3BY4A

Structure of ovarian tumor (otu) domain in complex with ubiquitin
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
172
structure length
172
Chain Sequence
RVLKSTEMSIGGSGENVLSVHPVLDDNSCLFHAIAYGIFKQDSVRDLREMVSKEVLNNPVKFNDAILDKPNKDYAQWILKMESWGGAIEIGIISDALAVAIYVVDIDAVKIEKFNEDKFDNYILILFNGIHYDSLTMNEFKTVFNKNQPESDDVLTAALQLASNLKQTGYSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for ubiquitin recognition by the Otu1 ovarian tumor domain protein
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle, hydrolase
molecule keywords Ubiquitin thioesterase OTU1
total genus 48
structure length 172
sequence length 172
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2008-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3by4A00
4BOUA 3PRMA 3BY4A 3PSEA 4BOZA 3PHWA 3ZNHA 4BOQA 3PT2A 4BOPA 3PHUA 3TMPA 3PHXA 4BOSA 5JZEA 3C0RA 3PRPA 4HXDB
chains in the Genus database with same CATH superfamily
3PNRA 3O0UA 1U5IA 3CBJA 2BTWA 4RNAA 3KW9A 3C0RA 2B1MA 2AYNA 2Y5BA 2DC6A 3I3TA 1EWMA 2PNSA 1SNKA 3N4CA 2BTWB 4YVAA 4IUMA 1YZBA 1CS8A 1HUCB 5FPWA 3OQCA 1QXPA 3MJ5A 1U9XA 3PSEA 4P6EA 3WXGA 4OVZA 3S3QA 2XU3A 2XU5A 4MM3B 1GLOA 2FUDA 2ATOA 2FQ9A 2HH5A 2VHFA 1IWDA 1F2CA 1X9YA 1U9WA 2G6DA 2AGAA 5EF4A 1TU6A 6PADA 1K3BB 1YVBA 4BS6A 1MEGA 2JTCA 2DCBA 2H7JA 2NQIA 4DMXA 1ICFA 1BY8A 4BOQA 1KHPA 3CH3X 3H7DA 2XU1A 1EF7A 4D8EA 4QH6A 3F5VA 1POPA 1F2AA 5EZQA 4P6GA 3IMAA 2DCAA 2BU3A 1AYUA 1ME3A 3V6CA 5J94A 1CVZA 3LFYA 3N3KA 3MHSA 2DZZA 1YALA 2FE8A 1AECA 4HXDB 3TRKA 3KWZA 3MHHA 4PP2E 1UKFA 1XKGA 4PT5A 1F2BA 1NLJA 4ZUXU 1CJLA 1ZIVA 4BQVA 4QRGA 3H8CA 1YK8A 3HD3A 1BQIA 3HHAA 1PXVA 1S4VA 1M6DA 3W30A 3BWKA 3IOQA 1ATKA 1YT7A 9PAPA 4BS5A 5EZSA 4A5UA 3V6EA 4RKXA 2FRAA 3N3GA 3M99A 4X6JA 4ZTBA 2R9FA 3PRMA 1AU2A 2YJ8A 4OW0A 3IFUA 4BOSA 2JRIA 1MHWA 2HWKA 4K7CA 3K9MA 3AI8A 1NQCA 4YV8A 3IUTA 2E02A 2NQGA 4AXMA 2OULA 4R3DA 1A6RA 2FT2A 4D8BA 8PCHA 3IEJA 1NPZA 4WA6A 4I07A 1CQDA 2R9OA 1EWOA 1DKIA 3O65A 4Q8HA 2OZ2A 2DC7A 3OF9A 1PPNA 2E03A 1PE6A 2IBIA 2GHUA 1Q6KA 1GCBA 4PADA 4XUIA 1NB5A 5CHVA 2YJBA 4OEMA 1ME4A 3H8BA 2R9NA 5EGWA 1Y08A 5A24A 2XU4A 4YYQA 7PCKA 3LXSA 1Y4HA 3PDFA 1BGOA 2AS8A 1MS6A 3QJ3A 2NQAA 1THEA 2NQDB 3IV2A 3OVZA 2OP3A 4FK5A 1DF0A 4KLBA 1O0EA 2JQGR 1ITOA 4REZA 4XZXA 5CHTA 3MTNA 1BP4A 5KO3A 2HD5A 2DJGB 3B79A 3HWNA 3RNVA 3OF8A 2DJFB 1EWLA 4X6IA 1MDWA 2AIMA 2ACTA 3RVXA 2AUZA 4M0WA 2J7QC 2FO5A 1CTEA 3DF0A 3CH2X 2G8EA 1PCIA 3TNXA 4N8WA 3BPFA 5JH3A 2CB5A 3WXEA 1SP4B 4YYRA 2DOSA 4QRXA 1F29A 1KHQA 2HHNA 2JQFR 1PIPA 4YYSA 4HWYA 3MTVA 4YYUA 3RVWA 1CV8A 5CVMA 3BBAA 3KKUA 2DC8A 3F75A 5E6JA 3PT2A 1KFUL 1PPOA 3P5UA 3D6SA 5JZEA 2E01A 4WURA 2R9CA 3ZUAA 4QBBA 2DCCA 4FIPA 2C0YA 4GUAA 3K8UA 4G54A 1CSBB 5CVOB 3BCNA 2G7YA 2F1GA 1YK7A 3QSDA 4BOPA 3TMPA 3E1ZB 3PBHA 3PRPA 4CDCB 2BDLA 2BDZA 1KFXL 1MIRA 4MI7A 3E9SA 4RY2A 1EWPA 2AUXA 2G8JA 4BOUA 3ZNHA 1VJVA 4MZSA 2FTDA 4RF0A 3H89A 5PADA 1NL6A 3OVXA 4W4UA 1U9VA 5K16A 4YYWA 4P16A 2FRQA 2O6XA 1QOLA 3O1GA 4Q8GA 3PHUA 1QMYA 2UZJA 3WXFA 4N4ZA 2B1NA 2Y6EA 2HXZA 1ZCMA 1TLOA 4PP1A 4I04A 2CIOA 3W31A 4CDEB 2AU1A 4N79A 4MZOA 2P0RA 3NHEA 3KX1A 2P86A 3PHWA 3OISA 1DEUA 2IPPB 2J7QA 3IHPA 1GECE 4OVZB 4BSQA 3I06A 1AIMA 1PVJA 2AYOA 4MSXA 1QDQA 2DC9A 4W5BA 1TL9A 4CDFB 3PHXA 4OELA 2DZYA 4QRVA 3MORA 3BPMA 1PPPA 3RVVA 3P5WA 3K24A 1PADA 1KXRA 4W5CA 2PREA 5CVNB 2PBHA 2ARYA 1JQPA 1CB5A 3PW3A 5F02A 1AU4A 1AU3A 4DMYA 3S3RA 2YJ9A 4IP3A 1U9QX 3KWBX 3ERVA 2FYEA 3BB7A 3GCBA 1AYVA 2F7DA 3U8EA 3USVA 4I05A 1PBHA 1CPJA 3BOWA 5JA7A 3BC3A 2YJCA 4CDDB 3H6SA 1VSNA 2P7UA 4RF1A 4CZWA 3MP2A 2YJ2A 2PADA 4YYVA 3P5VA 1AYWA 2Z84A 4FJCA 4BOZA 2WBFX 3HHIA 4AXLA 2GFOA 2R9MA 3P5XA 1MEMA 3KSEA 4D8IA 4X6HA 1AU0A 4PI3A 1FH0A 4BPVA 3B21A 2VHSA 3C9EA 3BY4A 3CBKA 1GMYA 2AVWA 3QT4A 2DCDA 2E00A 4XR7A 1PPDA 1STFE 2R6NA 1NB3A 3KFQA
chains in the Genus database with same CATH topology
4RF0A 3TRKA 2Z84A 5KO3A 3PSEA 4BOZA 3BB7A 4R3DA 5E6JA 3W31A 3PT2A 3RNVA 1UKFA 3W30A 2BTWA 3TMPA 4BOPA 4BOQA 4PT5A 4RNAA 3C0RA 4D8BA 3PRPA 4OVZA 5EZSA 4P16A 5JZEA 4D8EA 4A5UA 4D8IA 4WURA 3PHWA 4RKXA 4MM3B 2DOSA 3PHUA 3B21A 4M0WA 4ZTBA 5EZQA 2J7QC 4GUAA 2BTWB 1DKIA 3O65A 3BY4A 3PRMA 2UZJA 4MI7A 4OW0A 2BU3A 4IUMA 1YZBA 2J7QA 2AGAA 3E9SA 3IFUA 2JRIA 3MTVA 4RF1A 4OVZB 3MP2A 4BOSA 2HWKA 4BOUA 1PVJA 4REZA 3ZNHA 3BBAA 4IP3A 4XZXA 2FE8A 3PHXA 3OQCA 2JTCA 3MJ5A 4HXDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BOU A;  3PRM A;  3BY4 A;  3PSE A;  4BOZ A;  3PHW A;  3ZNH A;  4BOQ A;  3PT2 A;  4BOP A;  3PHU A;  3TMP A;  3PHX A;  4BOS A;  5JZE A;  3C0R A;  3PRP A;  4HXD B; 
#chains in the Genus database with same CATH topology
 3PNR A;  3O0U A;  1U5I A;  3CBJ A;  2BTW A;  4RNA A;  3KW9 A;  3C0R A;  2B1M A;  2AYN A;  2Y5B A;  2DC6 A;  3I3T A;  1EWM A;  2PNS A;  1SNK A;  3N4C A;  2BTW B;  4YVA A;  4IUM A;  1YZB A;  1CS8 A;  1HUC B;  5FPW A;  3OQC A;  1QXP A;  3MJ5 A;  1U9X A;  3PSE A;  4P6E A;  3WXG A;  4OVZ A;  3S3Q A;  2XU3 A;  2XU5 A;  4MM3 B;  1GLO A;  2FUD A;  2ATO A;  2FQ9 A;  2HH5 A;  2VHF A;  1IWD A;  1F2C A;  1X9Y A;  1U9W A;  2G6D A;  2AGA A;  5EF4 A;  1TU6 A;  6PAD A;  1K3B B;  1YVB A;  4BS6 A;  1MEG A;  2JTC A;  2DCB A;  2H7J A;  2NQI A;  4DMX A;  1ICF A;  1BY8 A;  4BOQ A;  1KHP A;  3CH3 X;  3H7D A;  2XU1 A;  1EF7 A;  4D8E A;  4QH6 A;  3F5V A;  1POP A;  1F2A A;  5EZQ A;  4P6G A;  3IMA A;  2DCA A;  2BU3 A;  1AYU A;  1ME3 A;  3V6C A;  5J94 A;  1CVZ A;  3LFY A;  3N3K A;  3MHS A;  2DZZ A;  1YAL A;  2FE8 A;  1AEC A;  4HXD B;  3TRK A;  3KWZ A;  3MHH A;  4PP2 E;  1UKF A;  1XKG A;  4PT5 A;  1F2B A;  1NLJ A;  4ZUX U;  1CJL A;  1ZIV A;  4BQV A;  4QRG A;  3H8C A;  1YK8 A;  3HD3 A;  1BQI A;  3HHA A;  1PXV A;  1S4V A;  1M6D A;  3W30 A;  3BWK A;  3IOQ A;  1ATK A;  1YT7 A;  9PAP A;  4BS5 A;  5EZS A;  4A5U A;  3V6E A;  4RKX A;  2FRA A;  3N3G A;  3M99 A;  4X6J A;  4ZTB A;  2R9F A;  3PRM A;  1AU2 A;  2YJ8 A;  4OW0 A;  3IFU A;  4BOS A;  2JRI A;  1MHW A;  2HWK A;  4K7C A;  3K9M A;  3AI8 A;  1NQC A;  4YV8 A;  3IUT A;  2E02 A;  2NQG A;  4AXM A;  2OUL A;  4R3D A;  1A6R A;  2FT2 A;  4D8B A;  8PCH A;  3IEJ A;  1NPZ A;  4WA6 A;  4I07 A;  1CQD A;  2R9O A;  1EWO A;  1DKI A;  3O65 A;  4Q8H A;  2OZ2 A;  2DC7 A;  3OF9 A;  1PPN A;  2E03 A;  1PE6 A;  2IBI A;  2GHU A;  1Q6K A;  1GCB A;  4PAD A;  4XUI A;  1NB5 A;  5CHV A;  2YJB A;  4OEM A;  1ME4 A;  3H8B A;  2R9N A;  5EGW A;  1Y08 A;  5A24 A;  2XU4 A;  4YYQ A;  7PCK A;  3LXS A;  1Y4H A;  3PDF A;  1BGO A;  2AS8 A;  1MS6 A;  3QJ3 A;  2NQA A;  1THE A;  2NQD B;  3IV2 A;  3OVZ A;  2OP3 A;  4FK5 A;  1DF0 A;  4KLB A;  1O0E A;  2JQG R;  1ITO A;  4REZ A;  4XZX A;  5CHT A;  3MTN A;  1BP4 A;  5KO3 A;  2HD5 A;  2DJG B;  3B79 A;  3HWN A;  3RNV A;  3OF8 A;  2DJF B;  1EWL A;  4X6I A;  1MDW A;  2AIM A;  2ACT A;  3RVX A;  2AUZ A;  4M0W A;  2J7Q C;  2FO5 A;  1CTE A;  3DF0 A;  3CH2 X;  2G8E A;  1PCI A;  3TNX A;  4N8W A;  3BPF A;  5JH3 A;  2CB5 A;  3WXE A;  1SP4 B;  4YYR A;  2DOS A;  4QRX A;  1F29 A;  1KHQ A;  2HHN A;  2JQF R;  1PIP A;  4YYS A;  4HWY A;  3MTV A;  4YYU A;  3RVW A;  1CV8 A;  5CVM A;  3BBA A;  3KKU A;  2DC8 A;  3F75 A;  5E6J A;  3PT2 A;  1KFU L;  1PPO A;  3P5U A;  3D6S A;  5JZE A;  2E01 A;  4WUR A;  2R9C A;  3ZUA A;  4QBB A;  2DCC A;  4FIP A;  2C0Y A;  4GUA A;  3K8U A;  4G54 A;  1CSB B;  5CVO B;  3BCN A;  2G7Y A;  2F1G A;  1YK7 A;  3QSD A;  4BOP A;  3TMP A;  3E1Z B;  3PBH A;  3PRP A;  4CDC B;  2BDL A;  2BDZ A;  1KFX L;  1MIR A;  4MI7 A;  3E9S A;  4RY2 A;  1EWP A;  2AUX A;  2G8J A;  4BOU A;  3ZNH A;  1VJV A;  4MZS A;  2FTD A;  4RF0 A;  3H89 A;  5PAD A;  1NL6 A;  3OVX A;  4W4U A;  1U9V A;  5K16 A;  4YYW A;  4P16 A;  2FRQ A;  2O6X A;  1QOL A;  3O1G A;  4Q8G A;  3PHU A;  1QMY A;  2UZJ A;  3WXF A;  4N4Z A;  2B1N A;  2Y6E A;  2HXZ A;  1ZCM A;  1TLO A;  4PP1 A;  4I04 A;  2CIO A;  3W31 A;  4CDE B;  2AU1 A;  4N79 A;  4MZO A;  2P0R A;  3NHE A;  3KX1 A;  2P86 A;  3PHW A;  3OIS A;  1DEU A;  2IPP B;  2J7Q A;  3IHP A;  1GEC E;  4OVZ B;  4BSQ A;  3I06 A;  1AIM A;  1PVJ A;  2AYO A;  4MSX A;  1QDQ A;  2DC9 A;  4W5B A;  1TL9 A;  4CDF B;  3PHX A;  4OEL A;  2DZY A;  4QRV A;  3MOR A;  3BPM A;  1PPP A;  3RVV A;  3P5W A;  3K24 A;  1PAD A;  1KXR A;  4W5C A;  2PRE A;  5CVN B;  2PBH A;  2ARY A;  1JQP A;  1CB5 A;  3PW3 A;  5F02 A;  1AU4 A;  1AU3 A;  4DMY A;  3S3R A;  2YJ9 A;  4IP3 A;  1U9Q X;  3KWB X;  3ERV A;  2FYE A;  3BB7 A;  3GCB A;  1AYV A;  2F7D A;  3U8E A;  3USV A;  4I05 A;  1PBH A;  1CPJ A;  3BOW A;  5JA7 A;  3BC3 A;  2YJC A;  4CDD B;  3H6S A;  1VSN A;  2P7U A;  4RF1 A;  4CZW A;  3MP2 A;  2YJ2 A;  2PAD A;  4YYV A;  3P5V A;  1AYW A;  2Z84 A;  4FJC A;  4BOZ A;  2WBF X;  3HHI A;  4AXL A;  2GFO A;  2R9M A;  3P5X A;  1MEM A;  3KSE A;  4D8I A;  4X6H A;  1AU0 A;  4PI3 A;  1FH0 A;  4BPV A;  3B21 A;  2VHS A;  3C9E A;  3BY4 A;  3CBK A;  1GMY A;  2AVW A;  3QT4 A;  2DCD A;  2E00 A;  4XR7 A;  1PPD A;  1STF E;  2R6N A;  1NB3 A;  3KFQ A; 
#chains in the Genus database with same CATH homology
 4RF0 A;  3TRK A;  2Z84 A;  5KO3 A;  3PSE A;  4BOZ A;  3BB7 A;  4R3D A;  5E6J A;  3W31 A;  3PT2 A;  3RNV A;  1UKF A;  3W30 A;  2BTW A;  3TMP A;  4BOP A;  4BOQ A;  4PT5 A;  4RNA A;  3C0R A;  4D8B A;  3PRP A;  4OVZ A;  5EZS A;  4P16 A;  5JZE A;  4D8E A;  4A5U A;  4D8I A;  4WUR A;  3PHW A;  4RKX A;  4MM3 B;  2DOS A;  3PHU A;  3B21 A;  4M0W A;  4ZTB A;  5EZQ A;  2J7Q C;  4GUA A;  2BTW B;  1DKI A;  3O65 A;  3BY4 A;  3PRM A;  2UZJ A;  4MI7 A;  4OW0 A;  2BU3 A;  4IUM A;  1YZB A;  2J7Q A;  2AGA A;  3E9S A;  3IFU A;  2JRI A;  3MTV A;  4RF1 A;  4OVZ B;  3MP2 A;  4BOS A;  2HWK A;  4BOU A;  1PVJ A;  4REZ A;  3ZNH A;  3BBA A;  4IP3 A;  4XZX A;  2FE8 A;  3PHX A;  3OQC A;  2JTC A;  3MJ5 A;  4HXD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...