3BY4A

Structure of ovarian tumor (otu) domain in complex with ubiquitin
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
172
structure length
172
Chain Sequence
RVLKSTEMSIGGSGENVLSVHPVLDDNSCLFHAIAYGIFKQDSVRDLREMVSKEVLNNPVKFNDAILDKPNKDYAQWILKMESWGGAIEIGIISDALAVAIYVVDIDAVKIEKFNEDKFDNYILILFNGIHYDSLTMNEFKTVFNKNQPESDDVLTAALQLASNLKQTGYSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin thioesterase OTU1
publication title Structural basis for ubiquitin recognition by the Otu1 ovarian tumor domain protein
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle, hydrolase
total genus 48
structure length 172
sequence length 172
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2008-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3by4A00
4HXDB 3PSEA 3PRMA 3PHWA 3PHXA 3C0RA 3PHUA 3PRPA 3PT2A 3ZNHA 4BOSA 4BOPA 4BOUA 3BY4A 3TMPA 4BOZA 4BOQA 5JZEA
chains in the Genus database with same CATH superfamily
5CHTA 2IBIA 1AYVA 3N4CA 2FQ9A 5JA7A 4WURA 1F29A 1CQDA 1NPZA 3N3KA 1GCBA 1O0EA 3CBJA 2NQDB 4PT5A 4KLBA 4BS5A 3TRKA 1FH0A 4REZA 3AI8A 4RF1A 2F7DA 3OF8A 3PW3A 3E1ZB 4ZUXU 5EZQA 2G8EA 4MM3B 4MI7A 4OVZA 4CDCB 3BC3A 4I07A 2J7QA 1GECE 2YJ9A 1YALA 4MSXA 3K24A 5KO3A 1CPJA 1PXVA 4YYSA 2Y6EA 4OELA 4YYRA 1KHPA 4FIPA 2E01A 1POPA 1QOLA 1SP4B 3KSEA 3S3RA 4QH6A 3TNXA 2R9MA 5CHVA 2BDLA 4IP3A 1DKIA 5CVNB 4G54A 2R9OA 1GLOA 2P7UA 1AYWA 1TLOA 1EWMA 4YYVA 3MJ5A 4MZSA 1BGOA 3D6SA 2R9NA 3RVXA 1U9VA 1ZCMA 2DCDA 4BQVA 3C9EA 4QRXA 3KKUA 2DCBA 1Y08A 2YJCA 4HXDB 2AS8A 4RF0A 3QSDA 4PP2E 4D8BA 2VHSA 5E6JA 5PADA 2DZZA 3MTNA 3KW9A 4QRVA 1PBHA 1ICFA 2B1MA 3F75A 1TL9A 2FE8A 1BQIA 3RNVA 2C0YA 2B1NA 2HD5A 2HWKA 2FO5A 3MTVA 3PT2A 2FTDA 8PCHA 4MZOA 5FPWA 3PNRA 4BOSA 3KWZA 2HHNA 1Q6KA 2CB5A 3I06A 3RVVA 1ME3A 2YJBA 4N8WA 2NQGA 3IUTA 3HHIA 3ZNHA 1CTEA 2PNSA 3KX1A 1KFUL 1PPDA 2GHUA 1BP4A 3U8EA 4I05A 4AXLA 1YZBA 1GMYA 1MEMA 4PP1A 2R9CA 5CVOB 2BDZA 1YK7A 1AU2A 3E9SA 4PI3A 1XKGA 1AYUA 1PPOA 4DMXA 3H7DA 5JZEA 2AGAA 1U9XA 4I04A 3BPFA 2ARYA 4K7CA 3KWBX 2DCCA 3O65A 3OVZA 2XU1A 5J94A 2F1GA 4M0WA 2NQIA 1NQCA 2DJFB 4Q8GA 1MIRA 3IEJA 2R6NA 4RY2A 4X6HA 1PCIA 2DC7A 3P5VA 3W30A 4XZXA 1CV8A 1QDQA 1Y4HA 3P5XA 2DZYA 1EF7A 4QBBA 4FJCA 4ZTBA 9PAPA 4AXMA 1YT7A 2ACTA 3PHXA 2JQGR 4OVZB 1ATKA 2NQAA 1HUCB 1CVZA 3S3QA 3QJ3A 1DEUA 3IV2A 4CDEB 1VJVA 5JH3A 2FT2A 4W5CA 3O1GA 2YJ8A 3M99A 2GFOA 2BU3A 5A24A 3H8CA 3PHUA 3IFUA 2DC6A 3USVA 2DJGB 1EWLA 3HHAA 3MHSA 1A6RA 2XU5A 2IPPB 4N79A 4YYUA 5EF4A 2VHFA 4BPVA 4N4ZA 3O0UA 1IWDA 3BWKA 4X6JA 1U9WA 2O6XA 2R9FA 3W31A 5CVMA 1AIMA 4BOZA 1MHWA 1UKFA 3OF9A 1NB5A 1M6DA 1X9YA 3PHWA 4FK5A 3F5VA 4Q8HA 3K8UA 3PDFA 3MP2A 4OEMA 3C0RA 3P5UA 1CJLA 3IOQA 2BTWA 2UZJA 1S4VA 3V6EA 4BOPA 1CS8A 2PREA 6PADA 1NB3A 3PSEA 2FYEA 4A5UA 2P86A 1STFE 4OW0A 4DMYA 1KHQA 3B79A 5EGWA 2BTWB 1F2CA 1AU4A 4CDDB 2JTCA 2G6DA 4BS6A 1SNKA 2E03A 3OVXA 2G7YA 1JQPA 3K9MA 3NHEA 3CH3X 1AU3A 3GCBA 4P16A 4RKXA 1NLJA 3BBAA 1DF0A 4PADA 2DCAA 2E00A 2DC8A 2Y5BA 3DF0A 3MHHA 3V6CA 4P6GA 3WXFA 3I3TA 3HD3A 4GUAA 1ZIVA 4R3DA 1VSNA 3WXGA 2P0RA 1YK8A 2XU3A 4WA6A 4YV8A 5K16A 3RVWA 3PRPA 3WXEA 1F2BA 2WBFX 3N3GA 3LXSA 3TMPA 4QRGA 2YJ2A 2OP3A 3BPMA 3CBKA 1QXPA 4BOUA 4W5BA 3H8BA 2AYNA 3PRMA 2FRAA 2PADA 4BOQA 1EWPA 2AU1A 1KXRA 2FUDA 3QT4A 2OULA 1CSBB 7PCKA 2FRQA 3HWNA 1MS6A 2Z84A 2PBHA 2G8JA 2OZ2A 3IHPA 4YYWA 2AIMA 2AUXA 4BSQA 1K3BB 2DOSA 1PADA 2DC9A 2H7JA 2HXZA 1MEGA 1NL6A 2AYOA 4YVAA 1ME4A 4W4UA 3ERVA 4YYQA 2AVWA 2HH5A 1U5IA 1EWOA 2XU4A 4P6EA 3OQCA 1KFXL 3KFQA 2JRIA 1ITOA 3PBHA 2JQFR 4D8EA 3LFYA 1U9QX 4XR7A 3H89A 4IUMA 3BCNA 1PIPA 4CDFB 4HWYA 3CH2X 3MORA 3ZUAA 1F2AA 1PE6A 1MDWA 1YVBA 3BOWA 4XUIA 2ATOA 3P5WA 1PPPA 1PVJA 3B21A 3BY4A 2J7QC 1QMYA 1BY8A 4CZWA 1PPNA 5F02A 2CIOA 1THEA 1AECA 4X6IA 3OISA 1CB5A 2E02A 3BB7A 2AUZA 1AU0A 4RNAA 3H6SA 1TU6A 4D8IA 5EZSA 3IMAA
chains in the Genus database with same CATH topology
4BOSA 4WURA 2Z84A 4PT5A 3W31A 3TRKA 4BOZA 3ZNHA 2DOSA 4REZA 1UKFA 4RF1A 1YZBA 3PHWA 3MP2A 5EZQA 3E9SA 3C0RA 4MM3B 4MI7A 4OVZA 5JZEA 2BTWA 2AGAA 2UZJA 2J7QA 4BOPA 3OQCA 3PSEA 2JRIA 4A5UA 5KO3A 4OW0A 3O65A 2BTWB 4M0WA 4D8EA 2JTCA 4IP3A 1DKIA 3W30A 4IUMA 4XZXA 4P16A 4RKXA 3BBAA 3MJ5A 4ZTBA 3PHXA 4OVZB 4GUAA 4R3DA 4HXDB 1PVJA 3B21A 3BY4A 4RF0A 2J7QC 3PRPA 4D8BA 3TMPA 2BU3A 5E6JA 3PHUA 4BOUA 2FE8A 3IFUA 3RNVA 3BB7A 2HWKA 4RNAA 3PRMA 3MTVA 3PT2A 4D8IA 5EZSA 4BOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HXD B;  3PSE A;  3PRM A;  3PHW A;  3PHX A;  3C0R A;  3PHU A;  3PRP A;  3PT2 A;  3ZNH A;  4BOS A;  4BOP A;  4BOU A;  3BY4 A;  3TMP A;  4BOZ A;  4BOQ A;  5JZE A; 
#chains in the Genus database with same CATH topology
 5CHT A;  2IBI A;  1AYV A;  3N4C A;  2FQ9 A;  5JA7 A;  4WUR A;  1F29 A;  1CQD A;  1NPZ A;  3N3K A;  1GCB A;  1O0E A;  3CBJ A;  2NQD B;  4PT5 A;  4KLB A;  4BS5 A;  3TRK A;  1FH0 A;  4REZ A;  3AI8 A;  4RF1 A;  2F7D A;  3OF8 A;  3PW3 A;  3E1Z B;  4ZUX U;  5EZQ A;  2G8E A;  4MM3 B;  4MI7 A;  4OVZ A;  4CDC B;  3BC3 A;  4I07 A;  2J7Q A;  1GEC E;  2YJ9 A;  1YAL A;  4MSX A;  3K24 A;  5KO3 A;  1CPJ A;  1PXV A;  4YYS A;  2Y6E A;  4OEL A;  4YYR A;  1KHP A;  4FIP A;  2E01 A;  1POP A;  1QOL A;  1SP4 B;  3KSE A;  3S3R A;  4QH6 A;  3TNX A;  2R9M A;  5CHV A;  2BDL A;  4IP3 A;  1DKI A;  5CVN B;  4G54 A;  2R9O A;  1GLO A;  2P7U A;  1AYW A;  1TLO A;  1EWM A;  4YYV A;  3MJ5 A;  4MZS A;  1BGO A;  3D6S A;  2R9N A;  3RVX A;  1U9V A;  1ZCM A;  2DCD A;  4BQV A;  3C9E A;  4QRX A;  3KKU A;  2DCB A;  1Y08 A;  2YJC A;  4HXD B;  2AS8 A;  4RF0 A;  3QSD A;  4PP2 E;  4D8B A;  2VHS A;  5E6J A;  5PAD A;  2DZZ A;  3MTN A;  3KW9 A;  4QRV A;  1PBH A;  1ICF A;  2B1M A;  3F75 A;  1TL9 A;  2FE8 A;  1BQI A;  3RNV A;  2C0Y A;  2B1N A;  2HD5 A;  2HWK A;  2FO5 A;  3MTV A;  3PT2 A;  2FTD A;  8PCH A;  4MZO A;  5FPW A;  3PNR A;  4BOS A;  3KWZ A;  2HHN A;  1Q6K A;  2CB5 A;  3I06 A;  3RVV A;  1ME3 A;  2YJB A;  4N8W A;  2NQG A;  3IUT A;  3HHI A;  3ZNH A;  1CTE A;  2PNS A;  3KX1 A;  1KFU L;  1PPD A;  2GHU A;  1BP4 A;  3U8E A;  4I05 A;  4AXL A;  1YZB A;  1GMY A;  1MEM A;  4PP1 A;  2R9C A;  5CVO B;  2BDZ A;  1YK7 A;  1AU2 A;  3E9S A;  4PI3 A;  1XKG A;  1AYU A;  1PPO A;  4DMX A;  3H7D A;  5JZE A;  2AGA A;  1U9X A;  4I04 A;  3BPF A;  2ARY A;  4K7C A;  3KWB X;  2DCC A;  3O65 A;  3OVZ A;  2XU1 A;  5J94 A;  2F1G A;  4M0W A;  2NQI A;  1NQC A;  2DJF B;  4Q8G A;  1MIR A;  3IEJ A;  2R6N A;  4RY2 A;  4X6H A;  1PCI A;  2DC7 A;  3P5V A;  3W30 A;  4XZX A;  1CV8 A;  1QDQ A;  1Y4H A;  3P5X A;  2DZY A;  1EF7 A;  4QBB A;  4FJC A;  4ZTB A;  9PAP A;  4AXM A;  1YT7 A;  2ACT A;  3PHX A;  2JQG R;  4OVZ B;  1ATK A;  2NQA A;  1HUC B;  1CVZ A;  3S3Q A;  3QJ3 A;  1DEU A;  3IV2 A;  4CDE B;  1VJV A;  5JH3 A;  2FT2 A;  4W5C A;  3O1G A;  2YJ8 A;  3M99 A;  2GFO A;  2BU3 A;  5A24 A;  3H8C A;  3PHU A;  3IFU A;  2DC6 A;  3USV A;  2DJG B;  1EWL A;  3HHA A;  3MHS A;  1A6R A;  2XU5 A;  2IPP B;  4N79 A;  4YYU A;  5EF4 A;  2VHF A;  4BPV A;  4N4Z A;  3O0U A;  1IWD A;  3BWK A;  4X6J A;  1U9W A;  2O6X A;  2R9F A;  3W31 A;  5CVM A;  1AIM A;  4BOZ A;  1MHW A;  1UKF A;  3OF9 A;  1NB5 A;  1M6D A;  1X9Y A;  3PHW A;  4FK5 A;  3F5V A;  4Q8H A;  3K8U A;  3PDF A;  3MP2 A;  4OEM A;  3C0R A;  3P5U A;  1CJL A;  3IOQ A;  2BTW A;  2UZJ A;  1S4V A;  3V6E A;  4BOP A;  1CS8 A;  2PRE A;  6PAD A;  1NB3 A;  3PSE A;  2FYE A;  4A5U A;  2P86 A;  1STF E;  4OW0 A;  4DMY A;  1KHQ A;  3B79 A;  5EGW A;  2BTW B;  1F2C A;  1AU4 A;  4CDD B;  2JTC A;  2G6D A;  4BS6 A;  1SNK A;  2E03 A;  3OVX A;  2G7Y A;  1JQP A;  3K9M A;  3NHE A;  3CH3 X;  1AU3 A;  3GCB A;  4P16 A;  4RKX A;  1NLJ A;  3BBA A;  1DF0 A;  4PAD A;  2DCA A;  2E00 A;  2DC8 A;  2Y5B A;  3DF0 A;  3MHH A;  3V6C A;  4P6G A;  3WXF A;  3I3T A;  3HD3 A;  4GUA A;  1ZIV A;  4R3D A;  1VSN A;  3WXG A;  2P0R A;  1YK8 A;  2XU3 A;  4WA6 A;  4YV8 A;  5K16 A;  3RVW A;  3PRP A;  3WXE A;  1F2B A;  2WBF X;  3N3G A;  3LXS A;  3TMP A;  4QRG A;  2YJ2 A;  2OP3 A;  3BPM A;  3CBK A;  1QXP A;  4BOU A;  4W5B A;  3H8B A;  2AYN A;  3PRM A;  2FRA A;  2PAD A;  4BOQ A;  1EWP A;  2AU1 A;  1KXR A;  2FUD A;  3QT4 A;  2OUL A;  1CSB B;  7PCK A;  2FRQ A;  3HWN A;  1MS6 A;  2Z84 A;  2PBH A;  2G8J A;  2OZ2 A;  3IHP A;  4YYW A;  2AIM A;  2AUX A;  4BSQ A;  1K3B B;  2DOS A;  1PAD A;  2DC9 A;  2H7J A;  2HXZ A;  1MEG A;  1NL6 A;  2AYO A;  4YVA A;  1ME4 A;  4W4U A;  3ERV A;  4YYQ A;  2AVW A;  2HH5 A;  1U5I A;  1EWO A;  2XU4 A;  4P6E A;  3OQC A;  1KFX L;  3KFQ A;  2JRI A;  1ITO A;  3PBH A;  2JQF R;  4D8E A;  3LFY A;  1U9Q X;  4XR7 A;  3H89 A;  4IUM A;  3BCN A;  1PIP A;  4CDF B;  4HWY A;  3CH2 X;  3MOR A;  3ZUA A;  1F2A A;  1PE6 A;  1MDW A;  1YVB A;  3BOW A;  4XUI A;  2ATO A;  3P5W A;  1PPP A;  1PVJ A;  3B21 A;  3BY4 A;  2J7Q C;  1QMY A;  1BY8 A;  4CZW A;  1PPN A;  5F02 A;  2CIO A;  1THE A;  1AEC A;  4X6I A;  3OIS A;  1CB5 A;  2E02 A;  3BB7 A;  2AUZ A;  1AU0 A;  4RNA A;  3H6S A;  1TU6 A;  4D8I A;  5EZS A;  3IMA A; 
#chains in the Genus database with same CATH homology
 4BOS A;  4WUR A;  2Z84 A;  4PT5 A;  3W31 A;  3TRK A;  4BOZ A;  3ZNH A;  2DOS A;  4REZ A;  1UKF A;  4RF1 A;  1YZB A;  3PHW A;  3MP2 A;  5EZQ A;  3E9S A;  3C0R A;  4MM3 B;  4MI7 A;  4OVZ A;  5JZE A;  2BTW A;  2AGA A;  2UZJ A;  2J7Q A;  4BOP A;  3OQC A;  3PSE A;  2JRI A;  4A5U A;  5KO3 A;  4OW0 A;  3O65 A;  2BTW B;  4M0W A;  4D8E A;  2JTC A;  4IP3 A;  1DKI A;  3W30 A;  4IUM A;  4XZX A;  4P16 A;  4RKX A;  3BBA A;  3MJ5 A;  4ZTB A;  3PHX A;  4OVZ B;  4GUA A;  4R3D A;  4HXD B;  1PVJ A;  3B21 A;  3BY4 A;  4RF0 A;  2J7Q C;  3PRP A;  4D8B A;  3TMP A;  2BU3 A;  5E6J A;  3PHU A;  4BOU A;  2FE8 A;  3IFU A;  3RNV A;  3BB7 A;  2HWK A;  4RNA A;  3PRM A;  3MTV A;  3PT2 A;  4D8I A;  5EZS A;  4BOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...