2FQ9A

Cathepsin s with nitrile inhibitor
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
218
structure length
218
Chain Sequence
ILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cathepsin S
publication title Cathepsin S with nitrile inhibitor
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 70
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2006-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2fq9A00
1GLOA 1KHPA 3PBHA 1VJVA 5CHVA 5EF4A 4QRVA 2XU3A 4BPVA 2FUDA 4YV8A 2IBIA 3BPMA 4YVAA 3HHAA 1MEMA 3MHHA 3HD3A 4WA6A 3TNXA 3BWKA 4X6IA 2VHFA 2GFOA 1PPNA 4X6HA 2HXZA 5CVNB 1NPZA 1CS8A 2BDZA 3GCBA 2DCDA 1CVZA 1Q6KA 3ERVA 4K7CA 2E02A 5CVMA 2HD5A 1EWLA 4PADA 3PW3A 2FRQA 2DC9A 3N4CA 1QMYA 4X6JA 3IMAA 4I05A 4PI3A 2ATOA 3KWBX 2CIOA 1PPPA 4N79A 4MZOA 3WXFA 3IHPA 1BY8A 3IOQA 1BQIA 4XR7A 1VSNA 6PADA 4W5BA 2ARYA 4CDFB 1NB3A 4DMXA 1MEGA 2E01A 2VHSA 4MSXA 4W4UA 7PCKA 1PE6A 3K24A 4OELA 5J94A 2AVWA 3MORA 4QRXA 1PPDA 1CSBB 1KXRA 4P6EA 1ZIVA 1YALA 3N3GA 4N8WA 2DJGB 2DJFB 1YK8A 3NHEA 2YJ8A 3V6CA 4AXMA 3H89A 1EWOA 1EWMA 1Y08A 2OULA 2F7DA 1AECA 3CBJA 3BPFA 5CHTA 3KWZA 1MIRA 4BSQA 5FPWA 4CDDB 4FIPA 1M6DA 1DEUA 1NB5A 1A6RA 1SNKA 3IV2A 4YYVA 1PPOA 3CH2X 2OZ2A 1ICFA 1CV8A 3KKUA 3P5UA 1K3BB 3WXGA 3H6SA 1IWDA 2DC6A 4BS6A 3DF0A 2DC7A 2HHNA 2AU1A 1AYUA 3H7DA 5CVOB 4KLBA 2CB5A 2XU4A 3K8UA 3AI8A 2AUZA 2C0YA 2DZYA 2IPPB 2YJCA 2YJBA 5F02A 1ZCMA 3P5VA 2NQIA 4QBBA 3OISA 4W5CA 1AU0A 3O0UA 2YJ9A 3I3TA 5JH3A 3RVWA 3BCNA 3K9MA 1F29A 3IEJA 1ATKA 2OP3A 2NQGA 1QDQA 3PNRA 1JQPA 2B1MA 2AYOA 1Y4HA 1AYWA 4P6GA 1BP4A 3CH3X 5K16A 1PCIA 2FYEA 3S3QA 1O0EA 2F1GA 3OF8A 1CTEA 2R9OA 3ZUAA 3V6EA 2FTDA 4PP2E 3PDFA 3I06A 1F2CA 2AIMA 4QRGA 1MS6A 2ACTA 2FT2A 1CB5A 3KW9A 4N4ZA 4AXLA 2R9MA 1MDWA 2YJ2A 4YYQA 1GCBA 2NQDB 4FJCA 1F2BA 1U9WA 1TLOA 3BC3A 2GHUA 1NLJA 4I04A 1GECE 4I07A 2Y6EA 2XU5A 2PNSA 1KHQA 2DC8A 2XU1A 4G54A 4YYWA 3KSEA 3RVVA 1U9QX 1X9YA 4YYRA 1TU6A 4Q8GA 1SP4B 1CJLA 1DF0A 3MHSA 3B79A 3P5WA 2JQGR 2FO5A 3KX1A 1U9XA 4PP1A 2JQFR 3H8BA 2AS8A 4FK5A 3C9EA 3CBKA 3QSDA 4RY2A 2E00A 5JA7A 5PADA 4CDEB 2FRAA 3USVA 2G7YA 1ITOA 1U5IA 4BQVA 3P5XA 4HWYA 3OVZA 3QJ3A 3F75A 2DCCA 1BGOA 1TL9A 2P86A 2B1NA 1AYVA 2PBHA 5A24A 2P0RA 9PAPA 4DMYA 2DCAA 2AUXA 2NQAA 3F5VA 5EGWA 1U9VA 3WXEA 4CDCB 2DCBA 1YT7A 2AYNA 2R9NA 3LXSA 3HHIA 1YVBA 1POPA 2G8EA 1AU3A 1THEA 1YK7A 1FH0A 3S3RA 1AU4A 1PXVA 1NQCA 4BS5A 1EF7A 3U8EA 1AIMA 3MTNA 4OEMA 4ZUXU 3N3KA 2DZZA 1F2AA 1ME3A 4CZWA 2G8JA 2R6NA 3HWNA 1MHWA 4YYSA 1HUCB 1GMYA 2G6DA 1XKGA 4YYUA 4MZSA 1NL6A 2FQ9A 3M99A 4QH6A 1CPJA 1QXPA 3RVXA 2HH5A 1KFUL 1PBHA 4XUIA 1AU2A 2R9CA 3LFYA 1KFXL 3H8CA 3OF9A 2WBFX 8PCHA 3D6SA 1ME4A 3O1GA 3BOWA 2O6XA 4Q8HA 1EWPA 1QOLA 1PADA 3KFQA 2PREA 2R9FA 2PADA 3E1ZB 2BDLA 3OVXA 2E03A 2P7UA 1S4VA 1PIPA 1STFE 1CQDA 3QT4A 2H7JA 2Y5BA 3IUTA
chains in the Genus database with same CATH superfamily
1GLOA 1KHPA 3PBHA 1VJVA 5CHVA 5EF4A 3RNVA 4QRVA 2XU3A 4BPVA 2FUDA 2J7QC 4YV8A 2IBIA 3BPMA 3W30A 2JTCA 4YVAA 3HHAA 1MEMA 3MHHA 3HD3A 4WA6A 3TNXA 3BWKA 4X6IA 5EZQA 2VHFA 2GFOA 1PPNA 2JRIA 4X6HA 2HXZA 5CVNB 1NPZA 1CS8A 2BDZA 3GCBA 3W31A 3O65A 2DCDA 1CVZA 4OVZB 1Q6KA 3ERVA 4K7CA 2E02A 5CVMA 2HD5A 3ZNHA 4D8IA 1EWLA 4PADA 3PW3A 2FRQA 2DC9A 3N4CA 1QMYA 3PHXA 4X6JA 3IMAA 5KO3A 4I05A 4PI3A 2ATOA 3KWBX 2CIOA 1PPPA 4N79A 4MZOA 3WXFA 2BU3A 3IHPA 1BY8A 3IOQA 1BQIA 4M0WA 4XR7A 1VSNA 6PADA 4W5BA 3BBAA 2ARYA 4CDFB 1NB3A 4DMXA 1DKIA 1MEGA 2E01A 2VHSA 4MSXA 4OVZA 4W4UA 7PCKA 1PE6A 3K24A 4OELA 5J94A 2AVWA 3MORA 4QRXA 1PPDA 4RF1A 1CSBB 1KXRA 4P6EA 3MTVA 1ZIVA 1YALA 4WURA 4D8BA 3N3GA 4N8WA 2DJGB 2DJFB 1YK8A 3NHEA 2YJ8A 3V6CA 4AXMA 3BB7A 3H89A 2Z84A 1EWOA 1EWMA 1Y08A 2OULA 2F7DA 1AECA 3CBJA 3BPFA 5CHTA 3KWZA 1MIRA 5EZSA 5FPWA 4BSQA 4CDDB 4FIPA 1M6DA 1DEUA 1NB5A 1A6RA 1SNKA 3IV2A 4YYVA 1PPOA 3CH2X 2OZ2A 1ICFA 3PT2A 1CV8A 3KKUA 3P5UA 1K3BB 3WXGA 2BTWB 3H6SA 1IWDA 5JZEA 2DC6A 4RKXA 4BS6A 3DF0A 2DC7A 2HHNA 2AU1A 1AYUA 3H7DA 5CVOB 3C0RA 4RF0A 4KLBA 2CB5A 2XU4A 3K8UA 2DOSA 3AI8A 2AUZA 2C0YA 2DZYA 4REZA 2IPPB 4IP3A 2YJCA 2YJBA 5F02A 4BOPA 1ZCMA 3P5VA 2NQIA 4QBBA 4P16A 3OISA 4W5CA 1AU0A 3O0UA 2YJ9A 3I3TA 5JH3A 3RVWA 3BCNA 3K9MA 1F29A 3IEJA 2BTWA 1ATKA 4MM3B 2OP3A 2NQGA 1QDQA 3PNRA 1JQPA 2B1MA 2AYOA 1Y4HA 1AYWA 4P6GA 1BP4A 3CH3X 5K16A 1PCIA 2FYEA 3S3QA 1O0EA 4BOQA 2F1GA 3OF8A 1CTEA 2R9OA 3ZUAA 3OQCA 3V6EA 2FTDA 4HXDB 4PP2E 3PRMA 3PDFA 3I06A 1UKFA 1F2CA 2AIMA 4QRGA 3PHWA 4BOSA 1MS6A 2ACTA 2FT2A 3IFUA 1CB5A 3KW9A 4N4ZA 3E9SA 4AXLA 2R9MA 1MDWA 2YJ2A 4IUMA 1GCBA 2NQDB 4YYQA 4FJCA 1F2BA 1U9WA 1TLOA 3BC3A 2GHUA 1NLJA 4I04A 1GECE 4I07A 2Y6EA 2XU5A 2PNSA 1KHQA 2DC8A 2XU1A 4G54A 4YYWA 3KSEA 4ZTBA 3RVVA 1U9QX 1X9YA 4YYRA 3TRKA 1TU6A 4Q8GA 1SP4B 1CJLA 1DF0A 3MHSA 3B79A 3P5WA 2JQGR 2FO5A 3KX1A 1U9XA 4PP1A 2JQFR 3H8BA 2AS8A 4FK5A 3C9EA 3CBKA 3QSDA 4RY2A 2E00A 2UZJA 4GUAA 4A5UA 5JA7A 5PADA 1YZBA 4CDEB 2FRAA 3USVA 2G7YA 1ITOA 3PHUA 1U5IA 4XZXA 4BQVA 3P5XA 4HWYA 3OVZA 3QJ3A 4D8EA 3F75A 2DCCA 1BGOA 2HWKA 1TL9A 2P86A 2B1NA 1AYVA 2PBHA 3TMPA 5A24A 2P0RA 9PAPA 4MI7A 4DMYA 2DCAA 2AUXA 2NQAA 3F5VA 5EGWA 4RNAA 1U9VA 3WXEA 4CDCB 2DCBA 1YT7A 2AYNA 3BY4A 2R9NA 3LXSA 3HHIA 1YVBA 4PT5A 1POPA 2G8EA 1AU3A 1THEA 1YK7A 1FH0A 3S3RA 1AU4A 1PXVA 1NQCA 4BS5A 1EF7A 3U8EA 1AIMA 3MTNA 4OEMA 4R3DA 4ZUXU 3N3KA 2DZZA 1F2AA 3PRPA 1ME3A 4CZWA 2G8JA 2R6NA 3HWNA 1MHWA 4YYSA 1HUCB 2J7QA 1GMYA 2G6DA 1XKGA 2FE8A 4MZSA 4YYUA 2AGAA 1NL6A 2FQ9A 3M99A 4QH6A 4BOUA 1CPJA 4BOZA 1QXPA 4OW0A 3RVXA 2HH5A 1KFUL 1PBHA 3MP2A 4XUIA 1AU2A 2R9CA 3LFYA 1KFXL 3H8CA 3OF9A 2WBFX 8PCHA 3D6SA 1ME4A 3O1GA 5E6JA 3BOWA 3MJ5A 2O6XA 4Q8HA 3B21A 1EWPA 1QOLA 1PADA 3KFQA 2PREA 2R9FA 2PADA 3E1ZB 2BDLA 3OVXA 2E03A 1PVJA 2P7UA 1S4VA 1PIPA 3PSEA 1STFE 1CQDA 3QT4A 2H7JA 2Y5BA 3IUTA
chains in the Genus database with same CATH topology
1GLOA 1KHPA 3PBHA 1VJVA 5CHVA 1W4TA 5EF4A 4QRVA 2XU3A 4BPVA 2FUDA 4YV8A 2IBIA 3BPMA 4YVAA 3HHAA 1MEMA 3MHHA 3HD3A 4WA6A 3TNXA 3BWKA 4X6IA 2VHFA 2GFOA 1PPNA 4X6HA 2HXZA 5CVNB 1W6FA 4C5PA 1NPZA 1CS8A 2BDZA 3GCBA 2DCDA 1CVZA 1Q6KA 3ERVA 4K7CA 2E02A 5CVMA 2HD5A 1EWLA 4PADA 3PW3A 2FRQA 2DC9A 3N4CA 1QMYA 4X6JA 3IMAA 4I05A 4PI3A 2ATOA 3KWBX 2CIOA 1PPPA 4N79A 4MZOA 3WXFA 3IHPA 1BY8A 3IOQA 1BQIA 2VFBA 4XR7A 1VSNA 6PADA 4W5BA 2ARYA 4CDFB 1NB3A 4DMXA 1MEGA 2E01A 2VHSA 4MSXA 4W4UA 7PCKA 1PE6A 3K24A 4OELA 5J94A 2AVWA 1GX3A 3MORA 4QRXA 1PPDA 1CSBB 1KXRA 4P6EA 1ZIVA 1YALA 3N3GA 4N8WA 2DJGB 2DJFB 1YK8A 3NHEA 2YJ8A 3V6CA 4AXMA 2BSZA 3H89A 1EWOA 1EWMA 1Y08A 2OULA 2F7DA 1AECA 3CBJA 3BPFA 5CHTA 3KWZA 1MIRA 4BSQA 5FPWA 4CDDB 4FIPA 1M6DA 1DEUA 1NB5A 1A6RA 1SNKA 3IV2A 4YYVA 1PPOA 3CH2X 2VFCA 2OZ2A 1ICFA 1CV8A 3KKUA 3P5UA 1K3BB 3WXGA 3H6SA 1IWDA 2DC6A 4BS6A 3DF0A 2DC7A 2HHNA 2AU1A 1AYUA 3H7DA 5CVOB 4KLBA 2CB5A 2XU4A 3K8UA 3AI8A 2AUZA 2C0YA 2DZYA 2IPPB 2YJCA 2YJBA 5F02A 1ZCMA 3P5VA 2NQIA 4QBBA 3OISA 4W5CA 1AU0A 3O0UA 2YJ9A 3I3TA 5JH3A 3RVWA 3BCNA 3K9MA 1F29A 3IEJA 1ATKA 2OP3A 2NQGA 1QDQA 3PNRA 1JQPA 2B1MA 2AYOA 1Y4HA 1AYWA 4BGFA 4P6GA 1BP4A 3CH3X 5K16A 1PCIA 2FYEA 3S3QA 1O0EA 2F1GA 3OF8A 1CTEA 2R9OA 3ZUAA 3V6EA 2FTDA 4PP2E 4NV8A 3PDFA 3I06A 1F2CA 2AIMA 4QRGA 1MS6A 2ACTA 2FT2A 1CB5A 3D9WA 3KW9A 4N4ZA 4AXLA 2R9MA 1MDWA 2YJ2A 4YYQA 1GCBA 2NQDB 4FJCA 1F2BA 1U9WA 1TLOA 3BC3A 2GHUA 1NLJA 4I04A 1GECE 4I07A 2Y6EA 2XU5A 2PNSA 1KHQA 2DC8A 2XU1A 4G54A 4YYWA 3KSEA 3RVVA 1U9QX 1X9YA 4YYRA 1TU6A 4Q8GA 1SP4B 1CJLA 1DF0A 3MHSA 3B79A 3P5WA 2JQGR 2FO5A 3KX1A 1U9XA 4PP1A 2JQFR 3H8BA 2AS8A 4FK5A 3C9EA 3CBKA 3QSDA 4RY2A 2E00A 5JA7A 5PADA 4CDEB 2FRAA 3USVA 2G7YA 1ITOA 1U5IA 4BQVA 3P5XA 4HWYA 3OVZA 1E2TA 3QJ3A 3F75A 2DCCA 1BGOA 1TL9A 2P86A 2B1NA 1AYVA 2PBHA 5A24A 2P0RA 9PAPA 4DMYA 2DCAA 2AUXA 2NQAA 3F5VA 5EGWA 1U9VA 3WXEA 4CDCB 2DCBA 1YT7A 2AYNA 2R9NA 3LXSA 3HHIA 1YVBA 1POPA 2G8EA 1AU3A 1THEA 1YK7A 1FH0A 1W5RA 3S3RA 1AU4A 1PXVA 4B55A 1NQCA 4BS5A 1EF7A 3U8EA 1AIMA 3MTNA 4OEMA 4ZUXU 3N3KA 2DZZA 1F2AA 3LTWA 1ME3A 4CZWA 2G8JA 2R6NA 3HWNA 1MHWA 4YYSA 1HUCB 1GMYA 2G6DA 1XKGA 4YYUA 4MZSA 1NL6A 2FQ9A 3M99A 4QH6A 1CPJA 1QXPA 3RVXA 2HH5A 1KFUL 1PBHA 4XUIA 1AU2A 2R9CA 3LFYA 1KFXL 3H8CA 3OF9A 2WBFX 8PCHA 3D6SA 1ME4A 3O1GA 3BOWA 2O6XA 4Q8HA 4NV7A 1EWPA 1QOLA 1PADA 3KFQA 2PREA 2R9FA 2PADA 3E1ZB 2BDLA 3OVXA 2E03A 4GUZA 2P7UA 1S4VA 1PIPA 1STFE 1CQDA 3QT4A 2H7JA 2Y5BA 3IUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GLO A;  1KHP A;  3PBH A;  1VJV A;  5CHV A;  5EF4 A;  4QRV A;  2XU3 A;  4BPV A;  2FUD A;  4YV8 A;  2IBI A;  3BPM A;  4YVA A;  3HHA A;  1MEM A;  3MHH A;  3HD3 A;  4WA6 A;  3TNX A;  3BWK A;  4X6I A;  2VHF A;  2GFO A;  1PPN A;  4X6H A;  2HXZ A;  5CVN B;  1NPZ A;  1CS8 A;  2BDZ A;  3GCB A;  2DCD A;  1CVZ A;  1Q6K A;  3ERV A;  4K7C A;  2E02 A;  5CVM A;  2HD5 A;  1EWL A;  4PAD A;  3PW3 A;  2FRQ A;  2DC9 A;  3N4C A;  1QMY A;  4X6J A;  3IMA A;  4I05 A;  4PI3 A;  2ATO A;  3KWB X;  2CIO A;  1PPP A;  4N79 A;  4MZO A;  3WXF A;  3IHP A;  1BY8 A;  3IOQ A;  1BQI A;  4XR7 A;  1VSN A;  6PAD A;  4W5B A;  2ARY A;  4CDF B;  1NB3 A;  4DMX A;  1MEG A;  2E01 A;  2VHS A;  4MSX A;  4W4U A;  7PCK A;  1PE6 A;  3K24 A;  4OEL A;  5J94 A;  2AVW A;  3MOR A;  4QRX A;  1PPD A;  1CSB B;  1KXR A;  4P6E A;  1ZIV A;  1YAL A;  3N3G A;  4N8W A;  2DJG B;  2DJF B;  1YK8 A;  3NHE A;  2YJ8 A;  3V6C A;  4AXM A;  3H89 A;  1EWO A;  1EWM A;  1Y08 A;  2OUL A;  2F7D A;  1AEC A;  3CBJ A;  3BPF A;  5CHT A;  3KWZ A;  1MIR A;  4BSQ A;  5FPW A;  4CDD B;  4FIP A;  1M6D A;  1DEU A;  1NB5 A;  1A6R A;  1SNK A;  3IV2 A;  4YYV A;  1PPO A;  3CH2 X;  2OZ2 A;  1ICF A;  1CV8 A;  3KKU A;  3P5U A;  1K3B B;  3WXG A;  3H6S A;  1IWD A;  2DC6 A;  4BS6 A;  3DF0 A;  2DC7 A;  2HHN A;  2AU1 A;  1AYU A;  3H7D A;  5CVO B;  4KLB A;  2CB5 A;  2XU4 A;  3K8U A;  3AI8 A;  2AUZ A;  2C0Y A;  2DZY A;  2IPP B;  2YJC A;  2YJB A;  5F02 A;  1ZCM A;  3P5V A;  2NQI A;  4QBB A;  3OIS A;  4W5C A;  1AU0 A;  3O0U A;  2YJ9 A;  3I3T A;  5JH3 A;  3RVW A;  3BCN A;  3K9M A;  1F29 A;  3IEJ A;  1ATK A;  2OP3 A;  2NQG A;  1QDQ A;  3PNR A;  1JQP A;  2B1M A;  2AYO A;  1Y4H A;  1AYW A;  4P6G A;  1BP4 A;  3CH3 X;  5K16 A;  1PCI A;  2FYE A;  3S3Q A;  1O0E A;  2F1G A;  3OF8 A;  1CTE A;  2R9O A;  3ZUA A;  3V6E A;  2FTD A;  4PP2 E;  3PDF A;  3I06 A;  1F2C A;  2AIM A;  4QRG A;  1MS6 A;  2ACT A;  2FT2 A;  1CB5 A;  3KW9 A;  4N4Z A;  4AXL A;  2R9M A;  1MDW A;  2YJ2 A;  4YYQ A;  1GCB A;  2NQD B;  4FJC A;  1F2B A;  1U9W A;  1TLO A;  3BC3 A;  2GHU A;  1NLJ A;  4I04 A;  1GEC E;  4I07 A;  2Y6E A;  2XU5 A;  2PNS A;  1KHQ A;  2DC8 A;  2XU1 A;  4G54 A;  4YYW A;  3KSE A;  3RVV A;  1U9Q X;  1X9Y A;  4YYR A;  1TU6 A;  4Q8G A;  1SP4 B;  1CJL A;  1DF0 A;  3MHS A;  3B79 A;  3P5W A;  2JQG R;  2FO5 A;  3KX1 A;  1U9X A;  4PP1 A;  2JQF R;  3H8B A;  2AS8 A;  4FK5 A;  3C9E A;  3CBK A;  3QSD A;  4RY2 A;  2E00 A;  5JA7 A;  5PAD A;  4CDE B;  2FRA A;  3USV A;  2G7Y A;  1ITO A;  1U5I A;  4BQV A;  3P5X A;  4HWY A;  3OVZ A;  3QJ3 A;  3F75 A;  2DCC A;  1BGO A;  1TL9 A;  2P86 A;  2B1N A;  1AYV A;  2PBH A;  5A24 A;  2P0R A;  9PAP A;  4DMY A;  2DCA A;  2AUX A;  2NQA A;  3F5V A;  5EGW A;  1U9V A;  3WXE A;  4CDC B;  2DCB A;  1YT7 A;  2AYN A;  2R9N A;  3LXS A;  3HHI A;  1YVB A;  1POP A;  2G8E A;  1AU3 A;  1THE A;  1YK7 A;  1FH0 A;  3S3R A;  1AU4 A;  1PXV A;  1NQC A;  4BS5 A;  1EF7 A;  3U8E A;  1AIM A;  3MTN A;  4OEM A;  4ZUX U;  3N3K A;  2DZZ A;  1F2A A;  1ME3 A;  4CZW A;  2G8J A;  2R6N A;  3HWN A;  1MHW A;  4YYS A;  1HUC B;  1GMY A;  2G6D A;  1XKG A;  4YYU A;  4MZS A;  1NL6 A;  2FQ9 A;  3M99 A;  4QH6 A;  1CPJ A;  1QXP A;  3RVX A;  2HH5 A;  1KFU L;  1PBH A;  4XUI A;  1AU2 A;  2R9C A;  3LFY A;  1KFX L;  3H8C A;  3OF9 A;  2WBF X;  8PCH A;  3D6S A;  1ME4 A;  3O1G A;  3BOW A;  2O6X A;  4Q8H A;  1EWP A;  1QOL A;  1PAD A;  3KFQ A;  2PRE A;  2R9F A;  2PAD A;  3E1Z B;  2BDL A;  3OVX A;  2E03 A;  2P7U A;  1S4V A;  1PIP A;  1STF E;  1CQD A;  3QT4 A;  2H7J A;  2Y5B A;  3IUT A; 
#chains in the Genus database with same CATH topology
 1GLO A;  1KHP A;  3PBH A;  1VJV A;  5CHV A;  5EF4 A;  3RNV A;  4QRV A;  2XU3 A;  4BPV A;  2FUD A;  2J7Q C;  4YV8 A;  2IBI A;  3BPM A;  3W30 A;  2JTC A;  4YVA A;  3HHA A;  1MEM A;  3MHH A;  3HD3 A;  4WA6 A;  3TNX A;  3BWK A;  4X6I A;  5EZQ A;  2VHF A;  2GFO A;  1PPN A;  2JRI A;  4X6H A;  2HXZ A;  5CVN B;  1NPZ A;  1CS8 A;  2BDZ A;  3GCB A;  3W31 A;  3O65 A;  2DCD A;  1CVZ A;  4OVZ B;  1Q6K A;  3ERV A;  4K7C A;  2E02 A;  5CVM A;  2HD5 A;  3ZNH A;  4D8I A;  1EWL A;  4PAD A;  3PW3 A;  2FRQ A;  2DC9 A;  3N4C A;  1QMY A;  3PHX A;  4X6J A;  3IMA A;  5KO3 A;  4I05 A;  4PI3 A;  2ATO A;  3KWB X;  2CIO A;  1PPP A;  4N79 A;  4MZO A;  3WXF A;  2BU3 A;  3IHP A;  1BY8 A;  3IOQ A;  1BQI A;  4M0W A;  4XR7 A;  1VSN A;  6PAD A;  4W5B A;  3BBA A;  2ARY A;  4CDF B;  1NB3 A;  4DMX A;  1DKI A;  1MEG A;  2E01 A;  2VHS A;  4MSX A;  4OVZ A;  4W4U A;  7PCK A;  1PE6 A;  3K24 A;  4OEL A;  5J94 A;  2AVW A;  3MOR A;  4QRX A;  1PPD A;  4RF1 A;  1CSB B;  1KXR A;  4P6E A;  3MTV A;  1ZIV A;  1YAL A;  4WUR A;  4D8B A;  3N3G A;  4N8W A;  2DJG B;  2DJF B;  1YK8 A;  3NHE A;  2YJ8 A;  3V6C A;  4AXM A;  3BB7 A;  3H89 A;  2Z84 A;  1EWO A;  1EWM A;  1Y08 A;  2OUL A;  2F7D A;  1AEC A;  3CBJ A;  3BPF A;  5CHT A;  3KWZ A;  1MIR A;  5EZS A;  5FPW A;  4BSQ A;  4CDD B;  4FIP A;  1M6D A;  1DEU A;  1NB5 A;  1A6R A;  1SNK A;  3IV2 A;  4YYV A;  1PPO A;  3CH2 X;  2OZ2 A;  1ICF A;  3PT2 A;  1CV8 A;  3KKU A;  3P5U A;  1K3B B;  3WXG A;  2BTW B;  3H6S A;  1IWD A;  5JZE A;  2DC6 A;  4RKX A;  4BS6 A;  3DF0 A;  2DC7 A;  2HHN A;  2AU1 A;  1AYU A;  3H7D A;  5CVO B;  3C0R A;  4RF0 A;  4KLB A;  2CB5 A;  2XU4 A;  3K8U A;  2DOS A;  3AI8 A;  2AUZ A;  2C0Y A;  2DZY A;  4REZ A;  2IPP B;  4IP3 A;  2YJC A;  2YJB A;  5F02 A;  4BOP A;  1ZCM A;  3P5V A;  2NQI A;  4QBB A;  4P16 A;  3OIS A;  4W5C A;  1AU0 A;  3O0U A;  2YJ9 A;  3I3T A;  5JH3 A;  3RVW A;  3BCN A;  3K9M A;  1F29 A;  3IEJ A;  2BTW A;  1ATK A;  4MM3 B;  2OP3 A;  2NQG A;  1QDQ A;  3PNR A;  1JQP A;  2B1M A;  2AYO A;  1Y4H A;  1AYW A;  4P6G A;  1BP4 A;  3CH3 X;  5K16 A;  1PCI A;  2FYE A;  3S3Q A;  1O0E A;  4BOQ A;  2F1G A;  3OF8 A;  1CTE A;  2R9O A;  3ZUA A;  3OQC A;  3V6E A;  2FTD A;  4HXD B;  4PP2 E;  3PRM A;  3PDF A;  3I06 A;  1UKF A;  1F2C A;  2AIM A;  4QRG A;  3PHW A;  4BOS A;  1MS6 A;  2ACT A;  2FT2 A;  3IFU A;  1CB5 A;  3KW9 A;  4N4Z A;  3E9S A;  4AXL A;  2R9M A;  1MDW A;  2YJ2 A;  4IUM A;  1GCB A;  2NQD B;  4YYQ A;  4FJC A;  1F2B A;  1U9W A;  1TLO A;  3BC3 A;  2GHU A;  1NLJ A;  4I04 A;  1GEC E;  4I07 A;  2Y6E A;  2XU5 A;  2PNS A;  1KHQ A;  2DC8 A;  2XU1 A;  4G54 A;  4YYW A;  3KSE A;  4ZTB A;  3RVV A;  1U9Q X;  1X9Y A;  4YYR A;  3TRK A;  1TU6 A;  4Q8G A;  1SP4 B;  1CJL A;  1DF0 A;  3MHS A;  3B79 A;  3P5W A;  2JQG R;  2FO5 A;  3KX1 A;  1U9X A;  4PP1 A;  2JQF R;  3H8B A;  2AS8 A;  4FK5 A;  3C9E A;  3CBK A;  3QSD A;  4RY2 A;  2E00 A;  2UZJ A;  4GUA A;  4A5U A;  5JA7 A;  5PAD A;  1YZB A;  4CDE B;  2FRA A;  3USV A;  2G7Y A;  1ITO A;  3PHU A;  1U5I A;  4XZX A;  4BQV A;  3P5X A;  4HWY A;  3OVZ A;  3QJ3 A;  4D8E A;  3F75 A;  2DCC A;  1BGO A;  2HWK A;  1TL9 A;  2P86 A;  2B1N A;  1AYV A;  2PBH A;  3TMP A;  5A24 A;  2P0R A;  9PAP A;  4MI7 A;  4DMY A;  2DCA A;  2AUX A;  2NQA A;  3F5V A;  5EGW A;  4RNA A;  1U9V A;  3WXE A;  4CDC B;  2DCB A;  1YT7 A;  2AYN A;  3BY4 A;  2R9N A;  3LXS A;  3HHI A;  1YVB A;  4PT5 A;  1POP A;  2G8E A;  1AU3 A;  1THE A;  1YK7 A;  1FH0 A;  3S3R A;  1AU4 A;  1PXV A;  1NQC A;  4BS5 A;  1EF7 A;  3U8E A;  1AIM A;  3MTN A;  4OEM A;  4R3D A;  4ZUX U;  3N3K A;  2DZZ A;  1F2A A;  3PRP A;  1ME3 A;  4CZW A;  2G8J A;  2R6N A;  3HWN A;  1MHW A;  4YYS A;  1HUC B;  2J7Q A;  1GMY A;  2G6D A;  1XKG A;  2FE8 A;  4MZS A;  4YYU A;  2AGA A;  1NL6 A;  2FQ9 A;  3M99 A;  4QH6 A;  4BOU A;  1CPJ A;  4BOZ A;  1QXP A;  4OW0 A;  3RVX A;  2HH5 A;  1KFU L;  1PBH A;  3MP2 A;  4XUI A;  1AU2 A;  2R9C A;  3LFY A;  1KFX L;  3H8C A;  3OF9 A;  2WBF X;  8PCH A;  3D6S A;  1ME4 A;  3O1G A;  5E6J A;  3BOW A;  3MJ5 A;  2O6X A;  4Q8H A;  3B21 A;  1EWP A;  1QOL A;  1PAD A;  3KFQ A;  2PRE A;  2R9F A;  2PAD A;  3E1Z B;  2BDL A;  3OVX A;  2E03 A;  1PVJ A;  2P7U A;  1S4V A;  1PIP A;  3PSE A;  1STF E;  1CQD A;  3QT4 A;  2H7J A;  2Y5B A;  3IUT A; 
#chains in the Genus database with same CATH homology
 1GLO A;  1KHP A;  3PBH A;  1VJV A;  5CHV A;  1W4T A;  5EF4 A;  4QRV A;  2XU3 A;  4BPV A;  2FUD A;  4YV8 A;  2IBI A;  3BPM A;  4YVA A;  3HHA A;  1MEM A;  3MHH A;  3HD3 A;  4WA6 A;  3TNX A;  3BWK A;  4X6I A;  2VHF A;  2GFO A;  1PPN A;  4X6H A;  2HXZ A;  5CVN B;  1W6F A;  4C5P A;  1NPZ A;  1CS8 A;  2BDZ A;  3GCB A;  2DCD A;  1CVZ A;  1Q6K A;  3ERV A;  4K7C A;  2E02 A;  5CVM A;  2HD5 A;  1EWL A;  4PAD A;  3PW3 A;  2FRQ A;  2DC9 A;  3N4C A;  1QMY A;  4X6J A;  3IMA A;  4I05 A;  4PI3 A;  2ATO A;  3KWB X;  2CIO A;  1PPP A;  4N79 A;  4MZO A;  3WXF A;  3IHP A;  1BY8 A;  3IOQ A;  1BQI A;  2VFB A;  4XR7 A;  1VSN A;  6PAD A;  4W5B A;  2ARY A;  4CDF B;  1NB3 A;  4DMX A;  1MEG A;  2E01 A;  2VHS A;  4MSX A;  4W4U A;  7PCK A;  1PE6 A;  3K24 A;  4OEL A;  5J94 A;  2AVW A;  1GX3 A;  3MOR A;  4QRX A;  1PPD A;  1CSB B;  1KXR A;  4P6E A;  1ZIV A;  1YAL A;  3N3G A;  4N8W A;  2DJG B;  2DJF B;  1YK8 A;  3NHE A;  2YJ8 A;  3V6C A;  4AXM A;  2BSZ A;  3H89 A;  1EWO A;  1EWM A;  1Y08 A;  2OUL A;  2F7D A;  1AEC A;  3CBJ A;  3BPF A;  5CHT A;  3KWZ A;  1MIR A;  4BSQ A;  5FPW A;  4CDD B;  4FIP A;  1M6D A;  1DEU A;  1NB5 A;  1A6R A;  1SNK A;  3IV2 A;  4YYV A;  1PPO A;  3CH2 X;  2VFC A;  2OZ2 A;  1ICF A;  1CV8 A;  3KKU A;  3P5U A;  1K3B B;  3WXG A;  3H6S A;  1IWD A;  2DC6 A;  4BS6 A;  3DF0 A;  2DC7 A;  2HHN A;  2AU1 A;  1AYU A;  3H7D A;  5CVO B;  4KLB A;  2CB5 A;  2XU4 A;  3K8U A;  3AI8 A;  2AUZ A;  2C0Y A;  2DZY A;  2IPP B;  2YJC A;  2YJB A;  5F02 A;  1ZCM A;  3P5V A;  2NQI A;  4QBB A;  3OIS A;  4W5C A;  1AU0 A;  3O0U A;  2YJ9 A;  3I3T A;  5JH3 A;  3RVW A;  3BCN A;  3K9M A;  1F29 A;  3IEJ A;  1ATK A;  2OP3 A;  2NQG A;  1QDQ A;  3PNR A;  1JQP A;  2B1M A;  2AYO A;  1Y4H A;  1AYW A;  4BGF A;  4P6G A;  1BP4 A;  3CH3 X;  5K16 A;  1PCI A;  2FYE A;  3S3Q A;  1O0E A;  2F1G A;  3OF8 A;  1CTE A;  2R9O A;  3ZUA A;  3V6E A;  2FTD A;  4PP2 E;  4NV8 A;  3PDF A;  3I06 A;  1F2C A;  2AIM A;  4QRG A;  1MS6 A;  2ACT A;  2FT2 A;  1CB5 A;  3D9W A;  3KW9 A;  4N4Z A;  4AXL A;  2R9M A;  1MDW A;  2YJ2 A;  4YYQ A;  1GCB A;  2NQD B;  4FJC A;  1F2B A;  1U9W A;  1TLO A;  3BC3 A;  2GHU A;  1NLJ A;  4I04 A;  1GEC E;  4I07 A;  2Y6E A;  2XU5 A;  2PNS A;  1KHQ A;  2DC8 A;  2XU1 A;  4G54 A;  4YYW A;  3KSE A;  3RVV A;  1U9Q X;  1X9Y A;  4YYR A;  1TU6 A;  4Q8G A;  1SP4 B;  1CJL A;  1DF0 A;  3MHS A;  3B79 A;  3P5W A;  2JQG R;  2FO5 A;  3KX1 A;  1U9X A;  4PP1 A;  2JQF R;  3H8B A;  2AS8 A;  4FK5 A;  3C9E A;  3CBK A;  3QSD A;  4RY2 A;  2E00 A;  5JA7 A;  5PAD A;  4CDE B;  2FRA A;  3USV A;  2G7Y A;  1ITO A;  1U5I A;  4BQV A;  3P5X A;  4HWY A;  3OVZ A;  1E2T A;  3QJ3 A;  3F75 A;  2DCC A;  1BGO A;  1TL9 A;  2P86 A;  2B1N A;  1AYV A;  2PBH A;  5A24 A;  2P0R A;  9PAP A;  4DMY A;  2DCA A;  2AUX A;  2NQA A;  3F5V A;  5EGW A;  1U9V A;  3WXE A;  4CDC B;  2DCB A;  1YT7 A;  2AYN A;  2R9N A;  3LXS A;  3HHI A;  1YVB A;  1POP A;  2G8E A;  1AU3 A;  1THE A;  1YK7 A;  1FH0 A;  1W5R A;  3S3R A;  1AU4 A;  1PXV A;  4B55 A;  1NQC A;  4BS5 A;  1EF7 A;  3U8E A;  1AIM A;  3MTN A;  4OEM A;  4ZUX U;  3N3K A;  2DZZ A;  1F2A A;  3LTW A;  1ME3 A;  4CZW A;  2G8J A;  2R6N A;  3HWN A;  1MHW A;  4YYS A;  1HUC B;  1GMY A;  2G6D A;  1XKG A;  4YYU A;  4MZS A;  1NL6 A;  2FQ9 A;  3M99 A;  4QH6 A;  1CPJ A;  1QXP A;  3RVX A;  2HH5 A;  1KFU L;  1PBH A;  4XUI A;  1AU2 A;  2R9C A;  3LFY A;  1KFX L;  3H8C A;  3OF9 A;  2WBF X;  8PCH A;  3D6S A;  1ME4 A;  3O1G A;  3BOW A;  2O6X A;  4Q8H A;  4NV7 A;  1EWP A;  1QOL A;  1PAD A;  3KFQ A;  2PRE A;  2R9F A;  2PAD A;  3E1Z B;  2BDL A;  3OVX A;  2E03 A;  4GUZ A;  2P7U A;  1S4V A;  1PIP A;  1STF E;  1CQD A;  3QT4 A;  2H7J A;  2Y5B A;  3IUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...