2FQ9A

Cathepsin s with nitrile inhibitor
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
218
structure length
218
Chain Sequence
ILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords cathepsin S
publication title Cathepsin S with nitrile inhibitor
rcsb
source organism Homo sapiens
total genus 70
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2006-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2fq9A00
1AYUA 1MDWA 2DJGB 4Q8GA 1STFE 3IHPA 4X6JA 3OISA 1CS8A 1EWMA 2JQGR 4HWYA 4MZSA 1PADA 4CDDB 3M99A 5A24A 1AYWA 4P6EA 2FQ9A 3CH3X 2AUXA 1AU2A 5FPWA 1SP4B 3H7DA 3I3TA 2E01A 2G6DA 2BDLA 3OVXA 3S3RA 4I07A 3CBJA 2WBFX 1PPPA 1BP4A 7PCKA 5JH3A 2F7DA 2NQGA 3HD3A 1PCIA 4PP1A 3V6CA 1F2CA 3MHHA 2DC6A 1YK7A 4MSXA 2OULA 2AS8A 4RY2A 1CB5A 1EF7A 2Y6EA 1AU4A 3PNRA 4X6HA 1BGOA 3F75A 1PBHA 4K7CA 1M6DA 2DCBA 3P5WA 1YALA 3NHEA 1PPDA 3N4CA 1VJVA 2FO5A 3RVXA 2YJCA 5J94A 2P0RA 2YJ2A 3DF0A 4QH6A 1CPJA 1ME4A 3OF9A 1EWLA 2VHSA 1U5IA 1KHPA 3CH2X 4G54A 3KFQA 1NB3A 1U9XA 3OVZA 5PADA 1U9QX 1ZIVA 2G8JA 5CVMA 1ITOA 2B1NA 1TL9A 3MTNA 4YYQA 1ME3A 4FK5A 4PP2E 2GFOA 1AU0A 2P7UA 3I06A 1DEUA 1DF0A 2R9MA 1F2AA 2HD5A 3V6EA 5EF4A 3GCBA 4YYWA 4W4UA 4DMYA 3OF8A 2F1GA 1K3BB 2AIMA 3USVA 4PI3A 3H8BA 2DZYA 4YYVA 2R9CA 2CB5A 2E02A 3HWNA 1Y08A 8PCHA 3LXSA 1JQPA 1EWOA 2P86A 2XU4A 3BCNA 3BC3A 3PW3A 3E1ZB 4N79A 3WXGA 2AYOA 3N3KA 2HHNA 1ZCMA 2AU1A 4DMXA 1ATKA 2DCCA 2AVWA 4BS5A 5F02A 1F29A 4KLBA 4YVAA 4N8WA 2G8EA 2DC7A 2E03A 4X6IA 3RVWA 3BWKA 2E00A 4N4ZA 2OZ2A 2HXZA 1TU6A 2OP3A 2G7YA 2XU1A 5CHTA 2PADA 1BQIA 1X9YA 3K8UA 2DCAA 2VHFA 1NLJA 1BY8A 1AU3A 4BSQA 2YJ8A 1KHQA 3IV2A 4QRXA 3H8CA 2NQIA 2FUDA 3N3GA 4W5BA 4PADA 3BOWA 5K16A 6PADA 1QOLA 2FYEA 2FRAA 3P5XA 3H89A 3MORA 3CBKA 1MIRA 4YV8A 3KX1A 2HH5A 2ATOA 1CJLA 3IMAA 1CV8A 1AIMA 2Y5BA 2R9OA 4OELA 3KW9A 1CQDA 4Q8HA 1PXVA 1PIPA 3KWBX 4CDEB 1PPOA 4BQVA 2ARYA 1NL6A 1MS6A 3IOQA 4I05A 1U9WA 2GHUA 2NQAA 1KFXL 1YT7A 4CDCB 1AECA 3ZUAA 1YVBA 2IBIA 2DCDA 2R9FA 1MEMA 2DZZA 3HHIA 2DC9A 3S3QA 1GMYA 1QDQA 1U9VA 1GCBA 3D6SA 4QRVA 1FH0A 3QT4A 3WXFA 1SNKA 2NQDB 3IEJA 3O1GA 3P5VA 1NB5A 4BS6A 3PBHA 2DC8A 2FT2A 1Y4HA 4CDFB 3RVVA 2YJBA 3KWZA 2AUZA 1S4VA 3KSEA 3QJ3A 4I04A 2PNSA 3MHSA 3O0UA 4QRGA 2XU3A 3PDFA 3P5UA 1THEA 2PBHA 4W5CA 5CHVA 3K24A 1TLOA 1F2BA 1ICFA 3QSDA 4XR7A 2YJ9A 4YYRA 2PREA 3AI8A 1CTEA 1VSNA 1CVZA 1XKGA 1GLOA 3WXEA 4OEMA 3F5VA 2AYNA 2IPPB 3BPFA 3KKUA 2FRQA 5JA7A 4YYUA 1EWPA 3B79A 1KFUL 5CVNB 3K9MA 4AXMA 3ERVA 4MZOA 3LFYA 2B1MA 1AYVA 1GECE 1NPZA 1POPA 3BPMA 1MEGA 1PE6A 4CZWA 2H7JA 1NQCA 4XUIA 4ZUXU 4QBBA 2ACTA 4AXLA 5CVOB 1MHWA 1Q6KA 1PPNA 1KXRA 4FJCA 1QMYA 9PAPA 1YK8A 2JQFR 4FIPA 2R9NA 3C9EA 2BDZA 4P6GA 2DJFB 3HHAA 1CSBB 4WA6A 3TNXA 1A6RA 1IWDA 2XU5A 1QXPA 3H6SA 3U8EA 4BPVA 5EGWA 2R6NA 4YYSA 1HUCB 2CIOA 2O6XA 2C0YA 2FTDA 1O0EA 3IUTA
chains in the Genus database with same CATH superfamily
1AYUA 2UZJA 1MDWA 2J7QC 2DJGB 4Q8GA 1STFE 3IHPA 4X6JA 3TMPA 3OISA 1CS8A 1EWMA 3W30A 3MP2A 2JQGR 1PVJA 4HWYA 4MZSA 1PADA 4CDDB 3M99A 5A24A 2FE8A 1AYWA 4OW0A 3C0RA 4P6EA 2FQ9A 3CH3X 2AUXA 1AU2A 5FPWA 1SP4B 3H7DA 4REZA 3I3TA 5EZSA 2E01A 3ZNHA 2G6DA 2HWKA 4RNAA 2BDLA 3OVXA 3S3RA 3IFUA 4I07A 4R3DA 3CBJA 1DKIA 2WBFX 1PPPA 1BP4A 7PCKA 3MTVA 5JH3A 2F7DA 2NQGA 3HD3A 1PCIA 4PP1A 3V6CA 1F2CA 3MHHA 2DC6A 4BOSA 1YK7A 4MSXA 2OULA 2AS8A 3RNVA 4RY2A 1CB5A 1EF7A 4D8EA 2Y6EA 1AU4A 3PNRA 4X6HA 1BGOA 4OVZB 3F75A 1PBHA 5KO3A 4K7CA 1M6DA 2DCBA 3P5WA 1YALA 3NHEA 1PPDA 3N4CA 1VJVA 2FO5A 3RVXA 2YJCA 5J94A 2P0RA 2YJ2A 3DF0A 4QH6A 1CPJA 1ME4A 3OF9A 3TRKA 1EWLA 3MJ5A 2VHSA 1U5IA 1KHPA 3CH2X 4G54A 3KFQA 1NB3A 1U9XA 3OVZA 5PADA 1U9QX 1ZIVA 2G8JA 5CVMA 1ITOA 2B1NA 1TL9A 3MTNA 4YYQA 1ME3A 4FK5A 4PP2E 2GFOA 1AU0A 2P7UA 3I06A 1DEUA 1DF0A 2R9MA 1F2AA 2HD5A 2BTWA 3V6EA 5EF4A 3GCBA 3PT2A 4W4UA 4YYWA 4DMYA 3OF8A 2F1GA 1K3BB 3PHXA 2AIMA 3USVA 4WURA 4PI3A 3H8BA 2DZYA 4YYVA 2R9CA 2CB5A 2E02A 3HWNA 4IUMA 1Y08A 3PHWA 3B21A 3OQCA 3LXSA 8PCHA 1JQPA 1EWOA 2P86A 2JRIA 2XU4A 3BCNA 3BC3A 3PW3A 3E1ZB 4N79A 3WXGA 2AYOA 3N3KA 2HHNA 1ZCMA 2AU1A 4DMXA 1ATKA 2DCCA 2AVWA 4BS5A 4ZTBA 5F02A 1F29A 4KLBA 4YVAA 4N8WA 2G8EA 2DC7A 2E03A 4X6IA 3RVWA 3BWKA 2E00A 4N4ZA 4D8BA 2OZ2A 4HXDB 2HXZA 1TU6A 2OP3A 2G7YA 2XU1A 5CHTA 2PADA 1BQIA 1X9YA 3K8UA 2DCAA 2VHFA 1NLJA 1BY8A 2Z84A 1AU3A 4BSQA 2YJ8A 1KHQA 3IV2A 4QRXA 3BB7A 3H8CA 2NQIA 2FUDA 3N3GA 4W5BA 5EZQA 4PADA 3BOWA 5K16A 5JZEA 6PADA 3BBAA 2J7QA 1QOLA 2FYEA 2FRAA 2AGAA 3P5XA 3H89A 4M0WA 3MORA 3CBKA 1MIRA 4YV8A 3KX1A 2HH5A 2ATOA 1CJLA 3E9SA 3IMAA 1CV8A 4GUAA 1AIMA 1UKFA 2DOSA 2Y5BA 5E6JA 2R9OA 3PRMA 4OELA 3KW9A 1CQDA 4P16A 4Q8HA 1PXVA 1PIPA 3KWBX 4CDEB 1PPOA 4BQVA 2ARYA 1NL6A 1MS6A 3PSEA 3IOQA 4I05A 1U9WA 4MM3B 2GHUA 2NQAA 1KFXL 1YT7A 2JTCA 4CDCB 1AECA 3ZUAA 1YVBA 4D8IA 2IBIA 2DCDA 2R9FA 1MEMA 4IP3A 2DZZA 3HHIA 2DC9A 3S3QA 1GMYA 1QDQA 1U9VA 4RF1A 1GCBA 3D6SA 4QRVA 1FH0A 3QT4A 3WXFA 1SNKA 2NQDB 3IEJA 3O1GA 3P5VA 1NB5A 3W31A 4BS6A 4BOPA 3PBHA 2DC8A 2FT2A 1Y4HA 4CDFB 3RVVA 4A5UA 2YJBA 3KWZA 2AUZA 1S4VA 4PT5A 3KSEA 3QJ3A 4I04A 2PNSA 3MHSA 3O0UA 4QRGA 2XU3A 3PDFA 3P5UA 4XZXA 1THEA 2PBHA 4W5CA 5CHVA 3K24A 1TLOA 1F2BA 1ICFA 3QSDA 4XR7A 2YJ9A 4YYRA 2PREA 3AI8A 1CTEA 1VSNA 1CVZA 1XKGA 1GLOA 3WXEA 4OEMA 3F5VA 2BTWB 2AYNA 2IPPB 3BPFA 3PRPA 3KKUA 2FRQA 5JA7A 2BU3A 4YYUA 1YZBA 1EWPA 3B79A 4MI7A 1KFUL 5CVNB 3K9MA 4AXMA 3ERVA 4MZOA 3LFYA 4BOUA 2B1MA 1AYVA 1GECE 1NPZA 1POPA 3BPMA 1MEGA 1PE6A 4CZWA 2H7JA 1NQCA 4XUIA 4ZUXU 4QBBA 2ACTA 3PHUA 4AXLA 5CVOB 1MHWA 1Q6KA 1PPNA 4BOZA 1KXRA 4FJCA 1QMYA 9PAPA 3BY4A 1YK8A 2JQFR 4FIPA 2R9NA 4BOQA 3C9EA 2BDZA 4P6GA 2DJFB 3HHAA 1CSBB 4RF0A 3O65A 4WA6A 3TNXA 1A6RA 1IWDA 2XU5A 1QXPA 3H6SA 3U8EA 4BPVA 5EGWA 4RKXA 2R6NA 4OVZA 4YYSA 1HUCB 2CIOA 2O6XA 2C0YA 2FTDA 1O0EA 3IUTA
chains in the Genus database with same CATH topology
1AYUA 1MDWA 2DJGB 2BSZA 4Q8GA 1STFE 3IHPA 4X6JA 4NV8A 3OISA 1CS8A 1EWMA 2JQGR 1GX3A 4HWYA 4MZSA 1PADA 4CDDB 3M99A 5A24A 1AYWA 4P6EA 2FQ9A 2VFBA 3CH3X 2AUXA 1AU2A 5FPWA 1SP4B 3H7DA 3I3TA 2E01A 2G6DA 2BDLA 3OVXA 3S3RA 4I07A 1W4TA 3CBJA 2WBFX 1PPPA 1BP4A 7PCKA 5JH3A 2F7DA 2NQGA 3HD3A 1PCIA 4PP1A 3V6CA 1F2CA 3MHHA 2DC6A 1YK7A 4MSXA 2OULA 2AS8A 4RY2A 1CB5A 1EF7A 2Y6EA 1AU4A 3PNRA 4X6HA 1BGOA 3F75A 1PBHA 4K7CA 1M6DA 2DCBA 3P5WA 1E2TA 1YALA 3NHEA 1PPDA 3N4CA 1VJVA 2FO5A 3RVXA 2YJCA 5J94A 2P0RA 2YJ2A 3DF0A 4QH6A 1CPJA 1ME4A 3OF9A 1EWLA 2VHSA 1U5IA 1KHPA 3CH2X 4G54A 3KFQA 1NB3A 1U9XA 3OVZA 5PADA 1U9QX 1ZIVA 2G8JA 5CVMA 1ITOA 2B1NA 1TL9A 3MTNA 4YYQA 1ME3A 4FK5A 4PP2E 2GFOA 1AU0A 2P7UA 3I06A 1DEUA 1DF0A 2R9MA 1F2AA 2HD5A 3V6EA 5EF4A 3GCBA 4YYWA 4W4UA 4DMYA 3OF8A 2F1GA 1K3BB 2AIMA 3USVA 4PI3A 3H8BA 2DZYA 4YYVA 2R9CA 2CB5A 2E02A 3HWNA 1Y08A 8PCHA 3LXSA 1JQPA 1EWOA 2P86A 2XU4A 3BCNA 3BC3A 3PW3A 3E1ZB 4N79A 3WXGA 2AYOA 3N3KA 2HHNA 1ZCMA 2AU1A 4DMXA 1ATKA 2DCCA 2AVWA 4BS5A 5F02A 1F29A 4KLBA 4YVAA 4N8WA 2G8EA 2DC7A 2E03A 4X6IA 3RVWA 3BWKA 2E00A 4N4ZA 2OZ2A 2HXZA 1TU6A 2OP3A 2G7YA 2XU1A 5CHTA 2PADA 1BQIA 1X9YA 3K8UA 2DCAA 2VHFA 1NLJA 1BY8A 1AU3A 4BSQA 2YJ8A 1KHQA 3IV2A 4QRXA 3H8CA 2NQIA 2FUDA 3N3GA 4W5BA 4PADA 3BOWA 5K16A 6PADA 1QOLA 2FYEA 2FRAA 3P5XA 3H89A 3MORA 3CBKA 1MIRA 4YV8A 3KX1A 2HH5A 2ATOA 1CJLA 3IMAA 1CV8A 1AIMA 2Y5BA 2R9OA 4OELA 3KW9A 1CQDA 3D9WA 4Q8HA 1PXVA 1PIPA 3KWBX 4CDEB 1PPOA 4BQVA 2ARYA 1NL6A 1MS6A 3IOQA 4I05A 1U9WA 2GHUA 2NQAA 1KFXL 1YT7A 4CDCB 4C5PA 1AECA 3ZUAA 1YVBA 2VFCA 2IBIA 2DCDA 2R9FA 1MEMA 2DZZA 3HHIA 2DC9A 3S3QA 1GMYA 1QDQA 1U9VA 1GCBA 1W5RA 3D6SA 4QRVA 1FH0A 3QT4A 3WXFA 1SNKA 2NQDB 3IEJA 3O1GA 3P5VA 1NB5A 4BS6A 3PBHA 2DC8A 2FT2A 1Y4HA 4CDFB 3RVVA 3LTWA 2YJBA 3KWZA 2AUZA 1S4VA 3KSEA 4B55A 1W6FA 4GUZA 3QJ3A 4I04A 2PNSA 3MHSA 3O0UA 4QRGA 2XU3A 3PDFA 3P5UA 1THEA 2PBHA 4W5CA 5CHVA 3K24A 1TLOA 1F2BA 1ICFA 3QSDA 4XR7A 2YJ9A 4YYRA 2PREA 3AI8A 1CTEA 1VSNA 1CVZA 4NV7A 1XKGA 4BGFA 1GLOA 3WXEA 4OEMA 3F5VA 2AYNA 2IPPB 3BPFA 3KKUA 2FRQA 5JA7A 4YYUA 1EWPA 3B79A 1KFUL 5CVNB 3K9MA 4AXMA 3ERVA 4MZOA 3LFYA 2B1MA 1AYVA 1GECE 1NPZA 1POPA 3BPMA 1MEGA 1PE6A 4CZWA 2H7JA 1NQCA 4XUIA 4ZUXU 4QBBA 2ACTA 4AXLA 5CVOB 1MHWA 1Q6KA 1PPNA 1KXRA 4FJCA 1QMYA 9PAPA 1YK8A 2JQFR 4FIPA 2R9NA 3C9EA 2BDZA 4P6GA 2DJFB 3HHAA 1CSBB 4WA6A 3TNXA 1A6RA 1IWDA 2XU5A 1QXPA 3H6SA 3U8EA 4BPVA 5EGWA 2R6NA 4YYSA 1HUCB 2CIOA 2O6XA 2C0YA 2FTDA 1O0EA 3IUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AYU A;  1MDW A;  2DJG B;  4Q8G A;  1STF E;  3IHP A;  4X6J A;  3OIS A;  1CS8 A;  1EWM A;  2JQG R;  4HWY A;  4MZS A;  1PAD A;  4CDD B;  3M99 A;  5A24 A;  1AYW A;  4P6E A;  2FQ9 A;  3CH3 X;  2AUX A;  1AU2 A;  5FPW A;  1SP4 B;  3H7D A;  3I3T A;  2E01 A;  2G6D A;  2BDL A;  3OVX A;  3S3R A;  4I07 A;  3CBJ A;  2WBF X;  1PPP A;  1BP4 A;  7PCK A;  5JH3 A;  2F7D A;  2NQG A;  3HD3 A;  1PCI A;  4PP1 A;  3V6C A;  1F2C A;  3MHH A;  2DC6 A;  1YK7 A;  4MSX A;  2OUL A;  2AS8 A;  4RY2 A;  1CB5 A;  1EF7 A;  2Y6E A;  1AU4 A;  3PNR A;  4X6H A;  1BGO A;  3F75 A;  1PBH A;  4K7C A;  1M6D A;  2DCB A;  3P5W A;  1YAL A;  3NHE A;  1PPD A;  3N4C A;  1VJV A;  2FO5 A;  3RVX A;  2YJC A;  5J94 A;  2P0R A;  2YJ2 A;  3DF0 A;  4QH6 A;  1CPJ A;  1ME4 A;  3OF9 A;  1EWL A;  2VHS A;  1U5I A;  1KHP A;  3CH2 X;  4G54 A;  3KFQ A;  1NB3 A;  1U9X A;  3OVZ A;  5PAD A;  1U9Q X;  1ZIV A;  2G8J A;  5CVM A;  1ITO A;  2B1N A;  1TL9 A;  3MTN A;  4YYQ A;  1ME3 A;  4FK5 A;  4PP2 E;  2GFO A;  1AU0 A;  2P7U A;  3I06 A;  1DEU A;  1DF0 A;  2R9M A;  1F2A A;  2HD5 A;  3V6E A;  5EF4 A;  3GCB A;  4YYW A;  4W4U A;  4DMY A;  3OF8 A;  2F1G A;  1K3B B;  2AIM A;  3USV A;  4PI3 A;  3H8B A;  2DZY A;  4YYV A;  2R9C A;  2CB5 A;  2E02 A;  3HWN A;  1Y08 A;  8PCH A;  3LXS A;  1JQP A;  1EWO A;  2P86 A;  2XU4 A;  3BCN A;  3BC3 A;  3PW3 A;  3E1Z B;  4N79 A;  3WXG A;  2AYO A;  3N3K A;  2HHN A;  1ZCM A;  2AU1 A;  4DMX A;  1ATK A;  2DCC A;  2AVW A;  4BS5 A;  5F02 A;  1F29 A;  4KLB A;  4YVA A;  4N8W A;  2G8E A;  2DC7 A;  2E03 A;  4X6I A;  3RVW A;  3BWK A;  2E00 A;  4N4Z A;  2OZ2 A;  2HXZ A;  1TU6 A;  2OP3 A;  2G7Y A;  2XU1 A;  5CHT A;  2PAD A;  1BQI A;  1X9Y A;  3K8U A;  2DCA A;  2VHF A;  1NLJ A;  1BY8 A;  1AU3 A;  4BSQ A;  2YJ8 A;  1KHQ A;  3IV2 A;  4QRX A;  3H8C A;  2NQI A;  2FUD A;  3N3G A;  4W5B A;  4PAD A;  3BOW A;  5K16 A;  6PAD A;  1QOL A;  2FYE A;  2FRA A;  3P5X A;  3H89 A;  3MOR A;  3CBK A;  1MIR A;  4YV8 A;  3KX1 A;  2HH5 A;  2ATO A;  1CJL A;  3IMA A;  1CV8 A;  1AIM A;  2Y5B A;  2R9O A;  4OEL A;  3KW9 A;  1CQD A;  4Q8H A;  1PXV A;  1PIP A;  3KWB X;  4CDE B;  1PPO A;  4BQV A;  2ARY A;  1NL6 A;  1MS6 A;  3IOQ A;  4I05 A;  1U9W A;  2GHU A;  2NQA A;  1KFX L;  1YT7 A;  4CDC B;  1AEC A;  3ZUA A;  1YVB A;  2IBI A;  2DCD A;  2R9F A;  1MEM A;  2DZZ A;  3HHI A;  2DC9 A;  3S3Q A;  1GMY A;  1QDQ A;  1U9V A;  1GCB A;  3D6S A;  4QRV A;  1FH0 A;  3QT4 A;  3WXF A;  1SNK A;  2NQD B;  3IEJ A;  3O1G A;  3P5V A;  1NB5 A;  4BS6 A;  3PBH A;  2DC8 A;  2FT2 A;  1Y4H A;  4CDF B;  3RVV A;  2YJB A;  3KWZ A;  2AUZ A;  1S4V A;  3KSE A;  3QJ3 A;  4I04 A;  2PNS A;  3MHS A;  3O0U A;  4QRG A;  2XU3 A;  3PDF A;  3P5U A;  1THE A;  2PBH A;  4W5C A;  5CHV A;  3K24 A;  1TLO A;  1F2B A;  1ICF A;  3QSD A;  4XR7 A;  2YJ9 A;  4YYR A;  2PRE A;  3AI8 A;  1CTE A;  1VSN A;  1CVZ A;  1XKG A;  1GLO A;  3WXE A;  4OEM A;  3F5V A;  2AYN A;  2IPP B;  3BPF A;  3KKU A;  2FRQ A;  5JA7 A;  4YYU A;  1EWP A;  3B79 A;  1KFU L;  5CVN B;  3K9M A;  4AXM A;  3ERV A;  4MZO A;  3LFY A;  2B1M A;  1AYV A;  1GEC E;  1NPZ A;  1POP A;  3BPM A;  1MEG A;  1PE6 A;  4CZW A;  2H7J A;  1NQC A;  4XUI A;  4ZUX U;  4QBB A;  2ACT A;  4AXL A;  5CVO B;  1MHW A;  1Q6K A;  1PPN A;  1KXR A;  4FJC A;  1QMY A;  9PAP A;  1YK8 A;  2JQF R;  4FIP A;  2R9N A;  3C9E A;  2BDZ A;  4P6G A;  2DJF B;  3HHA A;  1CSB B;  4WA6 A;  3TNX A;  1A6R A;  1IWD A;  2XU5 A;  1QXP A;  3H6S A;  3U8E A;  4BPV A;  5EGW A;  2R6N A;  4YYS A;  1HUC B;  2CIO A;  2O6X A;  2C0Y A;  2FTD A;  1O0E A;  3IUT A; 
#chains in the Genus database with same CATH topology
 1AYU A;  2UZJ A;  1MDW A;  2J7Q C;  2DJG B;  4Q8G A;  1STF E;  3IHP A;  4X6J A;  3TMP A;  3OIS A;  1CS8 A;  1EWM A;  3W30 A;  3MP2 A;  2JQG R;  1PVJ A;  4HWY A;  4MZS A;  1PAD A;  4CDD B;  3M99 A;  5A24 A;  2FE8 A;  1AYW A;  4OW0 A;  3C0R A;  4P6E A;  2FQ9 A;  3CH3 X;  2AUX A;  1AU2 A;  5FPW A;  1SP4 B;  3H7D A;  4REZ A;  3I3T A;  5EZS A;  2E01 A;  3ZNH A;  2G6D A;  2HWK A;  4RNA A;  2BDL A;  3OVX A;  3S3R A;  3IFU A;  4I07 A;  4R3D A;  3CBJ A;  1DKI A;  2WBF X;  1PPP A;  1BP4 A;  7PCK A;  3MTV A;  5JH3 A;  2F7D A;  2NQG A;  3HD3 A;  1PCI A;  4PP1 A;  3V6C A;  1F2C A;  3MHH A;  2DC6 A;  4BOS A;  1YK7 A;  4MSX A;  2OUL A;  2AS8 A;  3RNV A;  4RY2 A;  1CB5 A;  1EF7 A;  4D8E A;  2Y6E A;  1AU4 A;  3PNR A;  4X6H A;  1BGO A;  4OVZ B;  3F75 A;  1PBH A;  5KO3 A;  4K7C A;  1M6D A;  2DCB A;  3P5W A;  1YAL A;  3NHE A;  1PPD A;  3N4C A;  1VJV A;  2FO5 A;  3RVX A;  2YJC A;  5J94 A;  2P0R A;  2YJ2 A;  3DF0 A;  4QH6 A;  1CPJ A;  1ME4 A;  3OF9 A;  3TRK A;  1EWL A;  3MJ5 A;  2VHS A;  1U5I A;  1KHP A;  3CH2 X;  4G54 A;  3KFQ A;  1NB3 A;  1U9X A;  3OVZ A;  5PAD A;  1U9Q X;  1ZIV A;  2G8J A;  5CVM A;  1ITO A;  2B1N A;  1TL9 A;  3MTN A;  4YYQ A;  1ME3 A;  4FK5 A;  4PP2 E;  2GFO A;  1AU0 A;  2P7U A;  3I06 A;  1DEU A;  1DF0 A;  2R9M A;  1F2A A;  2HD5 A;  2BTW A;  3V6E A;  5EF4 A;  3GCB A;  3PT2 A;  4W4U A;  4YYW A;  4DMY A;  3OF8 A;  2F1G A;  1K3B B;  3PHX A;  2AIM A;  3USV A;  4WUR A;  4PI3 A;  3H8B A;  2DZY A;  4YYV A;  2R9C A;  2CB5 A;  2E02 A;  3HWN A;  4IUM A;  1Y08 A;  3PHW A;  3B21 A;  3OQC A;  3LXS A;  8PCH A;  1JQP A;  1EWO A;  2P86 A;  2JRI A;  2XU4 A;  3BCN A;  3BC3 A;  3PW3 A;  3E1Z B;  4N79 A;  3WXG A;  2AYO A;  3N3K A;  2HHN A;  1ZCM A;  2AU1 A;  4DMX A;  1ATK A;  2DCC A;  2AVW A;  4BS5 A;  4ZTB A;  5F02 A;  1F29 A;  4KLB A;  4YVA A;  4N8W A;  2G8E A;  2DC7 A;  2E03 A;  4X6I A;  3RVW A;  3BWK A;  2E00 A;  4N4Z A;  4D8B A;  2OZ2 A;  4HXD B;  2HXZ A;  1TU6 A;  2OP3 A;  2G7Y A;  2XU1 A;  5CHT A;  2PAD A;  1BQI A;  1X9Y A;  3K8U A;  2DCA A;  2VHF A;  1NLJ A;  1BY8 A;  2Z84 A;  1AU3 A;  4BSQ A;  2YJ8 A;  1KHQ A;  3IV2 A;  4QRX A;  3BB7 A;  3H8C A;  2NQI A;  2FUD A;  3N3G A;  4W5B A;  5EZQ A;  4PAD A;  3BOW A;  5K16 A;  5JZE A;  6PAD A;  3BBA A;  2J7Q A;  1QOL A;  2FYE A;  2FRA A;  2AGA A;  3P5X A;  3H89 A;  4M0W A;  3MOR A;  3CBK A;  1MIR A;  4YV8 A;  3KX1 A;  2HH5 A;  2ATO A;  1CJL A;  3E9S A;  3IMA A;  1CV8 A;  4GUA A;  1AIM A;  1UKF A;  2DOS A;  2Y5B A;  5E6J A;  2R9O A;  3PRM A;  4OEL A;  3KW9 A;  1CQD A;  4P16 A;  4Q8H A;  1PXV A;  1PIP A;  3KWB X;  4CDE B;  1PPO A;  4BQV A;  2ARY A;  1NL6 A;  1MS6 A;  3PSE A;  3IOQ A;  4I05 A;  1U9W A;  4MM3 B;  2GHU A;  2NQA A;  1KFX L;  1YT7 A;  2JTC A;  4CDC B;  1AEC A;  3ZUA A;  1YVB A;  4D8I A;  2IBI A;  2DCD A;  2R9F A;  1MEM A;  4IP3 A;  2DZZ A;  3HHI A;  2DC9 A;  3S3Q A;  1GMY A;  1QDQ A;  1U9V A;  4RF1 A;  1GCB A;  3D6S A;  4QRV A;  1FH0 A;  3QT4 A;  3WXF A;  1SNK A;  2NQD B;  3IEJ A;  3O1G A;  3P5V A;  1NB5 A;  3W31 A;  4BS6 A;  4BOP A;  3PBH A;  2DC8 A;  2FT2 A;  1Y4H A;  4CDF B;  3RVV A;  4A5U A;  2YJB A;  3KWZ A;  2AUZ A;  1S4V A;  4PT5 A;  3KSE A;  3QJ3 A;  4I04 A;  2PNS A;  3MHS A;  3O0U A;  4QRG A;  2XU3 A;  3PDF A;  3P5U A;  4XZX A;  1THE A;  2PBH A;  4W5C A;  5CHV A;  3K24 A;  1TLO A;  1F2B A;  1ICF A;  3QSD A;  4XR7 A;  2YJ9 A;  4YYR A;  2PRE A;  3AI8 A;  1CTE A;  1VSN A;  1CVZ A;  1XKG A;  1GLO A;  3WXE A;  4OEM A;  3F5V A;  2BTW B;  2AYN A;  2IPP B;  3BPF A;  3PRP A;  3KKU A;  2FRQ A;  5JA7 A;  2BU3 A;  4YYU A;  1YZB A;  1EWP A;  3B79 A;  4MI7 A;  1KFU L;  5CVN B;  3K9M A;  4AXM A;  3ERV A;  4MZO A;  3LFY A;  4BOU A;  2B1M A;  1AYV A;  1GEC E;  1NPZ A;  1POP A;  3BPM A;  1MEG A;  1PE6 A;  4CZW A;  2H7J A;  1NQC A;  4XUI A;  4ZUX U;  4QBB A;  2ACT A;  3PHU A;  4AXL A;  5CVO B;  1MHW A;  1Q6K A;  1PPN A;  4BOZ A;  1KXR A;  4FJC A;  1QMY A;  9PAP A;  3BY4 A;  1YK8 A;  2JQF R;  4FIP A;  2R9N A;  4BOQ A;  3C9E A;  2BDZ A;  4P6G A;  2DJF B;  3HHA A;  1CSB B;  4RF0 A;  3O65 A;  4WA6 A;  3TNX A;  1A6R A;  1IWD A;  2XU5 A;  1QXP A;  3H6S A;  3U8E A;  4BPV A;  5EGW A;  4RKX A;  2R6N A;  4OVZ A;  4YYS A;  1HUC B;  2CIO A;  2O6X A;  2C0Y A;  2FTD A;  1O0E A;  3IUT A; 
#chains in the Genus database with same CATH homology
 1AYU A;  1MDW A;  2DJG B;  2BSZ A;  4Q8G A;  1STF E;  3IHP A;  4X6J A;  4NV8 A;  3OIS A;  1CS8 A;  1EWM A;  2JQG R;  1GX3 A;  4HWY A;  4MZS A;  1PAD A;  4CDD B;  3M99 A;  5A24 A;  1AYW A;  4P6E A;  2FQ9 A;  2VFB A;  3CH3 X;  2AUX A;  1AU2 A;  5FPW A;  1SP4 B;  3H7D A;  3I3T A;  2E01 A;  2G6D A;  2BDL A;  3OVX A;  3S3R A;  4I07 A;  1W4T A;  3CBJ A;  2WBF X;  1PPP A;  1BP4 A;  7PCK A;  5JH3 A;  2F7D A;  2NQG A;  3HD3 A;  1PCI A;  4PP1 A;  3V6C A;  1F2C A;  3MHH A;  2DC6 A;  1YK7 A;  4MSX A;  2OUL A;  2AS8 A;  4RY2 A;  1CB5 A;  1EF7 A;  2Y6E A;  1AU4 A;  3PNR A;  4X6H A;  1BGO A;  3F75 A;  1PBH A;  4K7C A;  1M6D A;  2DCB A;  3P5W A;  1E2T A;  1YAL A;  3NHE A;  1PPD A;  3N4C A;  1VJV A;  2FO5 A;  3RVX A;  2YJC A;  5J94 A;  2P0R A;  2YJ2 A;  3DF0 A;  4QH6 A;  1CPJ A;  1ME4 A;  3OF9 A;  1EWL A;  2VHS A;  1U5I A;  1KHP A;  3CH2 X;  4G54 A;  3KFQ A;  1NB3 A;  1U9X A;  3OVZ A;  5PAD A;  1U9Q X;  1ZIV A;  2G8J A;  5CVM A;  1ITO A;  2B1N A;  1TL9 A;  3MTN A;  4YYQ A;  1ME3 A;  4FK5 A;  4PP2 E;  2GFO A;  1AU0 A;  2P7U A;  3I06 A;  1DEU A;  1DF0 A;  2R9M A;  1F2A A;  2HD5 A;  3V6E A;  5EF4 A;  3GCB A;  4YYW A;  4W4U A;  4DMY A;  3OF8 A;  2F1G A;  1K3B B;  2AIM A;  3USV A;  4PI3 A;  3H8B A;  2DZY A;  4YYV A;  2R9C A;  2CB5 A;  2E02 A;  3HWN A;  1Y08 A;  8PCH A;  3LXS A;  1JQP A;  1EWO A;  2P86 A;  2XU4 A;  3BCN A;  3BC3 A;  3PW3 A;  3E1Z B;  4N79 A;  3WXG A;  2AYO A;  3N3K A;  2HHN A;  1ZCM A;  2AU1 A;  4DMX A;  1ATK A;  2DCC A;  2AVW A;  4BS5 A;  5F02 A;  1F29 A;  4KLB A;  4YVA A;  4N8W A;  2G8E A;  2DC7 A;  2E03 A;  4X6I A;  3RVW A;  3BWK A;  2E00 A;  4N4Z A;  2OZ2 A;  2HXZ A;  1TU6 A;  2OP3 A;  2G7Y A;  2XU1 A;  5CHT A;  2PAD A;  1BQI A;  1X9Y A;  3K8U A;  2DCA A;  2VHF A;  1NLJ A;  1BY8 A;  1AU3 A;  4BSQ A;  2YJ8 A;  1KHQ A;  3IV2 A;  4QRX A;  3H8C A;  2NQI A;  2FUD A;  3N3G A;  4W5B A;  4PAD A;  3BOW A;  5K16 A;  6PAD A;  1QOL A;  2FYE A;  2FRA A;  3P5X A;  3H89 A;  3MOR A;  3CBK A;  1MIR A;  4YV8 A;  3KX1 A;  2HH5 A;  2ATO A;  1CJL A;  3IMA A;  1CV8 A;  1AIM A;  2Y5B A;  2R9O A;  4OEL A;  3KW9 A;  1CQD A;  3D9W A;  4Q8H A;  1PXV A;  1PIP A;  3KWB X;  4CDE B;  1PPO A;  4BQV A;  2ARY A;  1NL6 A;  1MS6 A;  3IOQ A;  4I05 A;  1U9W A;  2GHU A;  2NQA A;  1KFX L;  1YT7 A;  4CDC B;  4C5P A;  1AEC A;  3ZUA A;  1YVB A;  2VFC A;  2IBI A;  2DCD A;  2R9F A;  1MEM A;  2DZZ A;  3HHI A;  2DC9 A;  3S3Q A;  1GMY A;  1QDQ A;  1U9V A;  1GCB A;  1W5R A;  3D6S A;  4QRV A;  1FH0 A;  3QT4 A;  3WXF A;  1SNK A;  2NQD B;  3IEJ A;  3O1G A;  3P5V A;  1NB5 A;  4BS6 A;  3PBH A;  2DC8 A;  2FT2 A;  1Y4H A;  4CDF B;  3RVV A;  3LTW A;  2YJB A;  3KWZ A;  2AUZ A;  1S4V A;  3KSE A;  4B55 A;  1W6F A;  4GUZ A;  3QJ3 A;  4I04 A;  2PNS A;  3MHS A;  3O0U A;  4QRG A;  2XU3 A;  3PDF A;  3P5U A;  1THE A;  2PBH A;  4W5C A;  5CHV A;  3K24 A;  1TLO A;  1F2B A;  1ICF A;  3QSD A;  4XR7 A;  2YJ9 A;  4YYR A;  2PRE A;  3AI8 A;  1CTE A;  1VSN A;  1CVZ A;  4NV7 A;  1XKG A;  4BGF A;  1GLO A;  3WXE A;  4OEM A;  3F5V A;  2AYN A;  2IPP B;  3BPF A;  3KKU A;  2FRQ A;  5JA7 A;  4YYU A;  1EWP A;  3B79 A;  1KFU L;  5CVN B;  3K9M A;  4AXM A;  3ERV A;  4MZO A;  3LFY A;  2B1M A;  1AYV A;  1GEC E;  1NPZ A;  1POP A;  3BPM A;  1MEG A;  1PE6 A;  4CZW A;  2H7J A;  1NQC A;  4XUI A;  4ZUX U;  4QBB A;  2ACT A;  4AXL A;  5CVO B;  1MHW A;  1Q6K A;  1PPN A;  1KXR A;  4FJC A;  1QMY A;  9PAP A;  1YK8 A;  2JQF R;  4FIP A;  2R9N A;  3C9E A;  2BDZ A;  4P6G A;  2DJF B;  3HHA A;  1CSB B;  4WA6 A;  3TNX A;  1A6R A;  1IWD A;  2XU5 A;  1QXP A;  3H6S A;  3U8E A;  4BPV A;  5EGW A;  2R6N A;  4YYS A;  1HUC B;  2CIO A;  2O6X A;  2C0Y A;  2FTD A;  1O0E A;  3IUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...