2CIOA

The high resolution x-ray structure of papain complexed with fragments of the trypanosoma brucei cysteine protease inhibitor icp.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
212
structure length
211
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAPAIN
publication title High-Resolution Complex of Papain with Remnants of a Cysteine Protease Inhibitor Derived from Trypanosoma Brucei
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Hydrolase/inhibitor
total genus 71
structure length 211
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2cioA00
3OF8A 4XUIA 1CS8A 2H7JA 3S3RA 4W5BA 3MHHA 2DCBA 2DCDA 1U9QX 1JQPA 2PREA 3OVXA 3OF9A 1F2AA 1KXRA 1TU6A 2WBFX 2AIMA 1Y08A 1QMYA 2R9NA 1BP4A 5K16A 5EGWA 4QRVA 5J94A 2DC9A 4X6IA 1A6RA 2O6XA 4YYRA 4BQVA 1ITOA 3V6EA 3C9EA 2PNSA 2R9CA 4PI3A 4PP2E 1VJVA 1HUCB 3S3QA 1X9YA 1ZCMA 2E01A 1AYVA 1GMYA 4FJCA 3PW3A 2ACTA 1POPA 5CHVA 3IV2A 3LXSA 4BPVA 2NQIA 4BSQA 2XU4A 2CIOA 2DZZA 1ME3A 1M6DA 1GLOA 1KHQA 3OVZA 2Y5BA 4XR7A 1XKGA 2AU1A 4Q8HA 4YYSA 5A24A 1CPJA 2AVWA 1IWDA 4FK5A 1TL9A 2E03A 1SNKA 3GCBA 3BPMA 4CZWA 3TNXA 2GHUA 4X6JA 4MZSA 1CJLA 3H8CA 4K7CA 3K9MA 2ARYA 2XU1A 4MSXA 5CVMA 1AECA 4AXMA 2R9FA 2VHFA 4WA6A 2NQDB 4N79A 3KWBX 1GECE 3BCNA 3RVWA 2FRAA 1FH0A 3KX1A 1F2CA 3HWNA 2FQ9A 3N4CA 4I05A 1U9WA 3F75A 7PCKA 3MTNA 2DCCA 3U8EA 1U9VA 1BGOA 2P7UA 3IUTA 3M99A 5CHTA 3KW9A 4QBBA 2YJ9A 2GFOA 2CB5A 3P5WA 4QRGA 2R9MA 2BDZA 2E00A 3PBHA 5PADA 2P86A 4QH6A 4BS6A 4FIPA 4MZOA 2AUXA 2FYEA 1CV8A 4DMXA 1PE6A 2DCAA 3HHIA 1EWMA 3ERVA 3WXEA 3I3TA 1AU0A 2YJCA 4P6GA 1SP4B 3RVXA 1PXVA 4N4ZA 4OELA 1YT7A 3N3KA 3IMAA 3H7DA 3CH3X 2NQGA 3P5XA 4QRXA 1NQCA 1EWOA 2HH5A 2OZ2A 2XU3A 4CDEB 4YYWA 1CSBB 3BWKA 4YV8A 2AYNA 2DC8A 2G6DA 1F2BA 2ATOA 2FTDA 4W5CA 3K24A 1CTEA 5JH3A 4PP1A 3CBKA 1NB3A 2P0RA 1PIPA 1NB5A 1QDQA 3RVVA 3P5VA 5JA7A 2B1NA 4RY2A 1ATKA 3CBJA 3B79A 2F7DA 2NQAA 2BDLA 1PCIA 3O1GA 3QSDA 3I06A 1S4VA 1QXPA 3AI8A 5CVNB 3CH2X 1Q6KA 3HD3A 2IPPB 1DF0A 3NHEA 1MEMA 1KHPA 2E02A 3PNRA 4DMYA 1AYWA 1PBHA 2AUZA 1VSNA 3DF0A 3IEJA 6PADA 3N3GA 1YALA 3MORA 2JQGR 4X6HA 3K8UA 1KFXL 2PBHA 1AU3A 2XU5A 2OULA 1BQIA 4KLBA 5FPWA 1KFUL 2C0YA 1CVZA 1PPNA 3HHAA 2R9OA 3D6SA 3KWZA 1PPPA 1QOLA 1Y4HA 4OEMA 1CQDA 4CDFB 3QT4A 4I07A 4HWYA 4PADA 1AYUA 2FUDA 2G8JA 3V6CA 2R6NA 2AS8A 1ZIVA 1TLOA 1ME4A 1THEA 1STFE 4W4UA 3KSEA 2DC7A 5CVOB 3KFQA 3BPFA 1PPDA 4YYQA 1NL6A 3F5VA 3ZUAA 4YYVA 3QJ3A 1U5IA 3H89A 9PAPA 4P6EA 3LFYA 3H8BA 3H6SA 2AYOA 2JQFR 2VHSA 1MS6A 2YJ2A 2DJGB 2HHNA 1O0EA 4AXLA 1DEUA 2PADA 1PPOA 4I04A 2FO5A 2FT2A 4ZUXU 3BOWA 1AIMA 1MHWA 1MEGA 4BS5A 4CDDB 1MDWA 3E1ZB 2FRQA 1AU2A 3KKUA 1EWPA 2Y6EA 8PCHA 2G8EA 2HXZA 1AU4A 1EF7A 2YJBA 1ICFA 3WXFA 4G54A 3IOQA 2OP3A 1YVBA 2DC6A 2G7YA 4CDCB 3P5UA 1NLJA 1GCBA 3OISA 5F02A 3O0UA 3PDFA 2DZYA 2F1GA 1BY8A 4YYUA 1NPZA 2B1MA 5EF4A 1K3BB 4YVAA 4N8WA 1EWLA 3IHPA 2IBIA 3USVA 1CB5A 2YJ8A 3MHSA 1PADA 1YK7A 1YK8A 1U9XA 1MIRA 4Q8GA 1F29A 3WXGA 2DJFB 2HD5A 3BC3A
chains in the Genus database with same CATH superfamily
3OF8A 3E9SA 4XUIA 1CS8A 4RF0A 2H7JA 3S3RA 4W5BA 3MHHA 2DCBA 3PRPA 2DCDA 2J7QC 1U9QX 1JQPA 2PREA 3OVXA 3OF9A 4RKXA 1F2AA 1KXRA 1TU6A 2AGAA 2WBFX 2AIMA 1Y08A 1UKFA 1QMYA 2R9NA 1BP4A 5K16A 5EGWA 4QRVA 5J94A 2DC9A 4X6IA 1A6RA 2O6XA 4YYRA 3MTVA 4BQVA 1ITOA 4D8BA 1YZBA 3V6EA 3C9EA 2PNSA 2R9CA 4PI3A 4PP2E 1VJVA 1HUCB 3S3QA 1X9YA 1ZCMA 2E01A 1AYVA 1GMYA 4FJCA 2FE8A 3PW3A 2ACTA 1POPA 5CHVA 3IV2A 3LXSA 4BPVA 4D8IA 2NQIA 3PHWA 4BSQA 2XU4A 2CIOA 2DZZA 1ME3A 4OW0A 1M6DA 1GLOA 1KHQA 3OVZA 2Y5BA 4XR7A 1XKGA 4OVZA 2AU1A 4Q8HA 4YYSA 5A24A 1CPJA 2AVWA 1IWDA 4FK5A 1TL9A 2E03A 1SNKA 3GCBA 3BPMA 4CZWA 3TNXA 2GHUA 4P16A 4X6JA 4MZSA 1CJLA 3H8CA 4K7CA 2BTWB 3K9MA 2ARYA 2XU1A 4MSXA 5CVMA 1AECA 3ZNHA 3PSEA 4AXMA 3PHXA 2R9FA 2VHFA 4WA6A 2NQDB 4M0WA 1DKIA 4N79A 3KWBX 1GECE 3BCNA 3RVWA 2FRAA 1FH0A 3KX1A 1F2CA 3HWNA 2FQ9A 3N4CA 4RF1A 4I05A 1U9WA 3F75A 7PCKA 3MTNA 4R3DA 2DCCA 3U8EA 3TRKA 1U9VA 1BGOA 3MJ5A 2P7UA 3IUTA 3M99A 4IUMA 5CHTA 3KW9A 4QBBA 2YJ9A 2GFOA 2CB5A 3P5WA 4QRGA 2R9MA 1PVJA 2BDZA 2E00A 3PBHA 5PADA 2P86A 4QH6A 4BS6A 4FIPA 4MZOA 2AUXA 2FYEA 1CV8A 4DMXA 1PE6A 2DOSA 2DCAA 3HHIA 1EWMA 3ERVA 3WXEA 3I3TA 1AU0A 2JTCA 2YJCA 3RNVA 4P6GA 1SP4B 3RVXA 1PXVA 2J7QA 4N4ZA 4OELA 1YT7A 3N3KA 3IMAA 3PT2A 4HXDB 3H7DA 3CH3X 2NQGA 3P5XA 4QRXA 1NQCA 4BOUA 1EWOA 4RNAA 2HH5A 5EZSA 2OZ2A 2XU3A 4CDEB 3PRMA 4XZXA 4YYWA 3B21A 1CSBB 3BWKA 4YV8A 2AYNA 2DC8A 3IFUA 4REZA 2G6DA 1F2BA 4BOQA 2ATOA 2FTDA 4W5CA 3K24A 1CTEA 5JH3A 4PP1A 3CBKA 4D8EA 1NB3A 2P0RA 1PIPA 1NB5A 1QDQA 3RVVA 3P5VA 3BBAA 5JA7A 2B1NA 4RY2A 1ATKA 3CBJA 3B79A 4GUAA 2F7DA 2NQAA 2BDLA 1PCIA 3O1GA 3QSDA 3W30A 3I06A 1S4VA 1QXPA 3AI8A 5CVNB 4IP3A 3CH2X 1Q6KA 3HD3A 3W31A 2IPPB 1DF0A 4OVZB 3NHEA 2JRIA 1MEMA 1KHPA 2E02A 3PNRA 4DMYA 3C0RA 1AYWA 1PBHA 2AUZA 1VSNA 3DF0A 3IEJA 6PADA 3N3GA 1YALA 4PT5A 3MORA 2JQGR 4X6HA 3K8UA 1KFXL 2PBHA 1AU3A 2XU5A 2OULA 1BQIA 4KLBA 5FPWA 1KFUL 2C0YA 1CVZA 1PPNA 3HHAA 2R9OA 3D6SA 3KWZA 1PPPA 1QOLA 5JZEA 1Y4HA 4OEMA 1CQDA 4CDFB 3QT4A 4I07A 4BOZA 4HWYA 5KO3A 3BB7A 4PADA 1AYUA 2FUDA 3MP2A 2G8JA 3O65A 3V6CA 2R6NA 2AS8A 1ZIVA 1TLOA 1ME4A 2UZJA 1THEA 1STFE 4W4UA 3KSEA 2DC7A 4MI7A 5CVOB 3KFQA 3BPFA 1PPDA 4YYQA 1NL6A 2BU3A 3F5VA 3ZUAA 4YYVA 3QJ3A 1U5IA 3H89A 9PAPA 4P6EA 3PHUA 3LFYA 3H8BA 4ZTBA 3H6SA 2AYOA 2JQFR 2VHSA 4WURA 1MS6A 2YJ2A 2DJGB 2HHNA 2Z84A 1O0EA 4AXLA 1DEUA 2PADA 1PPOA 4I04A 5EZQA 2FO5A 2FT2A 4ZUXU 3BOWA 1AIMA 1MHWA 1MEGA 4BS5A 4CDDB 1MDWA 2BTWA 3E1ZB 2FRQA 1AU2A 3BY4A 3KKUA 1EWPA 2HWKA 2Y6EA 8PCHA 2G8EA 2HXZA 4BOSA 4MM3B 4BOPA 1AU4A 1EF7A 2YJBA 5E6JA 3OQCA 1ICFA 3WXFA 4G54A 3IOQA 2OP3A 1YVBA 2DC6A 2G7YA 4CDCB 3P5UA 1NLJA 1GCBA 3OISA 5F02A 3O0UA 3PDFA 2DZYA 2F1GA 1BY8A 4YYUA 1NPZA 2B1MA 5EF4A 1K3BB 4YVAA 4N8WA 1EWLA 3IHPA 2IBIA 3USVA 1CB5A 2YJ8A 3MHSA 1PADA 1YK7A 1YK8A 1U9XA 1MIRA 4Q8GA 1F29A 3WXGA 3TMPA 2DJFB 2HD5A 3BC3A 4A5UA
chains in the Genus database with same CATH topology
3OF8A 4XUIA 1CS8A 2H7JA 3S3RA 4W5BA 3MHHA 2DCBA 2DCDA 1U9QX 1JQPA 2PREA 3OVXA 4C5PA 3OF9A 1F2AA 1KXRA 1TU6A 2WBFX 2AIMA 1Y08A 1QMYA 4BGFA 2R9NA 1BP4A 5K16A 5EGWA 4QRVA 5J94A 2DC9A 4X6IA 1A6RA 2O6XA 4YYRA 4BQVA 1ITOA 3V6EA 3C9EA 2PNSA 2R9CA 4PI3A 4PP2E 1VJVA 1HUCB 3S3QA 1X9YA 1ZCMA 2E01A 1GX3A 1AYVA 1GMYA 4FJCA 3PW3A 2ACTA 1POPA 5CHVA 3IV2A 3LXSA 4BPVA 2NQIA 4BSQA 2XU4A 2CIOA 2DZZA 1ME3A 1M6DA 1GLOA 1KHQA 3OVZA 2Y5BA 4XR7A 1XKGA 2AU1A 4Q8HA 4YYSA 5A24A 1CPJA 2AVWA 1IWDA 4FK5A 1TL9A 2E03A 1SNKA 3GCBA 3BPMA 4CZWA 3TNXA 2GHUA 4X6JA 4MZSA 1CJLA 3H8CA 4K7CA 3K9MA 2ARYA 2XU1A 4MSXA 5CVMA 1W5RA 1AECA 4AXMA 2R9FA 2VHFA 4WA6A 2NQDB 4N79A 3KWBX 1GECE 3BCNA 3RVWA 2FRAA 1FH0A 3KX1A 1F2CA 3HWNA 2FQ9A 3N4CA 4I05A 1U9WA 2BSZA 3F75A 7PCKA 3MTNA 2DCCA 3U8EA 4GUZA 1U9VA 1BGOA 2P7UA 3IUTA 3M99A 5CHTA 3KW9A 4QBBA 2YJ9A 2GFOA 2CB5A 3P5WA 4QRGA 2R9MA 2BDZA 2E00A 3PBHA 5PADA 2P86A 4QH6A 4BS6A 4FIPA 4MZOA 2AUXA 2FYEA 1CV8A 4DMXA 1PE6A 2DCAA 3HHIA 1EWMA 3ERVA 3WXEA 3I3TA 1AU0A 2YJCA 4P6GA 1SP4B 3RVXA 1PXVA 4N4ZA 4OELA 1YT7A 3N3KA 1E2TA 4NV7A 3IMAA 3H7DA 3CH3X 2NQGA 3P5XA 4QRXA 1NQCA 1EWOA 2HH5A 2OZ2A 2XU3A 4CDEB 4YYWA 1CSBB 3BWKA 4YV8A 2AYNA 2DC8A 2G6DA 1F2BA 2ATOA 2FTDA 4W5CA 3K24A 1CTEA 4NV8A 5JH3A 4PP1A 3CBKA 1NB3A 2VFBA 2P0RA 1PIPA 1NB5A 1QDQA 2VFCA 3RVVA 3P5VA 5JA7A 2B1NA 4RY2A 1ATKA 3CBJA 3B79A 2F7DA 2NQAA 2BDLA 1PCIA 3O1GA 3QSDA 3I06A 1S4VA 1QXPA 3AI8A 5CVNB 3CH2X 1Q6KA 3HD3A 2IPPB 1DF0A 3NHEA 1MEMA 1KHPA 2E02A 3PNRA 4DMYA 1AYWA 1PBHA 2AUZA 1VSNA 3DF0A 3IEJA 6PADA 3N3GA 1YALA 3MORA 2JQGR 4X6HA 3K8UA 1KFXL 2PBHA 1AU3A 2XU5A 2OULA 1BQIA 4KLBA 5FPWA 1KFUL 2C0YA 1CVZA 1PPNA 3HHAA 2R9OA 3D6SA 3KWZA 1PPPA 1QOLA 1Y4HA 4OEMA 1CQDA 4CDFB 3QT4A 4I07A 4HWYA 4PADA 1AYUA 2FUDA 2G8JA 3V6CA 2R6NA 2AS8A 1ZIVA 1TLOA 1ME4A 1THEA 1STFE 4W4UA 3KSEA 2DC7A 5CVOB 3KFQA 3BPFA 1PPDA 4YYQA 1NL6A 3F5VA 3ZUAA 4YYVA 3QJ3A 1U5IA 3H89A 9PAPA 4P6EA 3LTWA 3LFYA 3H8BA 3H6SA 2AYOA 2JQFR 2VHSA 1MS6A 2YJ2A 2DJGB 2HHNA 1O0EA 4AXLA 1DEUA 2PADA 1PPOA 4I04A 2FO5A 2FT2A 4ZUXU 3BOWA 1AIMA 1MHWA 1MEGA 4BS5A 4CDDB 1MDWA 3E1ZB 2FRQA 3D9WA 1AU2A 3KKUA 1EWPA 2Y6EA 8PCHA 2G8EA 2HXZA 1W4TA 1AU4A 1EF7A 2YJBA 1ICFA 3WXFA 4G54A 3IOQA 2OP3A 1YVBA 2DC6A 2G7YA 4CDCB 3P5UA 1NLJA 1GCBA 3OISA 5F02A 3O0UA 3PDFA 2DZYA 2F1GA 1BY8A 4YYUA 1NPZA 2B1MA 5EF4A 4B55A 1K3BB 4YVAA 1W6FA 4N8WA 1EWLA 3IHPA 2IBIA 3USVA 1CB5A 2YJ8A 3MHSA 1PADA 1YK7A 1YK8A 1U9XA 1MIRA 4Q8GA 1F29A 3WXGA 2DJFB 2HD5A 3BC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OF8 A;  4XUI A;  1CS8 A;  2H7J A;  3S3R A;  4W5B A;  3MHH A;  2DCB A;  2DCD A;  1U9Q X;  1JQP A;  2PRE A;  3OVX A;  3OF9 A;  1F2A A;  1KXR A;  1TU6 A;  2WBF X;  2AIM A;  1Y08 A;  1QMY A;  2R9N A;  1BP4 A;  5K16 A;  5EGW A;  4QRV A;  5J94 A;  2DC9 A;  4X6I A;  1A6R A;  2O6X A;  4YYR A;  4BQV A;  1ITO A;  3V6E A;  3C9E A;  2PNS A;  2R9C A;  4PI3 A;  4PP2 E;  1VJV A;  1HUC B;  3S3Q A;  1X9Y A;  1ZCM A;  2E01 A;  1AYV A;  1GMY A;  4FJC A;  3PW3 A;  2ACT A;  1POP A;  5CHV A;  3IV2 A;  3LXS A;  4BPV A;  2NQI A;  4BSQ A;  2XU4 A;  2CIO A;  2DZZ A;  1ME3 A;  1M6D A;  1GLO A;  1KHQ A;  3OVZ A;  2Y5B A;  4XR7 A;  1XKG A;  2AU1 A;  4Q8H A;  4YYS A;  5A24 A;  1CPJ A;  2AVW A;  1IWD A;  4FK5 A;  1TL9 A;  2E03 A;  1SNK A;  3GCB A;  3BPM A;  4CZW A;  3TNX A;  2GHU A;  4X6J A;  4MZS A;  1CJL A;  3H8C A;  4K7C A;  3K9M A;  2ARY A;  2XU1 A;  4MSX A;  5CVM A;  1AEC A;  4AXM A;  2R9F A;  2VHF A;  4WA6 A;  2NQD B;  4N79 A;  3KWB X;  1GEC E;  3BCN A;  3RVW A;  2FRA A;  1FH0 A;  3KX1 A;  1F2C A;  3HWN A;  2FQ9 A;  3N4C A;  4I05 A;  1U9W A;  3F75 A;  7PCK A;  3MTN A;  2DCC A;  3U8E A;  1U9V A;  1BGO A;  2P7U A;  3IUT A;  3M99 A;  5CHT A;  3KW9 A;  4QBB A;  2YJ9 A;  2GFO A;  2CB5 A;  3P5W A;  4QRG A;  2R9M A;  2BDZ A;  2E00 A;  3PBH A;  5PAD A;  2P86 A;  4QH6 A;  4BS6 A;  4FIP A;  4MZO A;  2AUX A;  2FYE A;  1CV8 A;  4DMX A;  1PE6 A;  2DCA A;  3HHI A;  1EWM A;  3ERV A;  3WXE A;  3I3T A;  1AU0 A;  2YJC A;  4P6G A;  1SP4 B;  3RVX A;  1PXV A;  4N4Z A;  4OEL A;  1YT7 A;  3N3K A;  3IMA A;  3H7D A;  3CH3 X;  2NQG A;  3P5X A;  4QRX A;  1NQC A;  1EWO A;  2HH5 A;  2OZ2 A;  2XU3 A;  4CDE B;  4YYW A;  1CSB B;  3BWK A;  4YV8 A;  2AYN A;  2DC8 A;  2G6D A;  1F2B A;  2ATO A;  2FTD A;  4W5C A;  3K24 A;  1CTE A;  5JH3 A;  4PP1 A;  3CBK A;  1NB3 A;  2P0R A;  1PIP A;  1NB5 A;  1QDQ A;  3RVV A;  3P5V A;  5JA7 A;  2B1N A;  4RY2 A;  1ATK A;  3CBJ A;  3B79 A;  2F7D A;  2NQA A;  2BDL A;  1PCI A;  3O1G A;  3QSD A;  3I06 A;  1S4V A;  1QXP A;  3AI8 A;  5CVN B;  3CH2 X;  1Q6K A;  3HD3 A;  2IPP B;  1DF0 A;  3NHE A;  1MEM A;  1KHP A;  2E02 A;  3PNR A;  4DMY A;  1AYW A;  1PBH A;  2AUZ A;  1VSN A;  3DF0 A;  3IEJ A;  6PAD A;  3N3G A;  1YAL A;  3MOR A;  2JQG R;  4X6H A;  3K8U A;  1KFX L;  2PBH A;  1AU3 A;  2XU5 A;  2OUL A;  1BQI A;  4KLB A;  5FPW A;  1KFU L;  2C0Y A;  1CVZ A;  1PPN A;  3HHA A;  2R9O A;  3D6S A;  3KWZ A;  1PPP A;  1QOL A;  1Y4H A;  4OEM A;  1CQD A;  4CDF B;  3QT4 A;  4I07 A;  4HWY A;  4PAD A;  1AYU A;  2FUD A;  2G8J A;  3V6C A;  2R6N A;  2AS8 A;  1ZIV A;  1TLO A;  1ME4 A;  1THE A;  1STF E;  4W4U A;  3KSE A;  2DC7 A;  5CVO B;  3KFQ A;  3BPF A;  1PPD A;  4YYQ A;  1NL6 A;  3F5V A;  3ZUA A;  4YYV A;  3QJ3 A;  1U5I A;  3H89 A;  9PAP A;  4P6E A;  3LFY A;  3H8B A;  3H6S A;  2AYO A;  2JQF R;  2VHS A;  1MS6 A;  2YJ2 A;  2DJG B;  2HHN A;  1O0E A;  4AXL A;  1DEU A;  2PAD A;  1PPO A;  4I04 A;  2FO5 A;  2FT2 A;  4ZUX U;  3BOW A;  1AIM A;  1MHW A;  1MEG A;  4BS5 A;  4CDD B;  1MDW A;  3E1Z B;  2FRQ A;  1AU2 A;  3KKU A;  1EWP A;  2Y6E A;  8PCH A;  2G8E A;  2HXZ A;  1AU4 A;  1EF7 A;  2YJB A;  1ICF A;  3WXF A;  4G54 A;  3IOQ A;  2OP3 A;  1YVB A;  2DC6 A;  2G7Y A;  4CDC B;  3P5U A;  1NLJ A;  1GCB A;  3OIS A;  5F02 A;  3O0U A;  3PDF A;  2DZY A;  2F1G A;  1BY8 A;  4YYU A;  1NPZ A;  2B1M A;  5EF4 A;  1K3B B;  4YVA A;  4N8W A;  1EWL A;  3IHP A;  2IBI A;  3USV A;  1CB5 A;  2YJ8 A;  3MHS A;  1PAD A;  1YK7 A;  1YK8 A;  1U9X A;  1MIR A;  4Q8G A;  1F29 A;  3WXG A;  2DJF B;  2HD5 A;  3BC3 A; 
#chains in the Genus database with same CATH topology
 3OF8 A;  3E9S A;  4XUI A;  1CS8 A;  4RF0 A;  2H7J A;  3S3R A;  4W5B A;  3MHH A;  2DCB A;  3PRP A;  2DCD A;  2J7Q C;  1U9Q X;  1JQP A;  2PRE A;  3OVX A;  3OF9 A;  4RKX A;  1F2A A;  1KXR A;  1TU6 A;  2AGA A;  2WBF X;  2AIM A;  1Y08 A;  1UKF A;  1QMY A;  2R9N A;  1BP4 A;  5K16 A;  5EGW A;  4QRV A;  5J94 A;  2DC9 A;  4X6I A;  1A6R A;  2O6X A;  4YYR A;  3MTV A;  4BQV A;  1ITO A;  4D8B A;  1YZB A;  3V6E A;  3C9E A;  2PNS A;  2R9C A;  4PI3 A;  4PP2 E;  1VJV A;  1HUC B;  3S3Q A;  1X9Y A;  1ZCM A;  2E01 A;  1AYV A;  1GMY A;  4FJC A;  2FE8 A;  3PW3 A;  2ACT A;  1POP A;  5CHV A;  3IV2 A;  3LXS A;  4BPV A;  4D8I A;  2NQI A;  3PHW A;  4BSQ A;  2XU4 A;  2CIO A;  2DZZ A;  1ME3 A;  4OW0 A;  1M6D A;  1GLO A;  1KHQ A;  3OVZ A;  2Y5B A;  4XR7 A;  1XKG A;  4OVZ A;  2AU1 A;  4Q8H A;  4YYS A;  5A24 A;  1CPJ A;  2AVW A;  1IWD A;  4FK5 A;  1TL9 A;  2E03 A;  1SNK A;  3GCB A;  3BPM A;  4CZW A;  3TNX A;  2GHU A;  4P16 A;  4X6J A;  4MZS A;  1CJL A;  3H8C A;  4K7C A;  2BTW B;  3K9M A;  2ARY A;  2XU1 A;  4MSX A;  5CVM A;  1AEC A;  3ZNH A;  3PSE A;  4AXM A;  3PHX A;  2R9F A;  2VHF A;  4WA6 A;  2NQD B;  4M0W A;  1DKI A;  4N79 A;  3KWB X;  1GEC E;  3BCN A;  3RVW A;  2FRA A;  1FH0 A;  3KX1 A;  1F2C A;  3HWN A;  2FQ9 A;  3N4C A;  4RF1 A;  4I05 A;  1U9W A;  3F75 A;  7PCK A;  3MTN A;  4R3D A;  2DCC A;  3U8E A;  3TRK A;  1U9V A;  1BGO A;  3MJ5 A;  2P7U A;  3IUT A;  3M99 A;  4IUM A;  5CHT A;  3KW9 A;  4QBB A;  2YJ9 A;  2GFO A;  2CB5 A;  3P5W A;  4QRG A;  2R9M A;  1PVJ A;  2BDZ A;  2E00 A;  3PBH A;  5PAD A;  2P86 A;  4QH6 A;  4BS6 A;  4FIP A;  4MZO A;  2AUX A;  2FYE A;  1CV8 A;  4DMX A;  1PE6 A;  2DOS A;  2DCA A;  3HHI A;  1EWM A;  3ERV A;  3WXE A;  3I3T A;  1AU0 A;  2JTC A;  2YJC A;  3RNV A;  4P6G A;  1SP4 B;  3RVX A;  1PXV A;  2J7Q A;  4N4Z A;  4OEL A;  1YT7 A;  3N3K A;  3IMA A;  3PT2 A;  4HXD B;  3H7D A;  3CH3 X;  2NQG A;  3P5X A;  4QRX A;  1NQC A;  4BOU A;  1EWO A;  4RNA A;  2HH5 A;  5EZS A;  2OZ2 A;  2XU3 A;  4CDE B;  3PRM A;  4XZX A;  4YYW A;  3B21 A;  1CSB B;  3BWK A;  4YV8 A;  2AYN A;  2DC8 A;  3IFU A;  4REZ A;  2G6D A;  1F2B A;  4BOQ A;  2ATO A;  2FTD A;  4W5C A;  3K24 A;  1CTE A;  5JH3 A;  4PP1 A;  3CBK A;  4D8E A;  1NB3 A;  2P0R A;  1PIP A;  1NB5 A;  1QDQ A;  3RVV A;  3P5V A;  3BBA A;  5JA7 A;  2B1N A;  4RY2 A;  1ATK A;  3CBJ A;  3B79 A;  4GUA A;  2F7D A;  2NQA A;  2BDL A;  1PCI A;  3O1G A;  3QSD A;  3W30 A;  3I06 A;  1S4V A;  1QXP A;  3AI8 A;  5CVN B;  4IP3 A;  3CH2 X;  1Q6K A;  3HD3 A;  3W31 A;  2IPP B;  1DF0 A;  4OVZ B;  3NHE A;  2JRI A;  1MEM A;  1KHP A;  2E02 A;  3PNR A;  4DMY A;  3C0R A;  1AYW A;  1PBH A;  2AUZ A;  1VSN A;  3DF0 A;  3IEJ A;  6PAD A;  3N3G A;  1YAL A;  4PT5 A;  3MOR A;  2JQG R;  4X6H A;  3K8U A;  1KFX L;  2PBH A;  1AU3 A;  2XU5 A;  2OUL A;  1BQI A;  4KLB A;  5FPW A;  1KFU L;  2C0Y A;  1CVZ A;  1PPN A;  3HHA A;  2R9O A;  3D6S A;  3KWZ A;  1PPP A;  1QOL A;  5JZE A;  1Y4H A;  4OEM A;  1CQD A;  4CDF B;  3QT4 A;  4I07 A;  4BOZ A;  4HWY A;  5KO3 A;  3BB7 A;  4PAD A;  1AYU A;  2FUD A;  3MP2 A;  2G8J A;  3O65 A;  3V6C A;  2R6N A;  2AS8 A;  1ZIV A;  1TLO A;  1ME4 A;  2UZJ A;  1THE A;  1STF E;  4W4U A;  3KSE A;  2DC7 A;  4MI7 A;  5CVO B;  3KFQ A;  3BPF A;  1PPD A;  4YYQ A;  1NL6 A;  2BU3 A;  3F5V A;  3ZUA A;  4YYV A;  3QJ3 A;  1U5I A;  3H89 A;  9PAP A;  4P6E A;  3PHU A;  3LFY A;  3H8B A;  4ZTB A;  3H6S A;  2AYO A;  2JQF R;  2VHS A;  4WUR A;  1MS6 A;  2YJ2 A;  2DJG B;  2HHN A;  2Z84 A;  1O0E A;  4AXL A;  1DEU A;  2PAD A;  1PPO A;  4I04 A;  5EZQ A;  2FO5 A;  2FT2 A;  4ZUX U;  3BOW A;  1AIM A;  1MHW A;  1MEG A;  4BS5 A;  4CDD B;  1MDW A;  2BTW A;  3E1Z B;  2FRQ A;  1AU2 A;  3BY4 A;  3KKU A;  1EWP A;  2HWK A;  2Y6E A;  8PCH A;  2G8E A;  2HXZ A;  4BOS A;  4MM3 B;  4BOP A;  1AU4 A;  1EF7 A;  2YJB A;  5E6J A;  3OQC A;  1ICF A;  3WXF A;  4G54 A;  3IOQ A;  2OP3 A;  1YVB A;  2DC6 A;  2G7Y A;  4CDC B;  3P5U A;  1NLJ A;  1GCB A;  3OIS A;  5F02 A;  3O0U A;  3PDF A;  2DZY A;  2F1G A;  1BY8 A;  4YYU A;  1NPZ A;  2B1M A;  5EF4 A;  1K3B B;  4YVA A;  4N8W A;  1EWL A;  3IHP A;  2IBI A;  3USV A;  1CB5 A;  2YJ8 A;  3MHS A;  1PAD A;  1YK7 A;  1YK8 A;  1U9X A;  1MIR A;  4Q8G A;  1F29 A;  3WXG A;  3TMP A;  2DJF B;  2HD5 A;  3BC3 A;  4A5U A; 
#chains in the Genus database with same CATH homology
 3OF8 A;  4XUI A;  1CS8 A;  2H7J A;  3S3R A;  4W5B A;  3MHH A;  2DCB A;  2DCD A;  1U9Q X;  1JQP A;  2PRE A;  3OVX A;  4C5P A;  3OF9 A;  1F2A A;  1KXR A;  1TU6 A;  2WBF X;  2AIM A;  1Y08 A;  1QMY A;  4BGF A;  2R9N A;  1BP4 A;  5K16 A;  5EGW A;  4QRV A;  5J94 A;  2DC9 A;  4X6I A;  1A6R A;  2O6X A;  4YYR A;  4BQV A;  1ITO A;  3V6E A;  3C9E A;  2PNS A;  2R9C A;  4PI3 A;  4PP2 E;  1VJV A;  1HUC B;  3S3Q A;  1X9Y A;  1ZCM A;  2E01 A;  1GX3 A;  1AYV A;  1GMY A;  4FJC A;  3PW3 A;  2ACT A;  1POP A;  5CHV A;  3IV2 A;  3LXS A;  4BPV A;  2NQI A;  4BSQ A;  2XU4 A;  2CIO A;  2DZZ A;  1ME3 A;  1M6D A;  1GLO A;  1KHQ A;  3OVZ A;  2Y5B A;  4XR7 A;  1XKG A;  2AU1 A;  4Q8H A;  4YYS A;  5A24 A;  1CPJ A;  2AVW A;  1IWD A;  4FK5 A;  1TL9 A;  2E03 A;  1SNK A;  3GCB A;  3BPM A;  4CZW A;  3TNX A;  2GHU A;  4X6J A;  4MZS A;  1CJL A;  3H8C A;  4K7C A;  3K9M A;  2ARY A;  2XU1 A;  4MSX A;  5CVM A;  1W5R A;  1AEC A;  4AXM A;  2R9F A;  2VHF A;  4WA6 A;  2NQD B;  4N79 A;  3KWB X;  1GEC E;  3BCN A;  3RVW A;  2FRA A;  1FH0 A;  3KX1 A;  1F2C A;  3HWN A;  2FQ9 A;  3N4C A;  4I05 A;  1U9W A;  2BSZ A;  3F75 A;  7PCK A;  3MTN A;  2DCC A;  3U8E A;  4GUZ A;  1U9V A;  1BGO A;  2P7U A;  3IUT A;  3M99 A;  5CHT A;  3KW9 A;  4QBB A;  2YJ9 A;  2GFO A;  2CB5 A;  3P5W A;  4QRG A;  2R9M A;  2BDZ A;  2E00 A;  3PBH A;  5PAD A;  2P86 A;  4QH6 A;  4BS6 A;  4FIP A;  4MZO A;  2AUX A;  2FYE A;  1CV8 A;  4DMX A;  1PE6 A;  2DCA A;  3HHI A;  1EWM A;  3ERV A;  3WXE A;  3I3T A;  1AU0 A;  2YJC A;  4P6G A;  1SP4 B;  3RVX A;  1PXV A;  4N4Z A;  4OEL A;  1YT7 A;  3N3K A;  1E2T A;  4NV7 A;  3IMA A;  3H7D A;  3CH3 X;  2NQG A;  3P5X A;  4QRX A;  1NQC A;  1EWO A;  2HH5 A;  2OZ2 A;  2XU3 A;  4CDE B;  4YYW A;  1CSB B;  3BWK A;  4YV8 A;  2AYN A;  2DC8 A;  2G6D A;  1F2B A;  2ATO A;  2FTD A;  4W5C A;  3K24 A;  1CTE A;  4NV8 A;  5JH3 A;  4PP1 A;  3CBK A;  1NB3 A;  2VFB A;  2P0R A;  1PIP A;  1NB5 A;  1QDQ A;  2VFC A;  3RVV A;  3P5V A;  5JA7 A;  2B1N A;  4RY2 A;  1ATK A;  3CBJ A;  3B79 A;  2F7D A;  2NQA A;  2BDL A;  1PCI A;  3O1G A;  3QSD A;  3I06 A;  1S4V A;  1QXP A;  3AI8 A;  5CVN B;  3CH2 X;  1Q6K A;  3HD3 A;  2IPP B;  1DF0 A;  3NHE A;  1MEM A;  1KHP A;  2E02 A;  3PNR A;  4DMY A;  1AYW A;  1PBH A;  2AUZ A;  1VSN A;  3DF0 A;  3IEJ A;  6PAD A;  3N3G A;  1YAL A;  3MOR A;  2JQG R;  4X6H A;  3K8U A;  1KFX L;  2PBH A;  1AU3 A;  2XU5 A;  2OUL A;  1BQI A;  4KLB A;  5FPW A;  1KFU L;  2C0Y A;  1CVZ A;  1PPN A;  3HHA A;  2R9O A;  3D6S A;  3KWZ A;  1PPP A;  1QOL A;  1Y4H A;  4OEM A;  1CQD A;  4CDF B;  3QT4 A;  4I07 A;  4HWY A;  4PAD A;  1AYU A;  2FUD A;  2G8J A;  3V6C A;  2R6N A;  2AS8 A;  1ZIV A;  1TLO A;  1ME4 A;  1THE A;  1STF E;  4W4U A;  3KSE A;  2DC7 A;  5CVO B;  3KFQ A;  3BPF A;  1PPD A;  4YYQ A;  1NL6 A;  3F5V A;  3ZUA A;  4YYV A;  3QJ3 A;  1U5I A;  3H89 A;  9PAP A;  4P6E A;  3LTW A;  3LFY A;  3H8B A;  3H6S A;  2AYO A;  2JQF R;  2VHS A;  1MS6 A;  2YJ2 A;  2DJG B;  2HHN A;  1O0E A;  4AXL A;  1DEU A;  2PAD A;  1PPO A;  4I04 A;  2FO5 A;  2FT2 A;  4ZUX U;  3BOW A;  1AIM A;  1MHW A;  1MEG A;  4BS5 A;  4CDD B;  1MDW A;  3E1Z B;  2FRQ A;  3D9W A;  1AU2 A;  3KKU A;  1EWP A;  2Y6E A;  8PCH A;  2G8E A;  2HXZ A;  1W4T A;  1AU4 A;  1EF7 A;  2YJB A;  1ICF A;  3WXF A;  4G54 A;  3IOQ A;  2OP3 A;  1YVB A;  2DC6 A;  2G7Y A;  4CDC B;  3P5U A;  1NLJ A;  1GCB A;  3OIS A;  5F02 A;  3O0U A;  3PDF A;  2DZY A;  2F1G A;  1BY8 A;  4YYU A;  1NPZ A;  2B1M A;  5EF4 A;  4B55 A;  1K3B B;  4YVA A;  1W6F A;  4N8W A;  1EWL A;  3IHP A;  2IBI A;  3USV A;  1CB5 A;  2YJ8 A;  3MHS A;  1PAD A;  1YK7 A;  1YK8 A;  1U9X A;  1MIR A;  4Q8G A;  1F29 A;  3WXG A;  2DJF B;  2HD5 A;  3BC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...