2ATOA

Crystal structure of human cathepsin k in complex with myocrisin
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effects of disease-modifying anti-rheumatic drugs (DMARDs) on the activities of rheumatoid arthritis-associated cathepsins K and S.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin K
total genus 65
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2005-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2atoA00
3P5XA 4BS6A 1ATKA 4DMYA 1EWOA 3IOQA 1YT7A 3BC3A 1EWPA 1ME3A 3I06A 4BS5A 3CH3X 2F1GA 2G8JA 4W5BA 4P6GA 1CPJA 2F7DA 2AUXA 5CHVA 2NQDB 2AU1A 2BDLA 1MS6A 3P5UA 1PIPA 2PBHA 5CVOB 1EWLA 2R9FA 2R9NA 3QT4A 2PADA 5PADA 4QH6A 2E01A 2XU4A 3B79A 3OVZA 4YYUA 1NB3A 3K9MA 3QSDA 3OF9A 3MORA 1ZCMA 2R9OA 3KWZA 1F2AA 1U9XA 2PNSA 4ZUXU 9PAPA 2C0YA 1MIRA 1QXPA 1PPPA 4Q8HA 1Q6KA 1QMYA 1SNKA 5F02A 4Q8GA 1MDWA 1KFUL 1XKGA 2ATOA 1SP4B 4QRGA 1GLOA 2ARYA 4PP1A 3S3QA 2VHSA 2ACTA 1CSBB 4P6EA 3C9EA 1ME4A 1HUCB 3RVWA 3K24A 2E00A 2AUZA 4MZOA 2E03A 1PADA 5FPWA 1PXVA 4I07A 5K16A 3WXEA 2P86A 2HXZA 3LFYA 3H7DA 4KLBA 4BPVA 5JH3A 2YJ9A 2FO5A 2IPPB 3P5WA 4YYSA 4CDEB 3BWKA 2PREA 3BPFA 3S3RA 1MHWA 3MHHA 1CJLA 2OP3A 2GHUA 1PBHA 2AIMA 3KKUA 7PCKA 2R6NA 4G54A 4X6IA 2G6DA 4I05A 3KX1A 3OISA 2FYEA 1NB5A 1BQIA 2G8EA 3PBHA 6PADA 3KSEA 1IWDA 3KWBX 1FH0A 3O1GA 2IBIA 2NQAA 1U9QX 1NL6A 2JQGR 3ERVA 1AYUA 1EWMA 2YJCA 1U9VA 4FJCA 2P0RA 1PPOA 3OF8A 3LXSA 5EGWA 1KHQA 2OULA 1QDQA 2YJ8A 1YVBA 4CDFB 3TNXA 2YJ2A 3NHEA 3CBKA 3QJ3A 1U9WA 3IEJA 2R9CA 3I3TA 1Y4HA 1NQCA 3CBJA 3PW3A 1PPNA 3M99A 3RVVA 1CB5A 1TU6A 3RVXA 3PDFA 3MHSA 4AXLA 3D6SA 1YK7A 4BQVA 1AU3A 4DMXA 1GMYA 2Y6EA 4PP2E 2BDZA 1CS8A 2HHNA 3N3GA 3U8EA 4W5CA 4CZWA 2XU5A 1F29A 4YYVA 3H8CA 3CH2X 1U5IA 2FRQA 2WBFX 1F2CA 1GCBA 1O0EA 2AYNA 4YYWA 4CDDB 3ZUAA 1NPZA 2R9MA 1EF7A 2FUDA 3V6CA 2NQIA 3O0UA 3WXFA 2VHFA 4N79A 3KFQA 4QRXA 3F5VA 2AS8A 3H6SA 5EF4A 1DEUA 1GECE 2GFOA 4MZSA 1KFXL 1A6RA 2O6XA 2DCAA 3E1ZB 4YYQA 3HWNA 3BCNA 2HD5A 1PPDA 1MEMA 4W4UA 3IV2A 1K3BB 2OZ2A 4HWYA 4XUIA 1AECA 2HH5A 3GCBA 1CVZA 1CV8A 3HD3A 4WA6A 1POPA 4N4ZA 4RY2A 5A24A 2CIOA 3F75A 1AIMA 4YYRA 3BOWA 4PI3A 3V6EA 4FIPA 4XR7A 4X6JA 2FT2A 2FRAA 1KXRA 2AVWA 3K8UA 4N8WA 4QRVA 5J94A 5CVMA 2P7UA 8PCHA 1S4VA 3KW9A 1MEGA 2YJBA 1Y08A 4YVAA 2XU3A 3H8BA 1YK8A 1F2BA 3MTNA 1PE6A 2NQGA 1THEA 3IHPA 1ITOA 2Y5BA 1VJVA 2DCCA 4MSXA 1VSNA 2H7JA 5JA7A 1TLOA 4QBBA 5CHTA 2FTDA 3BPMA 4X6HA 1ZIVA 1AU0A 3WXGA 4OEMA 1YALA 2DJGB 1AU4A 2FQ9A 3AI8A 1NLJA 2AYOA 4OELA 2CB5A 2JQFR 3DF0A 4AXMA 4CDCB 3P5VA 1BGOA 2DC8A 4PADA 3N3KA 1CTEA 1X9YA 3N4CA 4K7CA 2XU1A 1CQDA 2B1NA 1STFE 1ICFA 4BSQA 3PNRA 2DZZA 1JQPA 4YV8A 1QOLA 3HHIA 2G7YA 3HHAA 1TL9A 1AU2A 2DJFB 1BY8A 1KHPA 1M6DA 2B1MA 2E02A 3IMAA 2DC6A 1AYVA 2DC7A 1BP4A 3USVA 2DZYA 2DC9A 3H89A 2DCBA 3IUTA 4FK5A 1AYWA 1PCIA 1DF0A 4I04A 5CVNB 2DCDA 3OVXA
chains in the Genus database with same CATH superfamily
3P5XA 4BS6A 1ATKA 4DMYA 1EWOA 3IOQA 1YT7A 3BC3A 3C0RA 1EWPA 1ME3A 3I06A 4GUAA 4BS5A 3CH3X 2F1GA 2G8JA 4W5BA 4P6GA 1CPJA 2F7DA 2AUXA 5CHVA 2NQDB 2AU1A 2BDLA 3W31A 1MS6A 4REZA 3P5UA 1PIPA 2PBHA 5CVOB 1EWLA 2R9FA 2R9NA 3QT4A 2PADA 5PADA 4QH6A 2E01A 4BOSA 2XU4A 3B79A 3OVZA 4YYUA 1NB3A 3K9MA 3QSDA 3OF9A 3MORA 1ZCMA 2R9OA 3KWZA 1F2AA 1U9XA 2PNSA 4ZUXU 9PAPA 2C0YA 1MIRA 1QXPA 1PPPA 4Q8HA 1Q6KA 1QMYA 1SNKA 2J7QC 5F02A 4Q8GA 1MDWA 1KFUL 1XKGA 2ATOA 1SP4B 4QRGA 1GLOA 2ARYA 4PP1A 3S3QA 3MJ5A 2VHSA 2ACTA 1CSBB 4P6EA 3C9EA 1ME4A 1HUCB 3RVWA 3K24A 2E00A 2AUZA 4MZOA 2E03A 1PADA 5FPWA 1PXVA 5JZEA 3MTVA 4I07A 5K16A 3WXEA 2P86A 2HXZA 3PT2A 3LFYA 4BOPA 3H7DA 4KLBA 4BPVA 5JH3A 2YJ9A 2FO5A 2IPPB 3P5WA 4YYSA 4CDEB 3BWKA 2PREA 3BPFA 3S3RA 1MHWA 3MHHA 1CJLA 2OP3A 2GHUA 1PBHA 2AIMA 3KKUA 7PCKA 2R6NA 4G54A 4X6IA 3BBAA 2G6DA 3IFUA 4I05A 4OW0A 3KX1A 3OISA 2FYEA 1NB5A 1BQIA 2G8EA 3PBHA 6PADA 3KSEA 1IWDA 3KWBX 4BOZA 1FH0A 3O1GA 2UZJA 4MI7A 2IBIA 2NQAA 1U9QX 1NL6A 2JQGR 4D8IA 3ERVA 1AYUA 1EWMA 2YJCA 3BB7A 1PVJA 3O65A 1U9VA 2Z84A 4FJCA 2P0RA 1PPOA 3OF8A 3LXSA 5EGWA 1KHQA 4R3DA 2OULA 4D8EA 1QDQA 4PT5A 2YJ8A 2FE8A 3ZNHA 1YVBA 4CDFB 3TNXA 4WURA 2YJ2A 2DOSA 3NHEA 3CBKA 3QJ3A 1U9WA 3IEJA 2R9CA 3I3TA 1Y4HA 1NQCA 3CBJA 3W30A 3PW3A 1PPNA 3M99A 3RVVA 1CB5A 1TU6A 3RVXA 3PDFA 3MHSA 5EZSA 5EZQA 4AXLA 3D6SA 1YK7A 1UKFA 4BQVA 1AU3A 4DMXA 1GMYA 2Y6EA 4PP2E 2J7QA 2BDZA 3PHUA 1CS8A 2HHNA 3N3GA 3U8EA 4W5CA 4CZWA 2XU5A 1F29A 4YYVA 3H8CA 4M0WA 3CH2X 1U5IA 2FRQA 2WBFX 1F2CA 1GCBA 1O0EA 2AYNA 4YYWA 4CDDB 4RF0A 3ZUAA 1NPZA 4IUMA 2R9MA 1EF7A 2FUDA 4IP3A 3V6CA 2NQIA 2BU3A 3O0UA 3WXFA 2VHFA 4N79A 3KFQA 4QRXA 3F5VA 2AS8A 3H6SA 5EF4A 1DEUA 1GECE 3OQCA 2JRIA 2GFOA 4MZSA 1KFXL 1A6RA 2O6XA 2DCAA 3E1ZB 4YYQA 3HWNA 3BCNA 2HD5A 1PPDA 1MEMA 4W4UA 3IV2A 3TMPA 5E6JA 1K3BB 2OZ2A 3PRMA 4HWYA 4XUIA 1AECA 2HH5A 3GCBA 3B21A 4D8BA 4HXDB 3MP2A 1CVZA 4RNAA 1CV8A 4OVZB 3HD3A 4WA6A 1POPA 4N4ZA 4RY2A 5A24A 2CIOA 3PHXA 2BTWB 3F75A 1AIMA 4YYRA 3BOWA 4PI3A 3V6EA 4FIPA 4XR7A 4X6JA 2FT2A 2FRAA 1KXRA 2AVWA 3K8UA 4N8WA 4QRVA 2JTCA 5J94A 5CVMA 2P7UA 8PCHA 1S4VA 3KW9A 1MEGA 2YJBA 1Y08A 4YVAA 2XU3A 3H8BA 4XZXA 2BTWA 1YK8A 1F2BA 3MTNA 5KO3A 1PE6A 2NQGA 4RF1A 1THEA 3IHPA 1ITOA 4ZTBA 2Y5BA 1VJVA 4RKXA 2DCCA 4MSXA 2HWKA 1VSNA 2H7JA 5JA7A 1TLOA 4QBBA 5CHTA 4BOQA 2FTDA 3BPMA 4X6HA 1YZBA 3PSEA 1ZIVA 1AU0A 3WXGA 4OEMA 1YALA 2DJGB 1AU4A 4BOUA 2FQ9A 4P16A 3AI8A 1NLJA 2AYOA 4OELA 2CB5A 2JQFR 3DF0A 4AXMA 4CDCB 3P5VA 1BGOA 2DC8A 4PADA 3N3KA 1CTEA 1X9YA 3N4CA 4K7CA 4A5UA 2XU1A 1CQDA 3RNVA 2B1NA 4MM3B 1STFE 1ICFA 4BSQA 3PNRA 2DZZA 1JQPA 4YV8A 4OVZA 1QOLA 3HHIA 2G7YA 3BY4A 3HHAA 1TL9A 1AU2A 2DJFB 1BY8A 1KHPA 1M6DA 3E9SA 2B1MA 2E02A 3IMAA 2DC6A 3PRPA 1AYVA 2DC7A 1DKIA 1BP4A 3USVA 2DZYA 2DC9A 3H89A 2DCBA 3IUTA 4FK5A 2AGAA 1AYWA 1PCIA 3TRKA 1DF0A 4I04A 5CVNB 2DCDA 3PHWA 3OVXA
chains in the Genus database with same CATH topology
3P5XA 4BS6A 1ATKA 4DMYA 1EWOA 3IOQA 1YT7A 3BC3A 1EWPA 1ME3A 2VFBA 3I06A 4BS5A 3CH3X 2F1GA 2G8JA 4W5BA 4P6GA 1CPJA 2F7DA 2AUXA 5CHVA 2NQDB 2AU1A 2BDLA 1MS6A 3P5UA 1PIPA 2PBHA 5CVOB 1EWLA 2R9FA 2R9NA 3QT4A 2PADA 5PADA 4QH6A 2E01A 2XU4A 3B79A 3OVZA 4YYUA 1NB3A 3K9MA 3QSDA 3OF9A 3MORA 1ZCMA 2R9OA 3KWZA 1F2AA 1U9XA 2PNSA 4ZUXU 9PAPA 2C0YA 1MIRA 1QXPA 1PPPA 4Q8HA 1Q6KA 1QMYA 1SNKA 4GUZA 5F02A 4Q8GA 1MDWA 1KFUL 1XKGA 2ATOA 1SP4B 4QRGA 1GLOA 2ARYA 4PP1A 4C5PA 3S3QA 2VHSA 2ACTA 1CSBB 4P6EA 3C9EA 1ME4A 1HUCB 3RVWA 3K24A 2E00A 2AUZA 4MZOA 2E03A 1PADA 5FPWA 1PXVA 4I07A 5K16A 3WXEA 2P86A 2HXZA 3LFYA 3H7DA 4KLBA 4BPVA 5JH3A 2YJ9A 2FO5A 2IPPB 3P5WA 4YYSA 4CDEB 3BWKA 1W6FA 2PREA 3BPFA 3S3RA 1MHWA 3MHHA 1CJLA 2OP3A 2GHUA 1PBHA 2AIMA 3KKUA 7PCKA 2R6NA 4G54A 4X6IA 2G6DA 4I05A 3KX1A 3OISA 2FYEA 1NB5A 1BQIA 2G8EA 3PBHA 6PADA 3KSEA 1IWDA 3KWBX 4BGFA 1FH0A 3O1GA 1W5RA 2IBIA 2NQAA 1U9QX 1NL6A 2JQGR 3ERVA 1AYUA 1EWMA 2YJCA 1U9VA 4FJCA 2P0RA 2VFCA 1PPOA 3OF8A 3LXSA 5EGWA 1KHQA 2OULA 1QDQA 2YJ8A 1YVBA 4CDFB 3TNXA 2YJ2A 2BSZA 3NHEA 3CBKA 3QJ3A 1U9WA 3IEJA 2R9CA 3I3TA 1Y4HA 1NQCA 4B55A 3CBJA 1W4TA 3PW3A 1PPNA 3M99A 3RVVA 1CB5A 1TU6A 3RVXA 3PDFA 3MHSA 4AXLA 3D6SA 1YK7A 4BQVA 1AU3A 4DMXA 1GMYA 2Y6EA 4PP2E 2BDZA 1CS8A 2HHNA 3N3GA 3U8EA 4W5CA 4CZWA 2XU5A 1F29A 4YYVA 3H8CA 3LTWA 3CH2X 1U5IA 2FRQA 2WBFX 1F2CA 1GCBA 1O0EA 2AYNA 4YYWA 4CDDB 3ZUAA 1NPZA 2R9MA 1EF7A 2FUDA 3V6CA 2NQIA 3O0UA 3WXFA 2VHFA 4N79A 3KFQA 4QRXA 3F5VA 2AS8A 3H6SA 5EF4A 1DEUA 1GECE 2GFOA 4MZSA 1KFXL 1A6RA 2O6XA 2DCAA 3E1ZB 4YYQA 3D9WA 3HWNA 3BCNA 2HD5A 1PPDA 1MEMA 4W4UA 3IV2A 1K3BB 2OZ2A 4HWYA 4XUIA 1AECA 2HH5A 3GCBA 1CVZA 1CV8A 3HD3A 4WA6A 1POPA 4N4ZA 4RY2A 5A24A 2CIOA 3F75A 1AIMA 4YYRA 3BOWA 4PI3A 3V6EA 4FIPA 4XR7A 4X6JA 2FT2A 2FRAA 1KXRA 2AVWA 3K8UA 4N8WA 4QRVA 4NV7A 5J94A 5CVMA 2P7UA 8PCHA 1S4VA 3KW9A 1MEGA 2YJBA 1Y08A 4YVAA 2XU3A 3H8BA 1YK8A 1F2BA 3MTNA 1PE6A 2NQGA 1THEA 3IHPA 1ITOA 2Y5BA 1VJVA 1GX3A 2DCCA 4MSXA 1VSNA 2H7JA 5JA7A 1TLOA 4QBBA 5CHTA 2FTDA 3BPMA 4X6HA 1ZIVA 4NV8A 1AU0A 3WXGA 4OEMA 1YALA 2DJGB 1AU4A 1E2TA 2FQ9A 3AI8A 1NLJA 2AYOA 4OELA 2CB5A 2JQFR 3DF0A 4AXMA 4CDCB 3P5VA 1BGOA 2DC8A 4PADA 3N3KA 1CTEA 1X9YA 3N4CA 4K7CA 2XU1A 1CQDA 2B1NA 1STFE 1ICFA 4BSQA 3PNRA 2DZZA 1JQPA 4YV8A 1QOLA 3HHIA 2G7YA 3HHAA 1TL9A 1AU2A 2DJFB 1BY8A 1KHPA 1M6DA 2B1MA 2E02A 3IMAA 2DC6A 1AYVA 2DC7A 1BP4A 3USVA 2DZYA 2DC9A 3H89A 2DCBA 3IUTA 4FK5A 1AYWA 1PCIA 1DF0A 5CVNB 4I04A 2DCDA 3OVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P5X A;  4BS6 A;  1ATK A;  4DMY A;  1EWO A;  3IOQ A;  1YT7 A;  3BC3 A;  1EWP A;  1ME3 A;  3I06 A;  4BS5 A;  3CH3 X;  2F1G A;  2G8J A;  4W5B A;  4P6G A;  1CPJ A;  2F7D A;  2AUX A;  5CHV A;  2NQD B;  2AU1 A;  2BDL A;  1MS6 A;  3P5U A;  1PIP A;  2PBH A;  5CVO B;  1EWL A;  2R9F A;  2R9N A;  3QT4 A;  2PAD A;  5PAD A;  4QH6 A;  2E01 A;  2XU4 A;  3B79 A;  3OVZ A;  4YYU A;  1NB3 A;  3K9M A;  3QSD A;  3OF9 A;  3MOR A;  1ZCM A;  2R9O A;  3KWZ A;  1F2A A;  1U9X A;  2PNS A;  4ZUX U;  9PAP A;  2C0Y A;  1MIR A;  1QXP A;  1PPP A;  4Q8H A;  1Q6K A;  1QMY A;  1SNK A;  5F02 A;  4Q8G A;  1MDW A;  1KFU L;  1XKG A;  2ATO A;  1SP4 B;  4QRG A;  1GLO A;  2ARY A;  4PP1 A;  3S3Q A;  2VHS A;  2ACT A;  1CSB B;  4P6E A;  3C9E A;  1ME4 A;  1HUC B;  3RVW A;  3K24 A;  2E00 A;  2AUZ A;  4MZO A;  2E03 A;  1PAD A;  5FPW A;  1PXV A;  4I07 A;  5K16 A;  3WXE A;  2P86 A;  2HXZ A;  3LFY A;  3H7D A;  4KLB A;  4BPV A;  5JH3 A;  2YJ9 A;  2FO5 A;  2IPP B;  3P5W A;  4YYS A;  4CDE B;  3BWK A;  2PRE A;  3BPF A;  3S3R A;  1MHW A;  3MHH A;  1CJL A;  2OP3 A;  2GHU A;  1PBH A;  2AIM A;  3KKU A;  7PCK A;  2R6N A;  4G54 A;  4X6I A;  2G6D A;  4I05 A;  3KX1 A;  3OIS A;  2FYE A;  1NB5 A;  1BQI A;  2G8E A;  3PBH A;  6PAD A;  3KSE A;  1IWD A;  3KWB X;  1FH0 A;  3O1G A;  2IBI A;  2NQA A;  1U9Q X;  1NL6 A;  2JQG R;  3ERV A;  1AYU A;  1EWM A;  2YJC A;  1U9V A;  4FJC A;  2P0R A;  1PPO A;  3OF8 A;  3LXS A;  5EGW A;  1KHQ A;  2OUL A;  1QDQ A;  2YJ8 A;  1YVB A;  4CDF B;  3TNX A;  2YJ2 A;  3NHE A;  3CBK A;  3QJ3 A;  1U9W A;  3IEJ A;  2R9C A;  3I3T A;  1Y4H A;  1NQC A;  3CBJ A;  3PW3 A;  1PPN A;  3M99 A;  3RVV A;  1CB5 A;  1TU6 A;  3RVX A;  3PDF A;  3MHS A;  4AXL A;  3D6S A;  1YK7 A;  4BQV A;  1AU3 A;  4DMX A;  1GMY A;  2Y6E A;  4PP2 E;  2BDZ A;  1CS8 A;  2HHN A;  3N3G A;  3U8E A;  4W5C A;  4CZW A;  2XU5 A;  1F29 A;  4YYV A;  3H8C A;  3CH2 X;  1U5I A;  2FRQ A;  2WBF X;  1F2C A;  1GCB A;  1O0E A;  2AYN A;  4YYW A;  4CDD B;  3ZUA A;  1NPZ A;  2R9M A;  1EF7 A;  2FUD A;  3V6C A;  2NQI A;  3O0U A;  3WXF A;  2VHF A;  4N79 A;  3KFQ A;  4QRX A;  3F5V A;  2AS8 A;  3H6S A;  5EF4 A;  1DEU A;  1GEC E;  2GFO A;  4MZS A;  1KFX L;  1A6R A;  2O6X A;  2DCA A;  3E1Z B;  4YYQ A;  3HWN A;  3BCN A;  2HD5 A;  1PPD A;  1MEM A;  4W4U A;  3IV2 A;  1K3B B;  2OZ2 A;  4HWY A;  4XUI A;  1AEC A;  2HH5 A;  3GCB A;  1CVZ A;  1CV8 A;  3HD3 A;  4WA6 A;  1POP A;  4N4Z A;  4RY2 A;  5A24 A;  2CIO A;  3F75 A;  1AIM A;  4YYR A;  3BOW A;  4PI3 A;  3V6E A;  4FIP A;  4XR7 A;  4X6J A;  2FT2 A;  2FRA A;  1KXR A;  2AVW A;  3K8U A;  4N8W A;  4QRV A;  5J94 A;  5CVM A;  2P7U A;  8PCH A;  1S4V A;  3KW9 A;  1MEG A;  2YJB A;  1Y08 A;  4YVA A;  2XU3 A;  3H8B A;  1YK8 A;  1F2B A;  3MTN A;  1PE6 A;  2NQG A;  1THE A;  3IHP A;  1ITO A;  2Y5B A;  1VJV A;  2DCC A;  4MSX A;  1VSN A;  2H7J A;  5JA7 A;  1TLO A;  4QBB A;  5CHT A;  2FTD A;  3BPM A;  4X6H A;  1ZIV A;  1AU0 A;  3WXG A;  4OEM A;  1YAL A;  2DJG B;  1AU4 A;  2FQ9 A;  3AI8 A;  1NLJ A;  2AYO A;  4OEL A;  2CB5 A;  2JQF R;  3DF0 A;  4AXM A;  4CDC B;  3P5V A;  1BGO A;  2DC8 A;  4PAD A;  3N3K A;  1CTE A;  1X9Y A;  3N4C A;  4K7C A;  2XU1 A;  1CQD A;  2B1N A;  1STF E;  1ICF A;  4BSQ A;  3PNR A;  2DZZ A;  1JQP A;  4YV8 A;  1QOL A;  3HHI A;  2G7Y A;  3HHA A;  1TL9 A;  1AU2 A;  2DJF B;  1BY8 A;  1KHP A;  1M6D A;  2B1M A;  2E02 A;  3IMA A;  2DC6 A;  1AYV A;  2DC7 A;  1BP4 A;  3USV A;  2DZY A;  2DC9 A;  3H89 A;  2DCB A;  3IUT A;  4FK5 A;  1AYW A;  1PCI A;  1DF0 A;  4I04 A;  5CVN B;  2DCD A;  3OVX A; 
#chains in the Genus database with same CATH topology
 3P5X A;  4BS6 A;  1ATK A;  4DMY A;  1EWO A;  3IOQ A;  1YT7 A;  3BC3 A;  3C0R A;  1EWP A;  1ME3 A;  3I06 A;  4GUA A;  4BS5 A;  3CH3 X;  2F1G A;  2G8J A;  4W5B A;  4P6G A;  1CPJ A;  2F7D A;  2AUX A;  5CHV A;  2NQD B;  2AU1 A;  2BDL A;  3W31 A;  1MS6 A;  4REZ A;  3P5U A;  1PIP A;  2PBH A;  5CVO B;  1EWL A;  2R9F A;  2R9N A;  3QT4 A;  2PAD A;  5PAD A;  4QH6 A;  2E01 A;  4BOS A;  2XU4 A;  3B79 A;  3OVZ A;  4YYU A;  1NB3 A;  3K9M A;  3QSD A;  3OF9 A;  3MOR A;  1ZCM A;  2R9O A;  3KWZ A;  1F2A A;  1U9X A;  2PNS A;  4ZUX U;  9PAP A;  2C0Y A;  1MIR A;  1QXP A;  1PPP A;  4Q8H A;  1Q6K A;  1QMY A;  1SNK A;  2J7Q C;  5F02 A;  4Q8G A;  1MDW A;  1KFU L;  1XKG A;  2ATO A;  1SP4 B;  4QRG A;  1GLO A;  2ARY A;  4PP1 A;  3S3Q A;  3MJ5 A;  2VHS A;  2ACT A;  1CSB B;  4P6E A;  3C9E A;  1ME4 A;  1HUC B;  3RVW A;  3K24 A;  2E00 A;  2AUZ A;  4MZO A;  2E03 A;  1PAD A;  5FPW A;  1PXV A;  5JZE A;  3MTV A;  4I07 A;  5K16 A;  3WXE A;  2P86 A;  2HXZ A;  3PT2 A;  3LFY A;  4BOP A;  3H7D A;  4KLB A;  4BPV A;  5JH3 A;  2YJ9 A;  2FO5 A;  2IPP B;  3P5W A;  4YYS A;  4CDE B;  3BWK A;  2PRE A;  3BPF A;  3S3R A;  1MHW A;  3MHH A;  1CJL A;  2OP3 A;  2GHU A;  1PBH A;  2AIM A;  3KKU A;  7PCK A;  2R6N A;  4G54 A;  4X6I A;  3BBA A;  2G6D A;  3IFU A;  4I05 A;  4OW0 A;  3KX1 A;  3OIS A;  2FYE A;  1NB5 A;  1BQI A;  2G8E A;  3PBH A;  6PAD A;  3KSE A;  1IWD A;  3KWB X;  4BOZ A;  1FH0 A;  3O1G A;  2UZJ A;  4MI7 A;  2IBI A;  2NQA A;  1U9Q X;  1NL6 A;  2JQG R;  4D8I A;  3ERV A;  1AYU A;  1EWM A;  2YJC A;  3BB7 A;  1PVJ A;  3O65 A;  1U9V A;  2Z84 A;  4FJC A;  2P0R A;  1PPO A;  3OF8 A;  3LXS A;  5EGW A;  1KHQ A;  4R3D A;  2OUL A;  4D8E A;  1QDQ A;  4PT5 A;  2YJ8 A;  2FE8 A;  3ZNH A;  1YVB A;  4CDF B;  3TNX A;  4WUR A;  2YJ2 A;  2DOS A;  3NHE A;  3CBK A;  3QJ3 A;  1U9W A;  3IEJ A;  2R9C A;  3I3T A;  1Y4H A;  1NQC A;  3CBJ A;  3W30 A;  3PW3 A;  1PPN A;  3M99 A;  3RVV A;  1CB5 A;  1TU6 A;  3RVX A;  3PDF A;  3MHS A;  5EZS A;  5EZQ A;  4AXL A;  3D6S A;  1YK7 A;  1UKF A;  4BQV A;  1AU3 A;  4DMX A;  1GMY A;  2Y6E A;  4PP2 E;  2J7Q A;  2BDZ A;  3PHU A;  1CS8 A;  2HHN A;  3N3G A;  3U8E A;  4W5C A;  4CZW A;  2XU5 A;  1F29 A;  4YYV A;  3H8C A;  4M0W A;  3CH2 X;  1U5I A;  2FRQ A;  2WBF X;  1F2C A;  1GCB A;  1O0E A;  2AYN A;  4YYW A;  4CDD B;  4RF0 A;  3ZUA A;  1NPZ A;  4IUM A;  2R9M A;  1EF7 A;  2FUD A;  4IP3 A;  3V6C A;  2NQI A;  2BU3 A;  3O0U A;  3WXF A;  2VHF A;  4N79 A;  3KFQ A;  4QRX A;  3F5V A;  2AS8 A;  3H6S A;  5EF4 A;  1DEU A;  1GEC E;  3OQC A;  2JRI A;  2GFO A;  4MZS A;  1KFX L;  1A6R A;  2O6X A;  2DCA A;  3E1Z B;  4YYQ A;  3HWN A;  3BCN A;  2HD5 A;  1PPD A;  1MEM A;  4W4U A;  3IV2 A;  3TMP A;  5E6J A;  1K3B B;  2OZ2 A;  3PRM A;  4HWY A;  4XUI A;  1AEC A;  2HH5 A;  3GCB A;  3B21 A;  4D8B A;  4HXD B;  3MP2 A;  1CVZ A;  4RNA A;  1CV8 A;  4OVZ B;  3HD3 A;  4WA6 A;  1POP A;  4N4Z A;  4RY2 A;  5A24 A;  2CIO A;  3PHX A;  2BTW B;  3F75 A;  1AIM A;  4YYR A;  3BOW A;  4PI3 A;  3V6E A;  4FIP A;  4XR7 A;  4X6J A;  2FT2 A;  2FRA A;  1KXR A;  2AVW A;  3K8U A;  4N8W A;  4QRV A;  2JTC A;  5J94 A;  5CVM A;  2P7U A;  8PCH A;  1S4V A;  3KW9 A;  1MEG A;  2YJB A;  1Y08 A;  4YVA A;  2XU3 A;  3H8B A;  4XZX A;  2BTW A;  1YK8 A;  1F2B A;  3MTN A;  5KO3 A;  1PE6 A;  2NQG A;  4RF1 A;  1THE A;  3IHP A;  1ITO A;  4ZTB A;  2Y5B A;  1VJV A;  4RKX A;  2DCC A;  4MSX A;  2HWK A;  1VSN A;  2H7J A;  5JA7 A;  1TLO A;  4QBB A;  5CHT A;  4BOQ A;  2FTD A;  3BPM A;  4X6H A;  1YZB A;  3PSE A;  1ZIV A;  1AU0 A;  3WXG A;  4OEM A;  1YAL A;  2DJG B;  1AU4 A;  4BOU A;  2FQ9 A;  4P16 A;  3AI8 A;  1NLJ A;  2AYO A;  4OEL A;  2CB5 A;  2JQF R;  3DF0 A;  4AXM A;  4CDC B;  3P5V A;  1BGO A;  2DC8 A;  4PAD A;  3N3K A;  1CTE A;  1X9Y A;  3N4C A;  4K7C A;  4A5U A;  2XU1 A;  1CQD A;  3RNV A;  2B1N A;  4MM3 B;  1STF E;  1ICF A;  4BSQ A;  3PNR A;  2DZZ A;  1JQP A;  4YV8 A;  4OVZ A;  1QOL A;  3HHI A;  2G7Y A;  3BY4 A;  3HHA A;  1TL9 A;  1AU2 A;  2DJF B;  1BY8 A;  1KHP A;  1M6D A;  3E9S A;  2B1M A;  2E02 A;  3IMA A;  2DC6 A;  3PRP A;  1AYV A;  2DC7 A;  1DKI A;  1BP4 A;  3USV A;  2DZY A;  2DC9 A;  3H89 A;  2DCB A;  3IUT A;  4FK5 A;  2AGA A;  1AYW A;  1PCI A;  3TRK A;  1DF0 A;  4I04 A;  5CVN B;  2DCD A;  3PHW A;  3OVX A; 
#chains in the Genus database with same CATH homology
 3P5X A;  4BS6 A;  1ATK A;  4DMY A;  1EWO A;  3IOQ A;  1YT7 A;  3BC3 A;  1EWP A;  1ME3 A;  2VFB A;  3I06 A;  4BS5 A;  3CH3 X;  2F1G A;  2G8J A;  4W5B A;  4P6G A;  1CPJ A;  2F7D A;  2AUX A;  5CHV A;  2NQD B;  2AU1 A;  2BDL A;  1MS6 A;  3P5U A;  1PIP A;  2PBH A;  5CVO B;  1EWL A;  2R9F A;  2R9N A;  3QT4 A;  2PAD A;  5PAD A;  4QH6 A;  2E01 A;  2XU4 A;  3B79 A;  3OVZ A;  4YYU A;  1NB3 A;  3K9M A;  3QSD A;  3OF9 A;  3MOR A;  1ZCM A;  2R9O A;  3KWZ A;  1F2A A;  1U9X A;  2PNS A;  4ZUX U;  9PAP A;  2C0Y A;  1MIR A;  1QXP A;  1PPP A;  4Q8H A;  1Q6K A;  1QMY A;  1SNK A;  4GUZ A;  5F02 A;  4Q8G A;  1MDW A;  1KFU L;  1XKG A;  2ATO A;  1SP4 B;  4QRG A;  1GLO A;  2ARY A;  4PP1 A;  4C5P A;  3S3Q A;  2VHS A;  2ACT A;  1CSB B;  4P6E A;  3C9E A;  1ME4 A;  1HUC B;  3RVW A;  3K24 A;  2E00 A;  2AUZ A;  4MZO A;  2E03 A;  1PAD A;  5FPW A;  1PXV A;  4I07 A;  5K16 A;  3WXE A;  2P86 A;  2HXZ A;  3LFY A;  3H7D A;  4KLB A;  4BPV A;  5JH3 A;  2YJ9 A;  2FO5 A;  2IPP B;  3P5W A;  4YYS A;  4CDE B;  3BWK A;  1W6F A;  2PRE A;  3BPF A;  3S3R A;  1MHW A;  3MHH A;  1CJL A;  2OP3 A;  2GHU A;  1PBH A;  2AIM A;  3KKU A;  7PCK A;  2R6N A;  4G54 A;  4X6I A;  2G6D A;  4I05 A;  3KX1 A;  3OIS A;  2FYE A;  1NB5 A;  1BQI A;  2G8E A;  3PBH A;  6PAD A;  3KSE A;  1IWD A;  3KWB X;  4BGF A;  1FH0 A;  3O1G A;  1W5R A;  2IBI A;  2NQA A;  1U9Q X;  1NL6 A;  2JQG R;  3ERV A;  1AYU A;  1EWM A;  2YJC A;  1U9V A;  4FJC A;  2P0R A;  2VFC A;  1PPO A;  3OF8 A;  3LXS A;  5EGW A;  1KHQ A;  2OUL A;  1QDQ A;  2YJ8 A;  1YVB A;  4CDF B;  3TNX A;  2YJ2 A;  2BSZ A;  3NHE A;  3CBK A;  3QJ3 A;  1U9W A;  3IEJ A;  2R9C A;  3I3T A;  1Y4H A;  1NQC A;  4B55 A;  3CBJ A;  1W4T A;  3PW3 A;  1PPN A;  3M99 A;  3RVV A;  1CB5 A;  1TU6 A;  3RVX A;  3PDF A;  3MHS A;  4AXL A;  3D6S A;  1YK7 A;  4BQV A;  1AU3 A;  4DMX A;  1GMY A;  2Y6E A;  4PP2 E;  2BDZ A;  1CS8 A;  2HHN A;  3N3G A;  3U8E A;  4W5C A;  4CZW A;  2XU5 A;  1F29 A;  4YYV A;  3H8C A;  3LTW A;  3CH2 X;  1U5I A;  2FRQ A;  2WBF X;  1F2C A;  1GCB A;  1O0E A;  2AYN A;  4YYW A;  4CDD B;  3ZUA A;  1NPZ A;  2R9M A;  1EF7 A;  2FUD A;  3V6C A;  2NQI A;  3O0U A;  3WXF A;  2VHF A;  4N79 A;  3KFQ A;  4QRX A;  3F5V A;  2AS8 A;  3H6S A;  5EF4 A;  1DEU A;  1GEC E;  2GFO A;  4MZS A;  1KFX L;  1A6R A;  2O6X A;  2DCA A;  3E1Z B;  4YYQ A;  3D9W A;  3HWN A;  3BCN A;  2HD5 A;  1PPD A;  1MEM A;  4W4U A;  3IV2 A;  1K3B B;  2OZ2 A;  4HWY A;  4XUI A;  1AEC A;  2HH5 A;  3GCB A;  1CVZ A;  1CV8 A;  3HD3 A;  4WA6 A;  1POP A;  4N4Z A;  4RY2 A;  5A24 A;  2CIO A;  3F75 A;  1AIM A;  4YYR A;  3BOW A;  4PI3 A;  3V6E A;  4FIP A;  4XR7 A;  4X6J A;  2FT2 A;  2FRA A;  1KXR A;  2AVW A;  3K8U A;  4N8W A;  4QRV A;  4NV7 A;  5J94 A;  5CVM A;  2P7U A;  8PCH A;  1S4V A;  3KW9 A;  1MEG A;  2YJB A;  1Y08 A;  4YVA A;  2XU3 A;  3H8B A;  1YK8 A;  1F2B A;  3MTN A;  1PE6 A;  2NQG A;  1THE A;  3IHP A;  1ITO A;  2Y5B A;  1VJV A;  1GX3 A;  2DCC A;  4MSX A;  1VSN A;  2H7J A;  5JA7 A;  1TLO A;  4QBB A;  5CHT A;  2FTD A;  3BPM A;  4X6H A;  1ZIV A;  4NV8 A;  1AU0 A;  3WXG A;  4OEM A;  1YAL A;  2DJG B;  1AU4 A;  1E2T A;  2FQ9 A;  3AI8 A;  1NLJ A;  2AYO A;  4OEL A;  2CB5 A;  2JQF R;  3DF0 A;  4AXM A;  4CDC B;  3P5V A;  1BGO A;  2DC8 A;  4PAD A;  3N3K A;  1CTE A;  1X9Y A;  3N4C A;  4K7C A;  2XU1 A;  1CQD A;  2B1N A;  1STF E;  1ICF A;  4BSQ A;  3PNR A;  2DZZ A;  1JQP A;  4YV8 A;  1QOL A;  3HHI A;  2G7Y A;  3HHA A;  1TL9 A;  1AU2 A;  2DJF B;  1BY8 A;  1KHP A;  1M6D A;  2B1M A;  2E02 A;  3IMA A;  2DC6 A;  1AYV A;  2DC7 A;  1BP4 A;  3USV A;  2DZY A;  2DC9 A;  3H89 A;  2DCB A;  3IUT A;  4FK5 A;  1AYW A;  1PCI A;  1DF0 A;  5CVN B;  4I04 A;  2DCD A;  3OVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...