2BDZ A;  1CJL A;  4PI3 A;  4N4Z A;  3RVV A;  1A6R A;  3NHE A;  2WBF X;  1PAD A;  4P6G A;  2ACT A;  3K8U A;  2P86 A;  4W5B A;  3MTN A;  3OF9 A;  8PCH A;  1GEC E;  1U9X A;  4BS5 A;  3RVX A;  1ME4 A;  1F29 A;  1KHP A;  4Q8G A;  4FIP A;  4YVA A;  1MEG A;  4QRX A;  4YYU A;  1ATK A;  2CB5 A;  1SNK A;  1POP A;  2AYO A;  1NL6 A;  3N3K A;  5FPW A;  5EGW A;  2PBH A;  3D9W A;  1BQI A;  1KXR A;  1U9W A;  1ICF A;  4MZO A;  1AYV A;  3BPF A;  3KFQ A;  4YV8 A;  3IOQ A;  4MSX A;  3PBH A;  3CH2 X;  1PPP A;  3WXF A;  1O0E A;  4G54 A;  5F02 A;  2DJF B;  2R6N A;  1CVZ A;  1M6D A;  4OEM A;  2DC8 A;  2YJ2 A;  2HHN A;  3WXE A;  2FTD A;  1YK7 A;  4CDC B;  4YYQ A;  2VFC A;  4BS6 A;  3V6E A;  1W5R A;  5CVM A;  3E1Z B;  3S3Q A;  3MHS A;  1CTE A;  5CHT A;  2XU1 A;  1AU3 A;  3F75 A;  2DJG B;  2PNS A;  4YYW A;  2G6D A;  3IEJ A;  5CVN B;  4CDD B;  4DMY A;  2G8E A;  1EF7 A;  3F5V A;  2FT2 A;  3HD3 A;  7PCK A;  4WA6 A;  2YJB A;  4X6J A;  3P5W A;  2DCA A;  3S3R A;  1U5I A;  1IWD A;  1Q6K A;  1MEM A;  3H7D A;  1JQP A;  4YYS A;  2FO5 A;  1QXP A;  1ZCM A;  1F2B A;  3KX1 A;  3P5U A;  2AVW A;  1U9V A;  5JH3 A;  2PRE A;  4P6E A;  3IMA A;  3BPM A;  3C9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...