2FQ9A

Cathepsin s with nitrile inhibitor
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
218
structure length
218
Chain Sequence
ILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cathepsin S with nitrile inhibitor
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords cathepsin S
total genus 70
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2006-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2fq9A00
2G7YA 2YJBA 5F02A 1STFE 3LFYA 1YT7A 4BPVA 3I06A 4YVAA 2NQAA 1AU4A 1NB5A 2P7UA 5CVMA 2XU3A 1ME3A 4Q8HA 3S3RA 3P5WA 3HWNA 3OF9A 2AS8A 2PREA 3RVXA 4N79A 2VHFA 4FK5A 4QRGA 3IUTA 1K3BB 2Y6EA 4YYUA 2YJ9A 3WXGA 3H7DA 4CDFB 1U9WA 4YYSA 2FYEA 2E02A 3S3QA 3ZUAA 2DCCA 2R9OA 2FTDA 1KFXL 2IPPB 3KW9A 1PPPA 1X9YA 1NQCA 4CDEB 3MHHA 2PNSA 4PP2E 3H6SA 3O0UA 3RVVA 3KX1A 2GHUA 3OVZA 4WA6A 3PDFA 2PBHA 2P0RA 4MZSA 2DC7A 1TLOA 2WBFX 3BCNA 1ATKA 1ZCMA 2YJCA 2GFOA 1GMYA 1KXRA 1VSNA 3IV2A 1U9XA 2BDZA 1PPNA 1CJLA 1AIMA 3OISA 4QRXA 3K24A 4PP1A 2AUXA 2FRAA 1XKGA 4BQVA 2P86A 4DMXA 1F29A 5JA7A 4N4ZA 2XU1A 3OF8A 2JQGR 4W5CA 4X6IA 3O1GA 1JQPA 4XUIA 5JH3A 2BDLA 2G8EA 1NB3A 3IEJA 3K8UA 4I04A 2HHNA 2Y5BA 4W4UA 3M99A 2E00A 8PCHA 1M6DA 1YVBA 3WXFA 1NLJA 2DC9A 1SP4B 1Y08A 3USVA 3KFQA 1CPJA 1F2AA 1QMYA 4MSXA 4P6GA 2ATOA 2VHSA 2NQIA 2O6XA 4Q8GA 5J94A 1QXPA 1CB5A 3QSDA 4XR7A 3MHSA 3BOWA 4K7CA 1MDWA 5CVOB 2B1MA 2JQFR 1PCIA 3P5UA 2NQDB 1U9QX 2ARYA 4AXLA 1QDQA 3QT4A 1U9VA 4QBBA 4I07A 3N4CA 2FQ9A 2DC6A 3BPFA 1MHWA 1EWPA 3TNXA 2ACTA 2PADA 3P5VA 1NPZA 2CIOA 5EF4A 4QH6A 5A24A 7PCKA 4CDCB 2CB5A 1YALA 1Q6KA 1AYUA 1O0EA 1AYWA 4CZWA 3K9MA 4YYQA 1POPA 3U8EA 2YJ8A 1PXVA 1PPOA 3N3KA 2DJFB 1ITOA 1VJVA 1GCBA 4PADA 1MIRA 1AU3A 1MEGA 3PW3A 2HXZA 1CTEA 1F2CA 1AU0A 1NL6A 5CHVA 1GECE 2AUZA 3KWBX 5PADA 4I05A 3N3GA 4MZOA 3IOQA 2AIMA 3I3TA 3PBHA 1PPDA 2OP3A 3P5XA 1EWMA 2F1GA 3KKUA 4AXMA 1TL9A 2G6DA 2DZZA 2AVWA 2FRQA 3LXSA 4YYWA 4W5BA 3V6CA 2FUDA 1TU6A 3GCBA 1BP4A 1PIPA 1BQIA 3AI8A 3WXEA 2AYOA 5FPWA 3H89A 3IMAA 2F7DA 2YJ2A 1CVZA 1PBHA 1AECA 1ME4A 1PADA 3BPMA 2DCBA 3HHIA 4KLBA 1S4VA 3CH3X 2XU5A 4BS5A 1F2BA 1THEA 2R9CA 1QOLA 3NHEA 1EWOA 3B79A 5K16A 1MS6A 1FH0A 1KHPA 1YK7A 2H7JA 1HUCB 3BWKA 1Y4HA 2DC8A 2XU4A 5CHTA 3OVXA 1YK8A 3PNRA 1GLOA 1CSBB 4FIPA 3D6SA 2OZ2A 4RY2A 4HWYA 4YYVA 1U5IA 4BS6A 2AYNA 3C9EA 4X6JA 2C0YA 2DZYA 3BC3A 3H8CA 4YYRA 1ICFA 4ZUXU 1ZIVA 2G8JA 3QJ3A 3MTNA 4BSQA 2DCAA 1BY8A 5CVNB 1CS8A 1DF0A 3CH2X 2AU1A 2B1NA 2IBIA 2R6NA 3CBKA 3ERVA 2NQGA 2DCDA 4OELA 3DF0A 2FO5A 2FT2A 1CV8A 4G54A 2HD5A 2R9NA 4OEMA 2E01A 1DEUA 4P6EA 4DMYA 4FJCA 1SNKA 3F75A 1PE6A 1IWDA 3H8BA 4YV8A 1KHQA 4QRVA 3HHAA 2R9MA 1EWLA 1AU2A 1AYVA 3IHPA 4X6HA 2R9FA 3KSEA 3HD3A 6PADA 1CQDA 1MEMA 3V6EA 1BGOA 2HH5A 3CBJA 3KWZA 4N8WA 1A6RA 9PAPA 3F5VA 4PI3A 2E03A 3RVWA 4CDDB 5EGWA 3E1ZB 2DJGB 1EF7A 2OULA 3MORA 1KFUL
chains in the Genus database with same CATH superfamily
2G7YA 2YJBA 5F02A 1STFE 3LFYA 1YT7A 4BPVA 3I06A 4YVAA 3TRKA 2NQAA 1AU4A 1NB5A 3ZNHA 2P7UA 5CVMA 2XU3A 1ME3A 3BB7A 4Q8HA 3S3RA 3P5WA 3HWNA 3OF9A 2AS8A 2PREA 3RVXA 3PHUA 4N79A 2VHFA 4FK5A 4QRGA 3IUTA 4BOZA 1K3BB 2Y6EA 4YYUA 2YJ9A 2BTWA 3WXGA 3H7DA 4CDFB 1U9WA 3TMPA 4YYSA 2BU3A 2FYEA 2E02A 3S3QA 3ZUAA 2DCCA 2R9OA 2FTDA 1KFXL 2IPPB 3KW9A 1PPPA 1X9YA 1NQCA 4CDEB 3E9SA 3MHHA 4OVZA 2PNSA 4PP2E 3H6SA 3O0UA 3RVVA 3KX1A 3O65A 2GHUA 3OVZA 3MP2A 4REZA 4WA6A 3PDFA 2PBHA 2P0RA 4MZSA 2DC7A 1TLOA 3RNVA 2WBFX 3BCNA 1ATKA 2Z84A 1ZCMA 2YJCA 2GFOA 1GMYA 1KXRA 1VSNA 3IV2A 1U9XA 2BDZA 4WURA 1PPNA 4BOSA 3C0RA 4HXDB 1CJLA 1AIMA 3OISA 4QRXA 3K24A 4PP1A 2AUXA 2FRAA 1XKGA 4R3DA 4BQVA 2P86A 4DMXA 1F29A 5JA7A 4XZXA 4N4ZA 2XU1A 3OF8A 2JQGR 3PSEA 4W5CA 4P16A 4X6IA 3O1GA 4BOUA 1JQPA 4XUIA 5JH3A 2BDLA 4D8BA 2G8EA 3MTVA 1NB3A 3IEJA 3K8UA 4I04A 2HHNA 2Y5BA 4W4UA 3M99A 2E00A 8PCHA 2J7QA 4OVZB 2DOSA 1M6DA 1YVBA 4IUMA 3WXFA 1NLJA 2DC9A 1SP4B 1Y08A 3USVA 3KFQA 1CPJA 1F2AA 3W30A 2AGAA 4PT5A 1QMYA 4MSXA 4P6GA 2ATOA 2VHSA 2NQIA 3PRMA 2O6XA 4Q8GA 5J94A 1QXPA 1CB5A 3QSDA 4XR7A 3MHSA 3BOWA 5EZSA 4K7CA 1MDWA 5CVOB 2B1MA 2JQFR 1PCIA 3P5UA 2NQDB 4A5UA 1U9QX 2ARYA 4AXLA 1QDQA 3QT4A 1U9VA 4I07A 4QBBA 3N4CA 2FQ9A 2DC6A 2J7QC 3BPFA 1MHWA 1EWPA 3TNXA 2ACTA 2PADA 3P5VA 1NPZA 2CIOA 5EF4A 4QH6A 5A24A 7PCKA 4CDCB 2CB5A 1YALA 3BY4A 1Q6KA 1AYUA 4M0WA 1O0EA 1AYWA 4CZWA 3K9MA 4YYQA 1POPA 3U8EA 2YJ8A 1PXVA 1PPOA 3N3KA 2DJFB 1ITOA 1VJVA 1GCBA 4PADA 1MIRA 3MJ5A 1AU3A 1MEGA 3PW3A 2HXZA 1CTEA 1F2CA 1AU0A 1NL6A 5E6JA 5CHVA 1GECE 2AUZA 3KWBX 5PADA 4I05A 3N3GA 4MZOA 3IOQA 2AIMA 3I3TA 3PBHA 1PPDA 2OP3A 3P5XA 1EWMA 2F1GA 3KKUA 4AXMA 1TL9A 2G6DA 2DZZA 2AVWA 2FRQA 4D8EA 3LXSA 4YYWA 4W5BA 3V6CA 2FUDA 1TU6A 3GCBA 1BP4A 1PIPA 1BQIA 3AI8A 3WXEA 2AYOA 5FPWA 3H89A 4RF0A 3IMAA 2F7DA 2YJ2A 1CVZA 1PBHA 1AECA 1ME4A 1PADA 3BPMA 2DCBA 3HHIA 4RKXA 4KLBA 3B21A 1S4VA 3CH3X 2XU5A 1YZBA 4BS5A 1F2BA 1THEA 2R9CA 4RNAA 1QOLA 3NHEA 1EWOA 4D8IA 4MM3B 3B79A 5K16A 1MS6A 1FH0A 3W31A 1KHPA 1YK7A 2H7JA 1HUCB 3BWKA 4BOQA 1Y4HA 2DC8A 4GUAA 2XU4A 5CHTA 3OVXA 1YK8A 3PNRA 1GLOA 1CSBB 4FIPA 3D6SA 2OZ2A 4RY2A 4HWYA 4YYVA 1U5IA 4BS6A 2AYNA 3C9EA 4X6JA 2UZJA 3PHWA 2C0YA 3IFUA 2DZYA 3BC3A 3H8CA 4YYRA 1ICFA 4ZUXU 1ZIVA 2G8JA 3QJ3A 3MTNA 4BSQA 2DCAA 1BY8A 5CVNB 4MI7A 1CS8A 1DF0A 3CH2X 2AU1A 2B1NA 2IBIA 2R6NA 3CBKA 3ERVA 2NQGA 4BOPA 2DCDA 4OELA 3DF0A 3PRPA 4ZTBA 2FO5A 1DKIA 2FT2A 1CV8A 4G54A 2HD5A 2R9NA 2JRIA 4OEMA 3PHXA 2FE8A 2E01A 1DEUA 4P6EA 3OQCA 4DMYA 4FJCA 3BBAA 1SNKA 3F75A 1PE6A 5EZQA 4OW0A 1IWDA 3H8BA 4YV8A 1KHQA 2JTCA 4QRVA 3HHAA 2R9MA 1EWLA 1AU2A 1UKFA 3PT2A 4RF1A 1AYVA 3IHPA 5JZEA 5KO3A 4X6HA 2R9FA 3KSEA 3HD3A 6PADA 1CQDA 1MEMA 3V6EA 1BGOA 2HH5A 2HWKA 3CBJA 3KWZA 4N8WA 4IP3A 1A6RA 9PAPA 3F5VA 4PI3A 2E03A 3RVWA 4CDDB 5EGWA 3E1ZB 2BTWB 2DJGB 1EF7A 2OULA 3MORA 1PVJA 1KFUL
chains in the Genus database with same CATH topology
2G7YA 2YJBA 5F02A 1STFE 3LFYA 1YT7A 4BPVA 3I06A 4YVAA 1W4TA 2NQAA 1AU4A 1NB5A 2P7UA 5CVMA 2XU3A 1ME3A 4Q8HA 3S3RA 3P5WA 3HWNA 3OF9A 2AS8A 2PREA 3RVXA 4N79A 2VHFA 4FK5A 4QRGA 3IUTA 1K3BB 2Y6EA 4YYUA 2VFBA 2YJ9A 3WXGA 3H7DA 4CDFB 1U9WA 4YYSA 2FYEA 2E02A 3S3QA 3ZUAA 2DCCA 2R9OA 2FTDA 4NV8A 1KFXL 2IPPB 3KW9A 1PPPA 1X9YA 1NQCA 4CDEB 3MHHA 2PNSA 4PP2E 3H6SA 3O0UA 3RVVA 3KX1A 2GHUA 3OVZA 4WA6A 2BSZA 3PDFA 2PBHA 2P0RA 2VFCA 4MZSA 2DC7A 1TLOA 2WBFX 3BCNA 1ATKA 1ZCMA 2YJCA 2GFOA 1W5RA 1GMYA 1KXRA 4GUZA 1VSNA 3IV2A 1U9XA 2BDZA 1PPNA 1CJLA 1AIMA 3OISA 4QRXA 3K24A 4PP1A 2AUXA 2FRAA 1XKGA 4BQVA 2P86A 4DMXA 1F29A 5JA7A 4N4ZA 2XU1A 3OF8A 2JQGR 4W5CA 4X6IA 3O1GA 1JQPA 4XUIA 5JH3A 2BDLA 2G8EA 1NB3A 3IEJA 3K8UA 4I04A 2HHNA 2Y5BA 4W4UA 3M99A 2E00A 1E2TA 8PCHA 1M6DA 1YVBA 3WXFA 3D9WA 1NLJA 2DC9A 1SP4B 1Y08A 3USVA 3KFQA 1CPJA 1F2AA 1QMYA 4MSXA 4P6GA 2ATOA 2VHSA 2NQIA 2O6XA 4Q8GA 5J94A 1QXPA 1CB5A 3QSDA 4XR7A 3MHSA 3BOWA 4K7CA 1MDWA 5CVOB 2B1MA 2JQFR 1PCIA 3P5UA 2NQDB 1U9QX 2ARYA 4AXLA 1QDQA 3QT4A 1U9VA 4QBBA 4I07A 3N4CA 2FQ9A 2DC6A 3BPFA 1MHWA 1EWPA 3TNXA 2ACTA 2PADA 3P5VA 1NPZA 2CIOA 5EF4A 4QH6A 4C5PA 5A24A 7PCKA 4CDCB 2CB5A 1YALA 1Q6KA 1AYUA 1O0EA 1AYWA 4CZWA 3K9MA 4YYQA 1POPA 3U8EA 2YJ8A 1PXVA 1PPOA 3N3KA 2DJFB 1ITOA 1VJVA 1GCBA 4PADA 1MIRA 1AU3A 1MEGA 3PW3A 2HXZA 1CTEA 1F2CA 1AU0A 1NL6A 5CHVA 1GECE 2AUZA 3KWBX 5PADA 4I05A 3N3GA 4MZOA 3IOQA 2AIMA 3I3TA 3PBHA 1PPDA 2OP3A 3P5XA 1EWMA 2F1GA 3KKUA 4AXMA 1TL9A 2G6DA 2DZZA 2AVWA 2FRQA 3LXSA 4YYWA 4W5BA 3V6CA 2FUDA 1TU6A 3GCBA 1BP4A 1PIPA 1BQIA 3AI8A 3WXEA 2AYOA 5FPWA 4B55A 3H89A 3IMAA 2F7DA 2YJ2A 1CVZA 1PBHA 1AECA 1ME4A 1PADA 3BPMA 2DCBA 3HHIA 4KLBA 1S4VA 3CH3X 2XU5A 4BS5A 1F2BA 1THEA 2R9CA 1QOLA 3NHEA 1EWOA 3B79A 5K16A 1MS6A 1FH0A 1KHPA 1YK7A 2H7JA 1HUCB 3BWKA 1Y4HA 2DC8A 2XU4A 5CHTA 3OVXA 1YK8A 3PNRA 1GLOA 1CSBB 4FIPA 3D6SA 1W6FA 2OZ2A 4RY2A 4HWYA 4YYVA 1U5IA 4BS6A 1GX3A 2AYNA 3C9EA 4X6JA 2C0YA 2DZYA 3BC3A 3H8CA 4YYRA 1ICFA 4ZUXU 1ZIVA 2G8JA 3QJ3A 3MTNA 4BSQA 2DCAA 1BY8A 5CVNB 1CS8A 1DF0A 3CH2X 2AU1A 2B1NA 2IBIA 2R6NA 3CBKA 3ERVA 2NQGA 2DCDA 4OELA 3DF0A 4BGFA 2FO5A 2FT2A 1CV8A 4G54A 2HD5A 2R9NA 4OEMA 2E01A 1DEUA 4P6EA 4DMYA 4FJCA 1SNKA 3F75A 1PE6A 1IWDA 3H8BA 4YV8A 1KHQA 4QRVA 3HHAA 2R9MA 1EWLA 1AU2A 1AYVA 3IHPA 4X6HA 2R9FA 3KSEA 4NV7A 3HD3A 6PADA 1CQDA 3LTWA 1MEMA 3V6EA 1BGOA 2HH5A 3CBJA 3KWZA 4N8WA 1A6RA 9PAPA 3F5VA 4PI3A 2E03A 3RVWA 4CDDB 5EGWA 3E1ZB 2DJGB 1EF7A 2OULA 3MORA 1KFUL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G7Y A;  2YJB A;  5F02 A;  1STF E;  3LFY A;  1YT7 A;  4BPV A;  3I06 A;  4YVA A;  2NQA A;  1AU4 A;  1NB5 A;  2P7U A;  5CVM A;  2XU3 A;  1ME3 A;  4Q8H A;  3S3R A;  3P5W A;  3HWN A;  3OF9 A;  2AS8 A;  2PRE A;  3RVX A;  4N79 A;  2VHF A;  4FK5 A;  4QRG A;  3IUT A;  1K3B B;  2Y6E A;  4YYU A;  2YJ9 A;  3WXG A;  3H7D A;  4CDF B;  1U9W A;  4YYS A;  2FYE A;  2E02 A;  3S3Q A;  3ZUA A;  2DCC A;  2R9O A;  2FTD A;  1KFX L;  2IPP B;  3KW9 A;  1PPP A;  1X9Y A;  1NQC A;  4CDE B;  3MHH A;  2PNS A;  4PP2 E;  3H6S A;  3O0U A;  3RVV A;  3KX1 A;  2GHU A;  3OVZ A;  4WA6 A;  3PDF A;  2PBH A;  2P0R A;  4MZS A;  2DC7 A;  1TLO A;  2WBF X;  3BCN A;  1ATK A;  1ZCM A;  2YJC A;  2GFO A;  1GMY A;  1KXR A;  1VSN A;  3IV2 A;  1U9X A;  2BDZ A;  1PPN A;  1CJL A;  1AIM A;  3OIS A;  4QRX A;  3K24 A;  4PP1 A;  2AUX A;  2FRA A;  1XKG A;  4BQV A;  2P86 A;  4DMX A;  1F29 A;  5JA7 A;  4N4Z A;  2XU1 A;  3OF8 A;  2JQG R;  4W5C A;  4X6I A;  3O1G A;  1JQP A;  4XUI A;  5JH3 A;  2BDL A;  2G8E A;  1NB3 A;  3IEJ A;  3K8U A;  4I04 A;  2HHN A;  2Y5B A;  4W4U A;  3M99 A;  2E00 A;  8PCH A;  1M6D A;  1YVB A;  3WXF A;  1NLJ A;  2DC9 A;  1SP4 B;  1Y08 A;  3USV A;  3KFQ A;  1CPJ A;  1F2A A;  1QMY A;  4MSX A;  4P6G A;  2ATO A;  2VHS A;  2NQI A;  2O6X A;  4Q8G A;  5J94 A;  1QXP A;  1CB5 A;  3QSD A;  4XR7 A;  3MHS A;  3BOW A;  4K7C A;  1MDW A;  5CVO B;  2B1M A;  2JQF R;  1PCI A;  3P5U A;  2NQD B;  1U9Q X;  2ARY A;  4AXL A;  1QDQ A;  3QT4 A;  1U9V A;  4QBB A;  4I07 A;  3N4C A;  2FQ9 A;  2DC6 A;  3BPF A;  1MHW A;  1EWP A;  3TNX A;  2ACT A;  2PAD A;  3P5V A;  1NPZ A;  2CIO A;  5EF4 A;  4QH6 A;  5A24 A;  7PCK A;  4CDC B;  2CB5 A;  1YAL A;  1Q6K A;  1AYU A;  1O0E A;  1AYW A;  4CZW A;  3K9M A;  4YYQ A;  1POP A;  3U8E A;  2YJ8 A;  1PXV A;  1PPO A;  3N3K A;  2DJF B;  1ITO A;  1VJV A;  1GCB A;  4PAD A;  1MIR A;  1AU3 A;  1MEG A;  3PW3 A;  2HXZ A;  1CTE A;  1F2C A;  1AU0 A;  1NL6 A;  5CHV A;  1GEC E;  2AUZ A;  3KWB X;  5PAD A;  4I05 A;  3N3G A;  4MZO A;  3IOQ A;  2AIM A;  3I3T A;  3PBH A;  1PPD A;  2OP3 A;  3P5X A;  1EWM A;  2F1G A;  3KKU A;  4AXM A;  1TL9 A;  2G6D A;  2DZZ A;  2AVW A;  2FRQ A;  3LXS A;  4YYW A;  4W5B A;  3V6C A;  2FUD A;  1TU6 A;  3GCB A;  1BP4 A;  1PIP A;  1BQI A;  3AI8 A;  3WXE A;  2AYO A;  5FPW A;  3H89 A;  3IMA A;  2F7D A;  2YJ2 A;  1CVZ A;  1PBH A;  1AEC A;  1ME4 A;  1PAD A;  3BPM A;  2DCB A;  3HHI A;  4KLB A;  1S4V A;  3CH3 X;  2XU5 A;  4BS5 A;  1F2B A;  1THE A;  2R9C A;  1QOL A;  3NHE A;  1EWO A;  3B79 A;  5K16 A;  1MS6 A;  1FH0 A;  1KHP A;  1YK7 A;  2H7J A;  1HUC B;  3BWK A;  1Y4H A;  2DC8 A;  2XU4 A;  5CHT A;  3OVX A;  1YK8 A;  3PNR A;  1GLO A;  1CSB B;  4FIP A;  3D6S A;  2OZ2 A;  4RY2 A;  4HWY A;  4YYV A;  1U5I A;  4BS6 A;  2AYN A;  3C9E A;  4X6J A;  2C0Y A;  2DZY A;  3BC3 A;  3H8C A;  4YYR A;  1ICF A;  4ZUX U;  1ZIV A;  2G8J A;  3QJ3 A;  3MTN A;  4BSQ A;  2DCA A;  1BY8 A;  5CVN B;  1CS8 A;  1DF0 A;  3CH2 X;  2AU1 A;  2B1N A;  2IBI A;  2R6N A;  3CBK A;  3ERV A;  2NQG A;  2DCD A;  4OEL A;  3DF0 A;  2FO5 A;  2FT2 A;  1CV8 A;  4G54 A;  2HD5 A;  2R9N A;  4OEM A;  2E01 A;  1DEU A;  4P6E A;  4DMY A;  4FJC A;  1SNK A;  3F75 A;  1PE6 A;  1IWD A;  3H8B A;  4YV8 A;  1KHQ A;  4QRV A;  3HHA A;  2R9M A;  1EWL A;  1AU2 A;  1AYV A;  3IHP A;  4X6H A;  2R9F A;  3KSE A;  3HD3 A;  6PAD A;  1CQD A;  1MEM A;  3V6E A;  1BGO A;  2HH5 A;  3CBJ A;  3KWZ A;  4N8W A;  1A6R A;  9PAP A;  3F5V A;  4PI3 A;  2E03 A;  3RVW A;  4CDD B;  5EGW A;  3E1Z B;  2DJG B;  1EF7 A;  2OUL A;  3MOR A;  1KFU L; 
#chains in the Genus database with same CATH topology
 2G7Y A;  2YJB A;  5F02 A;  1STF E;  3LFY A;  1YT7 A;  4BPV A;  3I06 A;  4YVA A;  3TRK A;  2NQA A;  1AU4 A;  1NB5 A;  3ZNH A;  2P7U A;  5CVM A;  2XU3 A;  1ME3 A;  3BB7 A;  4Q8H A;  3S3R A;  3P5W A;  3HWN A;  3OF9 A;  2AS8 A;  2PRE A;  3RVX A;  3PHU A;  4N79 A;  2VHF A;  4FK5 A;  4QRG A;  3IUT A;  4BOZ A;  1K3B B;  2Y6E A;  4YYU A;  2YJ9 A;  2BTW A;  3WXG A;  3H7D A;  4CDF B;  1U9W A;  3TMP A;  4YYS A;  2BU3 A;  2FYE A;  2E02 A;  3S3Q A;  3ZUA A;  2DCC A;  2R9O A;  2FTD A;  1KFX L;  2IPP B;  3KW9 A;  1PPP A;  1X9Y A;  1NQC A;  4CDE B;  3E9S A;  3MHH A;  4OVZ A;  2PNS A;  4PP2 E;  3H6S A;  3O0U A;  3RVV A;  3KX1 A;  3O65 A;  2GHU A;  3OVZ A;  3MP2 A;  4REZ A;  4WA6 A;  3PDF A;  2PBH A;  2P0R A;  4MZS A;  2DC7 A;  1TLO A;  3RNV A;  2WBF X;  3BCN A;  1ATK A;  2Z84 A;  1ZCM A;  2YJC A;  2GFO A;  1GMY A;  1KXR A;  1VSN A;  3IV2 A;  1U9X A;  2BDZ A;  4WUR A;  1PPN A;  4BOS A;  3C0R A;  4HXD B;  1CJL A;  1AIM A;  3OIS A;  4QRX A;  3K24 A;  4PP1 A;  2AUX A;  2FRA A;  1XKG A;  4R3D A;  4BQV A;  2P86 A;  4DMX A;  1F29 A;  5JA7 A;  4XZX A;  4N4Z A;  2XU1 A;  3OF8 A;  2JQG R;  3PSE A;  4W5C A;  4P16 A;  4X6I A;  3O1G A;  4BOU A;  1JQP A;  4XUI A;  5JH3 A;  2BDL A;  4D8B A;  2G8E A;  3MTV A;  1NB3 A;  3IEJ A;  3K8U A;  4I04 A;  2HHN A;  2Y5B A;  4W4U A;  3M99 A;  2E00 A;  8PCH A;  2J7Q A;  4OVZ B;  2DOS A;  1M6D A;  1YVB A;  4IUM A;  3WXF A;  1NLJ A;  2DC9 A;  1SP4 B;  1Y08 A;  3USV A;  3KFQ A;  1CPJ A;  1F2A A;  3W30 A;  2AGA A;  4PT5 A;  1QMY A;  4MSX A;  4P6G A;  2ATO A;  2VHS A;  2NQI A;  3PRM A;  2O6X A;  4Q8G A;  5J94 A;  1QXP A;  1CB5 A;  3QSD A;  4XR7 A;  3MHS A;  3BOW A;  5EZS A;  4K7C A;  1MDW A;  5CVO B;  2B1M A;  2JQF R;  1PCI A;  3P5U A;  2NQD B;  4A5U A;  1U9Q X;  2ARY A;  4AXL A;  1QDQ A;  3QT4 A;  1U9V A;  4I07 A;  4QBB A;  3N4C A;  2FQ9 A;  2DC6 A;  2J7Q C;  3BPF A;  1MHW A;  1EWP A;  3TNX A;  2ACT A;  2PAD A;  3P5V A;  1NPZ A;  2CIO A;  5EF4 A;  4QH6 A;  5A24 A;  7PCK A;  4CDC B;  2CB5 A;  1YAL A;  3BY4 A;  1Q6K A;  1AYU A;  4M0W A;  1O0E A;  1AYW A;  4CZW A;  3K9M A;  4YYQ A;  1POP A;  3U8E A;  2YJ8 A;  1PXV A;  1PPO A;  3N3K A;  2DJF B;  1ITO A;  1VJV A;  1GCB A;  4PAD A;  1MIR A;  3MJ5 A;  1AU3 A;  1MEG A;  3PW3 A;  2HXZ A;  1CTE A;  1F2C A;  1AU0 A;  1NL6 A;  5E6J A;  5CHV A;  1GEC E;  2AUZ A;  3KWB X;  5PAD A;  4I05 A;  3N3G A;  4MZO A;  3IOQ A;  2AIM A;  3I3T A;  3PBH A;  1PPD A;  2OP3 A;  3P5X A;  1EWM A;  2F1G A;  3KKU A;  4AXM A;  1TL9 A;  2G6D A;  2DZZ A;  2AVW A;  2FRQ A;  4D8E A;  3LXS A;  4YYW A;  4W5B A;  3V6C A;  2FUD A;  1TU6 A;  3GCB A;  1BP4 A;  1PIP A;  1BQI A;  3AI8 A;  3WXE A;  2AYO A;  5FPW A;  3H89 A;  4RF0 A;  3IMA A;  2F7D A;  2YJ2 A;  1CVZ A;  1PBH A;  1AEC A;  1ME4 A;  1PAD A;  3BPM A;  2DCB A;  3HHI A;  4RKX A;  4KLB A;  3B21 A;  1S4V A;  3CH3 X;  2XU5 A;  1YZB A;  4BS5 A;  1F2B A;  1THE A;  2R9C A;  4RNA A;  1QOL A;  3NHE A;  1EWO A;  4D8I A;  4MM3 B;  3B79 A;  5K16 A;  1MS6 A;  1FH0 A;  3W31 A;  1KHP A;  1YK7 A;  2H7J A;  1HUC B;  3BWK A;  4BOQ A;  1Y4H A;  2DC8 A;  4GUA A;  2XU4 A;  5CHT A;  3OVX A;  1YK8 A;  3PNR A;  1GLO A;  1CSB B;  4FIP A;  3D6S A;  2OZ2 A;  4RY2 A;  4HWY A;  4YYV A;  1U5I A;  4BS6 A;  2AYN A;  3C9E A;  4X6J A;  2UZJ A;  3PHW A;  2C0Y A;  3IFU A;  2DZY A;  3BC3 A;  3H8C A;  4YYR A;  1ICF A;  4ZUX U;  1ZIV A;  2G8J A;  3QJ3 A;  3MTN A;  4BSQ A;  2DCA A;  1BY8 A;  5CVN B;  4MI7 A;  1CS8 A;  1DF0 A;  3CH2 X;  2AU1 A;  2B1N A;  2IBI A;  2R6N A;  3CBK A;  3ERV A;  2NQG A;  4BOP A;  2DCD A;  4OEL A;  3DF0 A;  3PRP A;  4ZTB A;  2FO5 A;  1DKI A;  2FT2 A;  1CV8 A;  4G54 A;  2HD5 A;  2R9N A;  2JRI A;  4OEM A;  3PHX A;  2FE8 A;  2E01 A;  1DEU A;  4P6E A;  3OQC A;  4DMY A;  4FJC A;  3BBA A;  1SNK A;  3F75 A;  1PE6 A;  5EZQ A;  4OW0 A;  1IWD A;  3H8B A;  4YV8 A;  1KHQ A;  2JTC A;  4QRV A;  3HHA A;  2R9M A;  1EWL A;  1AU2 A;  1UKF A;  3PT2 A;  4RF1 A;  1AYV A;  3IHP A;  5JZE A;  5KO3 A;  4X6H A;  2R9F A;  3KSE A;  3HD3 A;  6PAD A;  1CQD A;  1MEM A;  3V6E A;  1BGO A;  2HH5 A;  2HWK A;  3CBJ A;  3KWZ A;  4N8W A;  4IP3 A;  1A6R A;  9PAP A;  3F5V A;  4PI3 A;  2E03 A;  3RVW A;  4CDD B;  5EGW A;  3E1Z B;  2BTW B;  2DJG B;  1EF7 A;  2OUL A;  3MOR A;  1PVJ A;  1KFU L; 
#chains in the Genus database with same CATH homology
 2G7Y A;  2YJB A;  5F02 A;  1STF E;  3LFY A;  1YT7 A;  4BPV A;  3I06 A;  4YVA A;  1W4T A;  2NQA A;  1AU4 A;  1NB5 A;  2P7U A;  5CVM A;  2XU3 A;  1ME3 A;  4Q8H A;  3S3R A;  3P5W A;  3HWN A;  3OF9 A;  2AS8 A;  2PRE A;  3RVX A;  4N79 A;  2VHF A;  4FK5 A;  4QRG A;  3IUT A;  1K3B B;  2Y6E A;  4YYU A;  2VFB A;  2YJ9 A;  3WXG A;  3H7D A;  4CDF B;  1U9W A;  4YYS A;  2FYE A;  2E02 A;  3S3Q A;  3ZUA A;  2DCC A;  2R9O A;  2FTD A;  4NV8 A;  1KFX L;  2IPP B;  3KW9 A;  1PPP A;  1X9Y A;  1NQC A;  4CDE B;  3MHH A;  2PNS A;  4PP2 E;  3H6S A;  3O0U A;  3RVV A;  3KX1 A;  2GHU A;  3OVZ A;  4WA6 A;  2BSZ A;  3PDF A;  2PBH A;  2P0R A;  2VFC A;  4MZS A;  2DC7 A;  1TLO A;  2WBF X;  3BCN A;  1ATK A;  1ZCM A;  2YJC A;  2GFO A;  1W5R A;  1GMY A;  1KXR A;  4GUZ A;  1VSN A;  3IV2 A;  1U9X A;  2BDZ A;  1PPN A;  1CJL A;  1AIM A;  3OIS A;  4QRX A;  3K24 A;  4PP1 A;  2AUX A;  2FRA A;  1XKG A;  4BQV A;  2P86 A;  4DMX A;  1F29 A;  5JA7 A;  4N4Z A;  2XU1 A;  3OF8 A;  2JQG R;  4W5C A;  4X6I A;  3O1G A;  1JQP A;  4XUI A;  5JH3 A;  2BDL A;  2G8E A;  1NB3 A;  3IEJ A;  3K8U A;  4I04 A;  2HHN A;  2Y5B A;  4W4U A;  3M99 A;  2E00 A;  1E2T A;  8PCH A;  1M6D A;  1YVB A;  3WXF A;  3D9W A;  1NLJ A;  2DC9 A;  1SP4 B;  1Y08 A;  3USV A;  3KFQ A;  1CPJ A;  1F2A A;  1QMY A;  4MSX A;  4P6G A;  2ATO A;  2VHS A;  2NQI A;  2O6X A;  4Q8G A;  5J94 A;  1QXP A;  1CB5 A;  3QSD A;  4XR7 A;  3MHS A;  3BOW A;  4K7C A;  1MDW A;  5CVO B;  2B1M A;  2JQF R;  1PCI A;  3P5U A;  2NQD B;  1U9Q X;  2ARY A;  4AXL A;  1QDQ A;  3QT4 A;  1U9V A;  4QBB A;  4I07 A;  3N4C A;  2FQ9 A;  2DC6 A;  3BPF A;  1MHW A;  1EWP A;  3TNX A;  2ACT A;  2PAD A;  3P5V A;  1NPZ A;  2CIO A;  5EF4 A;  4QH6 A;  4C5P A;  5A24 A;  7PCK A;  4CDC B;  2CB5 A;  1YAL A;  1Q6K A;  1AYU A;  1O0E A;  1AYW A;  4CZW A;  3K9M A;  4YYQ A;  1POP A;  3U8E A;  2YJ8 A;  1PXV A;  1PPO A;  3N3K A;  2DJF B;  1ITO A;  1VJV A;  1GCB A;  4PAD A;  1MIR A;  1AU3 A;  1MEG A;  3PW3 A;  2HXZ A;  1CTE A;  1F2C A;  1AU0 A;  1NL6 A;  5CHV A;  1GEC E;  2AUZ A;  3KWB X;  5PAD A;  4I05 A;  3N3G A;  4MZO A;  3IOQ A;  2AIM A;  3I3T A;  3PBH A;  1PPD A;  2OP3 A;  3P5X A;  1EWM A;  2F1G A;  3KKU A;  4AXM A;  1TL9 A;  2G6D A;  2DZZ A;  2AVW A;  2FRQ A;  3LXS A;  4YYW A;  4W5B A;  3V6C A;  2FUD A;  1TU6 A;  3GCB A;  1BP4 A;  1PIP A;  1BQI A;  3AI8 A;  3WXE A;  2AYO A;  5FPW A;  4B55 A;  3H89 A;  3IMA A;  2F7D A;  2YJ2 A;  1CVZ A;  1PBH A;  1AEC A;  1ME4 A;  1PAD A;  3BPM A;  2DCB A;  3HHI A;  4KLB A;  1S4V A;  3CH3 X;  2XU5 A;  4BS5 A;  1F2B A;  1THE A;  2R9C A;  1QOL A;  3NHE A;  1EWO A;  3B79 A;  5K16 A;  1MS6 A;  1FH0 A;  1KHP A;  1YK7 A;  2H7J A;  1HUC B;  3BWK A;  1Y4H A;  2DC8 A;  2XU4 A;  5CHT A;  3OVX A;  1YK8 A;  3PNR A;  1GLO A;  1CSB B;  4FIP A;  3D6S A;  1W6F A;  2OZ2 A;  4RY2 A;  4HWY A;  4YYV A;  1U5I A;  4BS6 A;  1GX3 A;  2AYN A;  3C9E A;  4X6J A;  2C0Y A;  2DZY A;  3BC3 A;  3H8C A;  4YYR A;  1ICF A;  4ZUX U;  1ZIV A;  2G8J A;  3QJ3 A;  3MTN A;  4BSQ A;  2DCA A;  1BY8 A;  5CVN B;  1CS8 A;  1DF0 A;  3CH2 X;  2AU1 A;  2B1N A;  2IBI A;  2R6N A;  3CBK A;  3ERV A;  2NQG A;  2DCD A;  4OEL A;  3DF0 A;  4BGF A;  2FO5 A;  2FT2 A;  1CV8 A;  4G54 A;  2HD5 A;  2R9N A;  4OEM A;  2E01 A;  1DEU A;  4P6E A;  4DMY A;  4FJC A;  1SNK A;  3F75 A;  1PE6 A;  1IWD A;  3H8B A;  4YV8 A;  1KHQ A;  4QRV A;  3HHA A;  2R9M A;  1EWL A;  1AU2 A;  1AYV A;  3IHP A;  4X6H A;  2R9F A;  3KSE A;  4NV7 A;  3HD3 A;  6PAD A;  1CQD A;  3LTW A;  1MEM A;  3V6E A;  1BGO A;  2HH5 A;  3CBJ A;  3KWZ A;  4N8W A;  1A6R A;  9PAP A;  3F5V A;  4PI3 A;  2E03 A;  3RVW A;  4CDD B;  5EGW A;  3E1Z B;  2DJG B;  1EF7 A;  2OUL A;  3MOR A;  1KFU L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...