2ATOA

Crystal structure of human cathepsin k in complex with myocrisin
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title Effects of disease-modifying anti-rheumatic drugs (DMARDs) on the activities of rheumatoid arthritis-associated cathepsins K and S.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 65
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2005-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2atoA00
2ATOA 3CBJA 1BGOA 3ERVA 2BDLA 3KWBX 3MTNA 2YJ2A 1NQCA 1O0EA 3D6SA 1U9XA 1Q6KA 1POPA 6PADA 2VHFA 3AI8A 1XKGA 1BQIA 2P7UA 1GLOA 4Q8GA 1AYUA 4I07A 4CZWA 1U9QX 2PADA 2DJGB 4Q8HA 4KLBA 4QBBA 1VSNA 2R9FA 1MEMA 2AYNA 2GHUA 3OF9A 2AIMA 1TL9A 1STFE 1QXPA 3IV2A 4YV8A 2YJ8A 3I3TA 3N3KA 4YYQA 3U8EA 2ACTA 4XR7A 1X9YA 1M6DA 2HXZA 1AU2A 3GCBA 3MHSA 3RVWA 4X6IA 2FRQA 1YK8A 3QJ3A 4FIPA 2R9NA 2AYOA 3K8UA 5CVMA 4CDFB 3F75A 1ZCMA 2IPPB 2AUXA 3CH2X 1ATKA 1MEGA 2CB5A 1CTEA 4CDEB 3WXGA 1ICFA 1CPJA 1PPNA 3HWNA 2DCCA 2P86A 3RVVA 3B79A 4DMYA 2OZ2A 3LFYA 3TNXA 8PCHA 2E03A 3IMAA 3O1GA 3M99A 1AYWA 4YYRA 3OVZA 3DF0A 1YK7A 1AECA 4HWYA 1THEA 1SP4B 1EWOA 2FTDA 1GCBA 4YYUA 1K3BB 3KX1A 4I04A 2DC9A 1CB5A 4BPVA 2G8JA 1ME3A 4G54A 4MSXA 5JH3A 5J94A 2DZZA 4MZSA 1DF0A 3OVXA 3BPFA 2GFOA 2HHNA 1YVBA 2R6NA 4AXMA 2OULA 5CHVA 1NL6A 4N79A 4PP2E 1AYVA 1BP4A 5CVNB 3P5WA 2AS8A 4OEMA 3USVA 3S3RA 2PNSA 1VJVA 4FK5A 1CV8A 5JA7A 4YYSA 4QRGA 2IBIA 4K7CA 4X6JA 3BOWA 3H6SA 2FT2A 1EWLA 2R9MA 3ZUAA 3E1ZB 4BSQA 1KFUL 1F2BA 1PIPA 3F5VA 3MHHA 5K16A 3CBKA 2G8EA 4MZOA 2B1NA 2XU5A 5EF4A 2P0RA 1MIRA 7PCKA 4CDDB 2VHSA 4QRVA 1CVZA 1AU0A 4YYVA 4XUIA 3K9MA 3QSDA 4OELA 4YYWA 2XU1A 2H7JA 3BWKA 2OP3A 1F2CA 2NQDB 2FUDA 2FQ9A 1HUCB 4BQVA 1NPZA 2E01A 2DCBA 2XU4A 2O6XA 1JQPA 1PXVA 5A24A 1F29A 2HD5A 2DC6A 4N4ZA 4I05A 1NB5A 1DEUA 2PREA 3HHAA 3MORA 2G7YA 1YT7A 4RY2A 1FH0A 1GMYA 1PPPA 2DCAA 1CJLA 2B1MA 3I06A 2NQAA 3PBHA 1ZIVA 3IEJA 4P6EA 3NHEA 3IHPA 2CIOA 4ZUXU 2R9OA 3PDFA 2Y6EA 1PPOA 3K24A 2R9CA 1PPDA 2DCDA 2DJFB 3S3QA 4YVAA 2DC8A 4QRXA 5FPWA 5CVOB 3CH3X 1CQDA 2AVWA 2XU3A 3H7DA 1KHQA 3KW9A 1TU6A 1U5IA 2E02A 3P5XA 1CSBB 3BPMA 4PADA 3V6CA 2G6DA 4WA6A 1AIMA 3IUTA 2JQFR 2ARYA 3H8CA 4QH6A 1ITOA 1AU3A 1U9WA 4FJCA 1BY8A 3P5VA 4N8WA 2F7DA 1QDQA 3KFQA 1KHPA 3N4CA 3H8BA 2YJ9A 4BS6A 2FYEA 1ME4A 3PW3A 5EGWA 3WXFA 1NLJA 1U9VA 1MS6A 2Y5BA 3BCNA 1GECE 3KSEA 2FRAA 1QMYA 1Y4HA 4CDCB 5F02A 1CS8A 1YALA 1KFXL 1PE6A 4W4UA 3PNRA 4BS5A 2YJBA 4AXLA 4DMXA 3BC3A 2FO5A 2WBFX 2YJCA 1F2AA 2E00A 4PI3A 3N3GA 3HHIA 3WXEA 1TLOA 1IWDA 1MHWA 2HH5A 2AU1A 4W5BA 1MDWA 5PADA 9PAPA 3LXSA 2NQGA 2F1GA 2NQIA 4PP1A 3RVXA 1PADA 3H89A 2JQGR 1PBHA 1QOLA 1Y08A 2PBHA 3O0UA 1A6RA 1EWPA 3KWZA 1AU4A 1NB3A 3OF8A 1EWMA 4P6GA 1PCIA 5CHTA 4W5CA 3P5UA 3OISA 2C0YA 2DC7A 2AUZA 2BDZA 3IOQA 3HD3A 1EF7A 1SNKA 1S4VA 1KXRA 3KKUA 3C9EA 4X6HA 3QT4A 2DZYA 3V6EA
chains in the Genus database with same CATH superfamily
2ATOA 3CBJA 1BGOA 4BOSA 3ERVA 2BDLA 3KWBX 2BTWB 3MTNA 2YJ2A 1NQCA 1O0EA 3D6SA 1U9XA 1Q6KA 1POPA 6PADA 2VHFA 3AI8A 1XKGA 1BQIA 2P7UA 1GLOA 4Q8GA 1AYUA 4A5UA 4I07A 4CZWA 1U9QX 2PADA 2DJGB 4Q8HA 4KLBA 4QBBA 1VSNA 4HXDB 2R9FA 1MEMA 2AYNA 2GHUA 3OF9A 1YZBA 3O65A 2AIMA 1TL9A 1STFE 1QXPA 3IV2A 4YV8A 2YJ8A 3I3TA 3N3KA 4YYQA 3U8EA 2JTCA 2ACTA 4D8EA 4XR7A 1X9YA 1M6DA 2HXZA 3MTVA 1AU2A 3GCBA 3MHSA 3RVWA 4X6IA 2FRQA 1YK8A 3QJ3A 4ZTBA 4FIPA 2R9NA 2AYOA 3K8UA 5CVMA 4CDFB 4OVZA 3F75A 1ZCMA 2IPPB 2AUXA 3CH2X 1UKFA 1ATKA 1MEGA 2CB5A 1CTEA 4CDEB 3WXGA 1ICFA 1CPJA 1PPNA 3HWNA 2DCCA 2P86A 3RVVA 3PRPA 3B79A 3B21A 4DMYA 2OZ2A 3LFYA 3TNXA 8PCHA 2E03A 3IMAA 3O1GA 3M99A 1AYWA 3E9SA 4IP3A 4YYRA 3OVZA 3DF0A 1YK7A 1AECA 4HWYA 1THEA 3BB7A 1SP4B 1EWOA 2FTDA 1GCBA 4YYUA 1K3BB 3KX1A 4I04A 2DC9A 1CB5A 4BPVA 2G8JA 1ME3A 4G54A 3PSEA 4MSXA 5JH3A 5J94A 2DZZA 4MZSA 1DF0A 3OVXA 3BPFA 2GFOA 2HHNA 1YVBA 2R6NA 4AXMA 2OULA 5CHVA 4BOPA 1NL6A 4N79A 4PP2E 4GUAA 1AYVA 1BP4A 5CVNB 3P5WA 2AS8A 4OEMA 3USVA 3S3RA 4D8BA 2PNSA 1VJVA 4FK5A 2BTWA 1CV8A 5JA7A 4YYSA 4QRGA 4BOUA 2IBIA 4K7CA 4X6JA 3BOWA 3H6SA 2FT2A 1EWLA 2R9MA 3ZUAA 3E1ZB 4REZA 2J7QA 4BSQA 1KFUL 1F2BA 1PIPA 3F5VA 3MHHA 5K16A 3CBKA 2G8EA 4M0WA 4MZOA 4OVZB 2B1NA 2XU5A 4RNAA 1DKIA 2P0RA 5EF4A 1MIRA 7PCKA 4CDDB 2FE8A 5KO3A 2VHSA 4QRVA 1CVZA 1AU0A 4YYVA 4XUIA 4MM3B 3K9MA 3QSDA 4OELA 3PHXA 4YYWA 2XU1A 2H7JA 4WURA 3BWKA 3PHUA 2OP3A 4P16A 4PT5A 1F2CA 2NQDB 2FUDA 2FQ9A 1HUCB 4BQVA 1NPZA 2E01A 2DCBA 2XU4A 2O6XA 1JQPA 1PXVA 5A24A 1F29A 5JZEA 2HD5A 3BY4A 3W31A 2DC6A 4N4ZA 4I05A 3ZNHA 3TRKA 4MI7A 1NB5A 1DEUA 4RKXA 3C0RA 2PREA 3HHAA 3MORA 2G7YA 1YT7A 2J7QC 1FH0A 4RY2A 1GMYA 1PPPA 2DCAA 1CJLA 2B1MA 3I06A 2NQAA 3PBHA 1ZIVA 3IEJA 4P6EA 3NHEA 3RNVA 3IHPA 2CIOA 4RF1A 4ZUXU 2R9OA 3PDFA 2Y6EA 1PPOA 3MJ5A 3K24A 2R9CA 4XZXA 1PPDA 2DCDA 2DJFB 3S3QA 4YVAA 2DC8A 4QRXA 5FPWA 5CVOB 3CH3X 5EZSA 1CQDA 2AVWA 2XU3A 3H7DA 1KHQA 3PHWA 3KW9A 1TU6A 1U5IA 4R3DA 2E02A 3P5XA 1CSBB 4BOZA 3BPMA 4PADA 3V6CA 2G6DA 4WA6A 1AIMA 3IUTA 2UZJA 1PVJA 2JQFR 3TMPA 2ARYA 3H8CA 2DOSA 3PRMA 4QH6A 4BOQA 1ITOA 1AU3A 1U9WA 2AGAA 4FJCA 1BY8A 3P5VA 4N8WA 2F7DA 1QDQA 3KFQA 1KHPA 3N4CA 3H8BA 2YJ9A 4OW0A 4BS6A 2FYEA 1ME4A 3PT2A 3PW3A 5EGWA 3WXFA 1NLJA 3OQCA 1U9VA 1MS6A 2Y5BA 3BCNA 1GECE 3KSEA 2FRAA 1QMYA 1Y4HA 4CDCB 5F02A 1CS8A 3MP2A 2BU3A 5EZQA 1YALA 1KFXL 1PE6A 4W4UA 3PNRA 4BS5A 2YJBA 4AXLA 4DMXA 3BC3A 2FO5A 2WBFX 2YJCA 1F2AA 3W30A 2E00A 4PI3A 3N3GA 3HHIA 3WXEA 1TLOA 1IWDA 1MHWA 2HH5A 2AU1A 4W5BA 1MDWA 5PADA 9PAPA 2JRIA 3LXSA 2NQGA 2F1GA 2NQIA 4PP1A 5E6JA 3RVXA 1PADA 3H89A 2JQGR 1PBHA 1QOLA 2HWKA 4D8IA 2Z84A 1Y08A 2PBHA 3IFUA 3O0UA 1A6RA 1EWPA 3KWZA 1AU4A 1NB3A 3OF8A 1EWMA 4P6GA 1PCIA 4IUMA 5CHTA 4W5CA 3P5UA 3OISA 2C0YA 2DC7A 2AUZA 2BDZA 3IOQA 3HD3A 1EF7A 1SNKA 1S4VA 1KXRA 3KKUA 3C9EA 3BBAA 4X6HA 3QT4A 2DZYA 3V6EA 4RF0A
chains in the Genus database with same CATH topology
2ATOA 3CBJA 1BGOA 3ERVA 2BDLA 3KWBX 4BGFA 3MTNA 2YJ2A 1NQCA 1O0EA 3D6SA 1U9XA 1Q6KA 1POPA 6PADA 2VHFA 3AI8A 1XKGA 1BQIA 2P7UA 1GLOA 4Q8GA 1AYUA 4I07A 4CZWA 1U9QX 2PADA 2DJGB 4Q8HA 4KLBA 4QBBA 1VSNA 2R9FA 1MEMA 2AYNA 2GHUA 3OF9A 2AIMA 1TL9A 1STFE 1QXPA 3IV2A 4B55A 4YV8A 2YJ8A 3I3TA 3N3KA 4YYQA 3U8EA 2ACTA 4XR7A 1X9YA 2VFBA 1M6DA 2HXZA 1AU2A 3GCBA 3MHSA 3RVWA 4X6IA 2FRQA 1YK8A 3QJ3A 4FIPA 2R9NA 2AYOA 3K8UA 5CVMA 4CDFB 3F75A 1ZCMA 2IPPB 2AUXA 3CH2X 1ATKA 1MEGA 2CB5A 1CTEA 4CDEB 3WXGA 1ICFA 1CPJA 1PPNA 3HWNA 2DCCA 2P86A 3RVVA 3B79A 4DMYA 2OZ2A 3LFYA 3TNXA 8PCHA 2E03A 3IMAA 3O1GA 3M99A 1AYWA 4YYRA 3OVZA 3DF0A 1YK7A 1AECA 4HWYA 1THEA 1SP4B 1EWOA 2FTDA 1GCBA 4YYUA 4GUZA 1K3BB 3KX1A 4I04A 2DC9A 1CB5A 4BPVA 2G8JA 1ME3A 4G54A 4MSXA 5JH3A 5J94A 3LTWA 2DZZA 4MZSA 1DF0A 3OVXA 3BPFA 2GFOA 2HHNA 1YVBA 2R6NA 4AXMA 2OULA 5CHVA 1NL6A 4N79A 4PP2E 1AYVA 1BP4A 5CVNB 3P5WA 2AS8A 4OEMA 3USVA 3S3RA 2PNSA 1W5RA 1VJVA 4FK5A 1CV8A 5JA7A 4YYSA 4QRGA 2IBIA 4K7CA 4X6JA 3BOWA 3H6SA 2FT2A 1EWLA 2R9MA 3ZUAA 3E1ZB 4BSQA 1KFUL 1F2BA 1PIPA 3F5VA 3MHHA 5K16A 3CBKA 2G8EA 4MZOA 2B1NA 2XU5A 5EF4A 2P0RA 1MIRA 7PCKA 4CDDB 2VHSA 4QRVA 1CVZA 1AU0A 4YYVA 4XUIA 3K9MA 3QSDA 4OELA 4YYWA 2XU1A 2H7JA 3BWKA 2OP3A 1F2CA 2NQDB 2FUDA 2FQ9A 1HUCB 4BQVA 1NPZA 2E01A 2DCBA 2XU4A 2O6XA 1JQPA 1PXVA 5A24A 1F29A 2HD5A 4NV8A 2DC6A 4N4ZA 4I05A 1NB5A 1DEUA 2PREA 3HHAA 3MORA 2G7YA 2BSZA 1YT7A 4RY2A 1FH0A 4NV7A 1GMYA 1PPPA 2DCAA 1CJLA 2B1MA 3I06A 1W6FA 2NQAA 3PBHA 1ZIVA 3IEJA 4P6EA 3NHEA 3IHPA 2CIOA 4ZUXU 2R9OA 3PDFA 2Y6EA 1PPOA 3K24A 2R9CA 1PPDA 2DCDA 2DJFB 3S3QA 4YVAA 2DC8A 4QRXA 5FPWA 5CVOB 3CH3X 1CQDA 2AVWA 1E2TA 2XU3A 3H7DA 1KHQA 3KW9A 1TU6A 1U5IA 2E02A 3P5XA 1CSBB 3BPMA 4PADA 3V6CA 2G6DA 4WA6A 1AIMA 3IUTA 2JQFR 2ARYA 3H8CA 4QH6A 2VFCA 1GX3A 4C5PA 1ITOA 1AU3A 1U9WA 4FJCA 1BY8A 3P5VA 4N8WA 1W4TA 2F7DA 1QDQA 3KFQA 1KHPA 3N4CA 3H8BA 2YJ9A 4BS6A 2FYEA 1ME4A 3PW3A 5EGWA 3WXFA 1NLJA 1U9VA 1MS6A 2Y5BA 3BCNA 1GECE 3KSEA 2FRAA 1QMYA 1Y4HA 4CDCB 5F02A 1CS8A 1YALA 1KFXL 1PE6A 4W4UA 3PNRA 4BS5A 2YJBA 4AXLA 4DMXA 3BC3A 2FO5A 2WBFX 2YJCA 1F2AA 2E00A 4PI3A 3N3GA 3HHIA 3WXEA 1TLOA 1IWDA 1MHWA 2HH5A 2AU1A 3D9WA 4W5BA 1MDWA 5PADA 9PAPA 3LXSA 2NQGA 2F1GA 2NQIA 4PP1A 3RVXA 1PADA 3H89A 2JQGR 1PBHA 1QOLA 1Y08A 2PBHA 3O0UA 1A6RA 1EWPA 3KWZA 1AU4A 1NB3A 3OF8A 1EWMA 4P6GA 1PCIA 5CHTA 4W5CA 3P5UA 3OISA 2C0YA 2DC7A 2AUZA 2BDZA 3IOQA 3HD3A 1EF7A 1SNKA 1S4VA 1KXRA 3KKUA 3C9EA 4X6HA 3QT4A 2DZYA 3V6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ATO A;  3CBJ A;  1BGO A;  3ERV A;  2BDL A;  3KWB X;  3MTN A;  2YJ2 A;  1NQC A;  1O0E A;  3D6S A;  1U9X A;  1Q6K A;  1POP A;  6PAD A;  2VHF A;  3AI8 A;  1XKG A;  1BQI A;  2P7U A;  1GLO A;  4Q8G A;  1AYU A;  4I07 A;  4CZW A;  1U9Q X;  2PAD A;  2DJG B;  4Q8H A;  4KLB A;  4QBB A;  1VSN A;  2R9F A;  1MEM A;  2AYN A;  2GHU A;  3OF9 A;  2AIM A;  1TL9 A;  1STF E;  1QXP A;  3IV2 A;  4YV8 A;  2YJ8 A;  3I3T A;  3N3K A;  4YYQ A;  3U8E A;  2ACT A;  4XR7 A;  1X9Y A;  1M6D A;  2HXZ A;  1AU2 A;  3GCB A;  3MHS A;  3RVW A;  4X6I A;  2FRQ A;  1YK8 A;  3QJ3 A;  4FIP A;  2R9N A;  2AYO A;  3K8U A;  5CVM A;  4CDF B;  3F75 A;  1ZCM A;  2IPP B;  2AUX A;  3CH2 X;  1ATK A;  1MEG A;  2CB5 A;  1CTE A;  4CDE B;  3WXG A;  1ICF A;  1CPJ A;  1PPN A;  3HWN A;  2DCC A;  2P86 A;  3RVV A;  3B79 A;  4DMY A;  2OZ2 A;  3LFY A;  3TNX A;  8PCH A;  2E03 A;  3IMA A;  3O1G A;  3M99 A;  1AYW A;  4YYR A;  3OVZ A;  3DF0 A;  1YK7 A;  1AEC A;  4HWY A;  1THE A;  1SP4 B;  1EWO A;  2FTD A;  1GCB A;  4YYU A;  1K3B B;  3KX1 A;  4I04 A;  2DC9 A;  1CB5 A;  4BPV A;  2G8J A;  1ME3 A;  4G54 A;  4MSX A;  5JH3 A;  5J94 A;  2DZZ A;  4MZS A;  1DF0 A;  3OVX A;  3BPF A;  2GFO A;  2HHN A;  1YVB A;  2R6N A;  4AXM A;  2OUL A;  5CHV A;  1NL6 A;  4N79 A;  4PP2 E;  1AYV A;  1BP4 A;  5CVN B;  3P5W A;  2AS8 A;  4OEM A;  3USV A;  3S3R A;  2PNS A;  1VJV A;  4FK5 A;  1CV8 A;  5JA7 A;  4YYS A;  4QRG A;  2IBI A;  4K7C A;  4X6J A;  3BOW A;  3H6S A;  2FT2 A;  1EWL A;  2R9M A;  3ZUA A;  3E1Z B;  4BSQ A;  1KFU L;  1F2B A;  1PIP A;  3F5V A;  3MHH A;  5K16 A;  3CBK A;  2G8E A;  4MZO A;  2B1N A;  2XU5 A;  5EF4 A;  2P0R A;  1MIR A;  7PCK A;  4CDD B;  2VHS A;  4QRV A;  1CVZ A;  1AU0 A;  4YYV A;  4XUI A;  3K9M A;  3QSD A;  4OEL A;  4YYW A;  2XU1 A;  2H7J A;  3BWK A;  2OP3 A;  1F2C A;  2NQD B;  2FUD A;  2FQ9 A;  1HUC B;  4BQV A;  1NPZ A;  2E01 A;  2DCB A;  2XU4 A;  2O6X A;  1JQP A;  1PXV A;  5A24 A;  1F29 A;  2HD5 A;  2DC6 A;  4N4Z A;  4I05 A;  1NB5 A;  1DEU A;  2PRE A;  3HHA A;  3MOR A;  2G7Y A;  1YT7 A;  4RY2 A;  1FH0 A;  1GMY A;  1PPP A;  2DCA A;  1CJL A;  2B1M A;  3I06 A;  2NQA A;  3PBH A;  1ZIV A;  3IEJ A;  4P6E A;  3NHE A;  3IHP A;  2CIO A;  4ZUX U;  2R9O A;  3PDF A;  2Y6E A;  1PPO A;  3K24 A;  2R9C A;  1PPD A;  2DCD A;  2DJF B;  3S3Q A;  4YVA A;  2DC8 A;  4QRX A;  5FPW A;  5CVO B;  3CH3 X;  1CQD A;  2AVW A;  2XU3 A;  3H7D A;  1KHQ A;  3KW9 A;  1TU6 A;  1U5I A;  2E02 A;  3P5X A;  1CSB B;  3BPM A;  4PAD A;  3V6C A;  2G6D A;  4WA6 A;  1AIM A;  3IUT A;  2JQF R;  2ARY A;  3H8C A;  4QH6 A;  1ITO A;  1AU3 A;  1U9W A;  4FJC A;  1BY8 A;  3P5V A;  4N8W A;  2F7D A;  1QDQ A;  3KFQ A;  1KHP A;  3N4C A;  3H8B A;  2YJ9 A;  4BS6 A;  2FYE A;  1ME4 A;  3PW3 A;  5EGW A;  3WXF A;  1NLJ A;  1U9V A;  1MS6 A;  2Y5B A;  3BCN A;  1GEC E;  3KSE A;  2FRA A;  1QMY A;  1Y4H A;  4CDC B;  5F02 A;  1CS8 A;  1YAL A;  1KFX L;  1PE6 A;  4W4U A;  3PNR A;  4BS5 A;  2YJB A;  4AXL A;  4DMX A;  3BC3 A;  2FO5 A;  2WBF X;  2YJC A;  1F2A A;  2E00 A;  4PI3 A;  3N3G A;  3HHI A;  3WXE A;  1TLO A;  1IWD A;  1MHW A;  2HH5 A;  2AU1 A;  4W5B A;  1MDW A;  5PAD A;  9PAP A;  3LXS A;  2NQG A;  2F1G A;  2NQI A;  4PP1 A;  3RVX A;  1PAD A;  3H89 A;  2JQG R;  1PBH A;  1QOL A;  1Y08 A;  2PBH A;  3O0U A;  1A6R A;  1EWP A;  3KWZ A;  1AU4 A;  1NB3 A;  3OF8 A;  1EWM A;  4P6G A;  1PCI A;  5CHT A;  4W5C A;  3P5U A;  3OIS A;  2C0Y A;  2DC7 A;  2AUZ A;  2BDZ A;  3IOQ A;  3HD3 A;  1EF7 A;  1SNK A;  1S4V A;  1KXR A;  3KKU A;  3C9E A;  4X6H A;  3QT4 A;  2DZY A;  3V6E A; 
#chains in the Genus database with same CATH topology
 2ATO A;  3CBJ A;  1BGO A;  4BOS A;  3ERV A;  2BDL A;  3KWB X;  2BTW B;  3MTN A;  2YJ2 A;  1NQC A;  1O0E A;  3D6S A;  1U9X A;  1Q6K A;  1POP A;  6PAD A;  2VHF A;  3AI8 A;  1XKG A;  1BQI A;  2P7U A;  1GLO A;  4Q8G A;  1AYU A;  4A5U A;  4I07 A;  4CZW A;  1U9Q X;  2PAD A;  2DJG B;  4Q8H A;  4KLB A;  4QBB A;  1VSN A;  4HXD B;  2R9F A;  1MEM A;  2AYN A;  2GHU A;  3OF9 A;  1YZB A;  3O65 A;  2AIM A;  1TL9 A;  1STF E;  1QXP A;  3IV2 A;  4YV8 A;  2YJ8 A;  3I3T A;  3N3K A;  4YYQ A;  3U8E A;  2JTC A;  2ACT A;  4D8E A;  4XR7 A;  1X9Y A;  1M6D A;  2HXZ A;  3MTV A;  1AU2 A;  3GCB A;  3MHS A;  3RVW A;  4X6I A;  2FRQ A;  1YK8 A;  3QJ3 A;  4ZTB A;  4FIP A;  2R9N A;  2AYO A;  3K8U A;  5CVM A;  4CDF B;  4OVZ A;  3F75 A;  1ZCM A;  2IPP B;  2AUX A;  3CH2 X;  1UKF A;  1ATK A;  1MEG A;  2CB5 A;  1CTE A;  4CDE B;  3WXG A;  1ICF A;  1CPJ A;  1PPN A;  3HWN A;  2DCC A;  2P86 A;  3RVV A;  3PRP A;  3B79 A;  3B21 A;  4DMY A;  2OZ2 A;  3LFY A;  3TNX A;  8PCH A;  2E03 A;  3IMA A;  3O1G A;  3M99 A;  1AYW A;  3E9S A;  4IP3 A;  4YYR A;  3OVZ A;  3DF0 A;  1YK7 A;  1AEC A;  4HWY A;  1THE A;  3BB7 A;  1SP4 B;  1EWO A;  2FTD A;  1GCB A;  4YYU A;  1K3B B;  3KX1 A;  4I04 A;  2DC9 A;  1CB5 A;  4BPV A;  2G8J A;  1ME3 A;  4G54 A;  3PSE A;  4MSX A;  5JH3 A;  5J94 A;  2DZZ A;  4MZS A;  1DF0 A;  3OVX A;  3BPF A;  2GFO A;  2HHN A;  1YVB A;  2R6N A;  4AXM A;  2OUL A;  5CHV A;  4BOP A;  1NL6 A;  4N79 A;  4PP2 E;  4GUA A;  1AYV A;  1BP4 A;  5CVN B;  3P5W A;  2AS8 A;  4OEM A;  3USV A;  3S3R A;  4D8B A;  2PNS A;  1VJV A;  4FK5 A;  2BTW A;  1CV8 A;  5JA7 A;  4YYS A;  4QRG A;  4BOU A;  2IBI A;  4K7C A;  4X6J A;  3BOW A;  3H6S A;  2FT2 A;  1EWL A;  2R9M A;  3ZUA A;  3E1Z B;  4REZ A;  2J7Q A;  4BSQ A;  1KFU L;  1F2B A;  1PIP A;  3F5V A;  3MHH A;  5K16 A;  3CBK A;  2G8E A;  4M0W A;  4MZO A;  4OVZ B;  2B1N A;  2XU5 A;  4RNA A;  1DKI A;  2P0R A;  5EF4 A;  1MIR A;  7PCK A;  4CDD B;  2FE8 A;  5KO3 A;  2VHS A;  4QRV A;  1CVZ A;  1AU0 A;  4YYV A;  4XUI A;  4MM3 B;  3K9M A;  3QSD A;  4OEL A;  3PHX A;  4YYW A;  2XU1 A;  2H7J A;  4WUR A;  3BWK A;  3PHU A;  2OP3 A;  4P16 A;  4PT5 A;  1F2C A;  2NQD B;  2FUD A;  2FQ9 A;  1HUC B;  4BQV A;  1NPZ A;  2E01 A;  2DCB A;  2XU4 A;  2O6X A;  1JQP A;  1PXV A;  5A24 A;  1F29 A;  5JZE A;  2HD5 A;  3BY4 A;  3W31 A;  2DC6 A;  4N4Z A;  4I05 A;  3ZNH A;  3TRK A;  4MI7 A;  1NB5 A;  1DEU A;  4RKX A;  3C0R A;  2PRE A;  3HHA A;  3MOR A;  2G7Y A;  1YT7 A;  2J7Q C;  1FH0 A;  4RY2 A;  1GMY A;  1PPP A;  2DCA A;  1CJL A;  2B1M A;  3I06 A;  2NQA A;  3PBH A;  1ZIV A;  3IEJ A;  4P6E A;  3NHE A;  3RNV A;  3IHP A;  2CIO A;  4RF1 A;  4ZUX U;  2R9O A;  3PDF A;  2Y6E A;  1PPO A;  3MJ5 A;  3K24 A;  2R9C A;  4XZX A;  1PPD A;  2DCD A;  2DJF B;  3S3Q A;  4YVA A;  2DC8 A;  4QRX A;  5FPW A;  5CVO B;  3CH3 X;  5EZS A;  1CQD A;  2AVW A;  2XU3 A;  3H7D A;  1KHQ A;  3PHW A;  3KW9 A;  1TU6 A;  1U5I A;  4R3D A;  2E02 A;  3P5X A;  1CSB B;  4BOZ A;  3BPM A;  4PAD A;  3V6C A;  2G6D A;  4WA6 A;  1AIM A;  3IUT A;  2UZJ A;  1PVJ A;  2JQF R;  3TMP A;  2ARY A;  3H8C A;  2DOS A;  3PRM A;  4QH6 A;  4BOQ A;  1ITO A;  1AU3 A;  1U9W A;  2AGA A;  4FJC A;  1BY8 A;  3P5V A;  4N8W A;  2F7D A;  1QDQ A;  3KFQ A;  1KHP A;  3N4C A;  3H8B A;  2YJ9 A;  4OW0 A;  4BS6 A;  2FYE A;  1ME4 A;  3PT2 A;  3PW3 A;  5EGW A;  3WXF A;  1NLJ A;  3OQC A;  1U9V A;  1MS6 A;  2Y5B A;  3BCN A;  1GEC E;  3KSE A;  2FRA A;  1QMY A;  1Y4H A;  4CDC B;  5F02 A;  1CS8 A;  3MP2 A;  2BU3 A;  5EZQ A;  1YAL A;  1KFX L;  1PE6 A;  4W4U A;  3PNR A;  4BS5 A;  2YJB A;  4AXL A;  4DMX A;  3BC3 A;  2FO5 A;  2WBF X;  2YJC A;  1F2A A;  3W30 A;  2E00 A;  4PI3 A;  3N3G A;  3HHI A;  3WXE A;  1TLO A;  1IWD A;  1MHW A;  2HH5 A;  2AU1 A;  4W5B A;  1MDW A;  5PAD A;  9PAP A;  2JRI A;  3LXS A;  2NQG A;  2F1G A;  2NQI A;  4PP1 A;  5E6J A;  3RVX A;  1PAD A;  3H89 A;  2JQG R;  1PBH A;  1QOL A;  2HWK A;  4D8I A;  2Z84 A;  1Y08 A;  2PBH A;  3IFU A;  3O0U A;  1A6R A;  1EWP A;  3KWZ A;  1AU4 A;  1NB3 A;  3OF8 A;  1EWM A;  4P6G A;  1PCI A;  4IUM A;  5CHT A;  4W5C A;  3P5U A;  3OIS A;  2C0Y A;  2DC7 A;  2AUZ A;  2BDZ A;  3IOQ A;  3HD3 A;  1EF7 A;  1SNK A;  1S4V A;  1KXR A;  3KKU A;  3C9E A;  3BBA A;  4X6H A;  3QT4 A;  2DZY A;  3V6E A;  4RF0 A; 
#chains in the Genus database with same CATH homology
 2ATO A;  3CBJ A;  1BGO A;  3ERV A;  2BDL A;  3KWB X;  4BGF A;  3MTN A;  2YJ2 A;  1NQC A;  1O0E A;  3D6S A;  1U9X A;  1Q6K A;  1POP A;  6PAD A;  2VHF A;  3AI8 A;  1XKG A;  1BQI A;  2P7U A;  1GLO A;  4Q8G A;  1AYU A;  4I07 A;  4CZW A;  1U9Q X;  2PAD A;  2DJG B;  4Q8H A;  4KLB A;  4QBB A;  1VSN A;  2R9F A;  1MEM A;  2AYN A;  2GHU A;  3OF9 A;  2AIM A;  1TL9 A;  1STF E;  1QXP A;  3IV2 A;  4B55 A;  4YV8 A;  2YJ8 A;  3I3T A;  3N3K A;  4YYQ A;  3U8E A;  2ACT A;  4XR7 A;  1X9Y A;  2VFB A;  1M6D A;  2HXZ A;  1AU2 A;  3GCB A;  3MHS A;  3RVW A;  4X6I A;  2FRQ A;  1YK8 A;  3QJ3 A;  4FIP A;  2R9N A;  2AYO A;  3K8U A;  5CVM A;  4CDF B;  3F75 A;  1ZCM A;  2IPP B;  2AUX A;  3CH2 X;  1ATK A;  1MEG A;  2CB5 A;  1CTE A;  4CDE B;  3WXG A;  1ICF A;  1CPJ A;  1PPN A;  3HWN A;  2DCC A;  2P86 A;  3RVV A;  3B79 A;  4DMY A;  2OZ2 A;  3LFY A;  3TNX A;  8PCH A;  2E03 A;  3IMA A;  3O1G A;  3M99 A;  1AYW A;  4YYR A;  3OVZ A;  3DF0 A;  1YK7 A;  1AEC A;  4HWY A;  1THE A;  1SP4 B;  1EWO A;  2FTD A;  1GCB A;  4YYU A;  4GUZ A;  1K3B B;  3KX1 A;  4I04 A;  2DC9 A;  1CB5 A;  4BPV A;  2G8J A;  1ME3 A;  4G54 A;  4MSX A;  5JH3 A;  5J94 A;  3LTW A;  2DZZ A;  4MZS A;  1DF0 A;  3OVX A;  3BPF A;  2GFO A;  2HHN A;  1YVB A;  2R6N A;  4AXM A;  2OUL A;  5CHV A;  1NL6 A;  4N79 A;  4PP2 E;  1AYV A;  1BP4 A;  5CVN B;  3P5W A;  2AS8 A;  4OEM A;  3USV A;  3S3R A;  2PNS A;  1W5R A;  1VJV A;  4FK5 A;  1CV8 A;  5JA7 A;  4YYS A;  4QRG A;  2IBI A;  4K7C A;  4X6J A;  3BOW A;  3H6S A;  2FT2 A;  1EWL A;  2R9M A;  3ZUA A;  3E1Z B;  4BSQ A;  1KFU L;  1F2B A;  1PIP A;  3F5V A;  3MHH A;  5K16 A;  3CBK A;  2G8E A;  4MZO A;  2B1N A;  2XU5 A;  5EF4 A;  2P0R A;  1MIR A;  7PCK A;  4CDD B;  2VHS A;  4QRV A;  1CVZ A;  1AU0 A;  4YYV A;  4XUI A;  3K9M A;  3QSD A;  4OEL A;  4YYW A;  2XU1 A;  2H7J A;  3BWK A;  2OP3 A;  1F2C A;  2NQD B;  2FUD A;  2FQ9 A;  1HUC B;  4BQV A;  1NPZ A;  2E01 A;  2DCB A;  2XU4 A;  2O6X A;  1JQP A;  1PXV A;  5A24 A;  1F29 A;  2HD5 A;  4NV8 A;  2DC6 A;  4N4Z A;  4I05 A;  1NB5 A;  1DEU A;  2PRE A;  3HHA A;  3MOR A;  2G7Y A;  2BSZ A;  1YT7 A;  4RY2 A;  1FH0 A;  4NV7 A;  1GMY A;  1PPP A;  2DCA A;  1CJL A;  2B1M A;  3I06 A;  1W6F A;  2NQA A;  3PBH A;  1ZIV A;  3IEJ A;  4P6E A;  3NHE A;  3IHP A;  2CIO A;  4ZUX U;  2R9O A;  3PDF A;  2Y6E A;  1PPO A;  3K24 A;  2R9C A;  1PPD A;  2DCD A;  2DJF B;  3S3Q A;  4YVA A;  2DC8 A;  4QRX A;  5FPW A;  5CVO B;  3CH3 X;  1CQD A;  2AVW A;  1E2T A;  2XU3 A;  3H7D A;  1KHQ A;  3KW9 A;  1TU6 A;  1U5I A;  2E02 A;  3P5X A;  1CSB B;  3BPM A;  4PAD A;  3V6C A;  2G6D A;  4WA6 A;  1AIM A;  3IUT A;  2JQF R;  2ARY A;  3H8C A;  4QH6 A;  2VFC A;  1GX3 A;  4C5P A;  1ITO A;  1AU3 A;  1U9W A;  4FJC A;  1BY8 A;  3P5V A;  4N8W A;  1W4T A;  2F7D A;  1QDQ A;  3KFQ A;  1KHP A;  3N4C A;  3H8B A;  2YJ9 A;  4BS6 A;  2FYE A;  1ME4 A;  3PW3 A;  5EGW A;  3WXF A;  1NLJ A;  1U9V A;  1MS6 A;  2Y5B A;  3BCN A;  1GEC E;  3KSE A;  2FRA A;  1QMY A;  1Y4H A;  4CDC B;  5F02 A;  1CS8 A;  1YAL A;  1KFX L;  1PE6 A;  4W4U A;  3PNR A;  4BS5 A;  2YJB A;  4AXL A;  4DMX A;  3BC3 A;  2FO5 A;  2WBF X;  2YJC A;  1F2A A;  2E00 A;  4PI3 A;  3N3G A;  3HHI A;  3WXE A;  1TLO A;  1IWD A;  1MHW A;  2HH5 A;  2AU1 A;  3D9W A;  4W5B A;  1MDW A;  5PAD A;  9PAP A;  3LXS A;  2NQG A;  2F1G A;  2NQI A;  4PP1 A;  3RVX A;  1PAD A;  3H89 A;  2JQG R;  1PBH A;  1QOL A;  1Y08 A;  2PBH A;  3O0U A;  1A6R A;  1EWP A;  3KWZ A;  1AU4 A;  1NB3 A;  3OF8 A;  1EWM A;  4P6G A;  1PCI A;  5CHT A;  4W5C A;  3P5U A;  3OIS A;  2C0Y A;  2DC7 A;  2AUZ A;  2BDZ A;  3IOQ A;  3HD3 A;  1EF7 A;  1SNK A;  1S4V A;  1KXR A;  3KKU A;  3C9E A;  4X6H A;  3QT4 A;  2DZY A;  3V6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...