2FQ9A

Cathepsin s with nitrile inhibitor
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
218
structure length
218
Chain Sequence
b'ILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cathepsin S
publication title Cathepsin S with nitrile inhibitor
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 70
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2006-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2fq9A00
1PBHA 4PADA 4QRXA 3K9MA 3NHEA 2PNSA 4I05A 1YALA 1BP4A 1BGOA 3C9EA 1S4VA 1AU0A 1MEMA 4QRVA 3OF8A 1PPDA 2P86A 2Y5BA 5J94A 5PADA 1QMYA 2ARYA 3KKUA 1TLOA 2XU4A 1AYUA 3KSEA 4YYVA 2ATOA 2HHNA 1Y08A 2G6DA 3BPFA 1MEGA 3MHHA 3QT4A 1ICFA 2YJ9A 2DZZA 1GCBA 3V6EA 3KW9A 1EWOA 4I04A 3H8BA 4KLBA 3U8EA 1YK7A 2XU5A 2P0RA 2YJ2A 3F75A 1ZCMA 2R9MA 3PNRA 4MZOA 1U9QX 1U5IA 7PCKA 5JA7A 4X6JA 3WXEA 3M99A 3WXFA 1PPPA 2DC6A 3CH3X 2ACTA 2PREA 1KFXL 3MTNA 2DCDA 4CDDB 1NPZA 3OF9A 2DCBA 1AYVA 3KWZA 4PP2E 1NB5A 3HHAA 4YYWA 3IMAA 1CPJA 4I07A 4XR7A 2R9OA 4N79A 2FRAA 2AU1A 2HD5A 1F2CA 2BDZA 1CS8A 3KX1A 1M6DA 5EGWA 1GECE 4DMYA 1AIMA 2VHSA 3MHSA 1NB3A 5CHVA 1ME4A 1A6RA 5JH3A 3OVZA 2DZYA 3KWBX 3USVA 2H7JA 1CB5A 2HH5A 2XU1A 4W5BA 1IWDA 4QBBA 3RVXA 3DF0A 1PCIA 3CBJA 3PW3A 1PE6A 3F5VA 1PADA 2G7YA 1CV8A 1AU4A 1NLJA 1Q6KA 4ZUXU 2OP3A 2DCAA 4P6EA 2NQAA 3P5XA 1BY8A 5F02A 1F2BA 4OEMA 2NQDB 5CHTA 3IHPA 4YYUA 2HXZA 2OZ2A 2E02A 1ATKA 2DC9A 4CDEB 2YJCA 2YJ8A 1QDQA 3QSDA 2AUZA 1X9YA 2AYOA 1DF0A 3K8UA 4CDCB 3ZUAA 4RY2A 2P7UA 1SNKA 1DEUA 4QH6A 1FH0A 2B1MA 2R6NA 3PBHA 1CVZA 4FJCA 4BPVA 3BOWA 4Q8HA 3LXSA 2WBFX 3RVVA 3BCNA 1VJVA 2VHFA 5FPWA 4N8WA 2OULA 3CBKA 3OVXA 1NL6A 1GMYA 4K7CA 3S3RA 4MZSA 2E01A 4HWYA 2PBHA 3HWNA 2GHUA 3P5UA 1CQDA 1PPNA 4FK5A 1AYWA 1CSBB 1EWPA 2JQGR 3ERVA 4X6IA 4P6GA 3E1ZB 2R9CA 3RVWA 4DMXA 1O0EA 5CVMA 3N3GA 2AS8A 2CIOA 3KFQA 1QXPA 4YYQA 3O0UA 3AI8A 1MS6A 1EWMA 3I06A 1YVBA 4G54A 2R9NA 3IV2A 1KFUL 2R9FA 3CH2X 1HUCB 1U9WA 2PADA 2B1NA 2XU3A 3I3TA 3MORA 2BDLA 3WXGA 3P5WA 1MHWA 1YK8A 1XKGA 2O6XA 3B79A 4QRGA 3V6CA 3K24A 2IPPB 3HHIA 4W4UA 1POPA 4N4ZA 3N3KA 1THEA 4BS5A 1ITOA 3QJ3A 3LFYA 4YVAA 1CTEA 4W5CA 1PIPA 3P5VA 8PCHA 1EWLA 1ZIVA 1TL9A 1PXVA 2F1GA 1SP4B 2DC7A 1JQPA 1F29A 2C0YA 2AUXA 3H7DA 5CVNB 2FUDA 1KHPA 3TNXA 2NQIA 4PP1A 2DJGB 2CB5A 3D6SA 1YT7A 2AYNA 6PADA 1QOLA 1AU3A 2FRQA 1MDWA 2FO5A 2FYEA 2DC8A 4PI3A 4XUIA 3OISA 4BSQA 2FTDA 2F7DA 1K3BB 1VSNA 2IBIA 2E03A 1PPOA 1Y4HA 2Y6EA 2AIMA 3H6SA 3O1GA 4CZWA 9PAPA 1U9XA 2FQ9A 1U9VA 4BQVA 2NQGA 2G8JA 4WA6A 4MSXA 1CJLA 4BS6A 3IUTA 5CVOB 4YV8A 3S3QA 1STFE 3GCBA 3H89A 2DCCA 4YYSA 2E00A 3IEJA 4CDFB 1MIRA 2GFOA 4FIPA 5EF4A 3H8CA 1F2AA 1ME3A 2YJBA 3PDFA 3IOQA 2FT2A 4X6HA 2JQFR 3N4CA 4YYRA 2AVWA 4AXLA 1AECA 1KHQA 3BPMA 5K16A 1BQIA 1TU6A 2DJFB 2G8EA 4Q8GA 5A24A 1GLOA 3BWKA 4OELA 1AU2A 1NQCA 4AXMA 3HD3A 1EF7A 3BC3A 1KXRA
chains in the Genus database with same CATH superfamily
3PRPA 1PBHA 5EZSA 4PADA 4QRXA 1DKIA 3K9MA 3C0RA 3NHEA 2PNSA 4I05A 1YALA 1BP4A 1BGOA 3C9EA 1S4VA 1AU0A 1MEMA 4QRVA 3OF8A 3BBAA 1PPDA 2P86A 2Y5BA 5J94A 5PADA 1QMYA 2ARYA 3KKUA 1TLOA 2XU4A 1AYUA 3KSEA 4YYVA 2ATOA 2HHNA 1Y08A 2G6DA 3BPFA 1MEGA 3MHHA 3QT4A 1ICFA 2YJ9A 2DZZA 1GCBA 3V6EA 3KW9A 1EWOA 4I04A 4OVZB 3H8BA 3PT2A 4KLBA 3U8EA 1YK7A 2XU5A 2P0RA 2YJ2A 3F75A 1ZCMA 2R9MA 3PNRA 4MZOA 5EZQA 4RF0A 1U9QX 1U5IA 7PCKA 4M0WA 5E6JA 5JA7A 4X6JA 3WXEA 3RNVA 3M99A 3WXFA 4BOPA 1PPPA 2DC6A 3CH3X 2ACTA 3TMPA 2PREA 1KFXL 3MTNA 2DCDA 4CDDB 1NPZA 3OF9A 2DCBA 4RF1A 1AYVA 3KWZA 4PP2E 1NB5A 3HHAA 4YYWA 3IMAA 1CPJA 4I07A 4XR7A 2R9OA 3W31A 4N79A 2FRAA 2AU1A 2HD5A 1F2CA 2BDZA 1CS8A 3KX1A 2AGAA 1M6DA 5EGWA 1GECE 4DMYA 1AIMA 2VHSA 3MHSA 2J7QA 1NB3A 5KO3A 5CHVA 1ME4A 1A6RA 5JH3A 3OVZA 2DZYA 3KWBX 3USVA 2H7JA 1CB5A 2HH5A 2XU1A 4RNAA 4W5BA 4MM3B 3ZNHA 4BOZA 1IWDA 4QBBA 3RVXA 4REZA 3DF0A 1PCIA 3CBJA 3PW3A 1PE6A 3F5VA 4R3DA 1PADA 2G7YA 1CV8A 1AU4A 1NLJA 1Q6KA 4ZUXU 2OP3A 2DCAA 2NQAA 4P6EA 4RKXA 3P5XA 1BY8A 5F02A 1F2BA 4OEMA 2NQDB 5CHTA 3IHPA 4YYUA 2HXZA 2OZ2A 2E02A 1ATKA 2DC9A 4CDEB 2YJCA 2YJ8A 1QDQA 3QSDA 2AUZA 4ZTBA 1X9YA 2AYOA 1DF0A 3K8UA 4CDCB 3ZUAA 4RY2A 2P7UA 1SNKA 1DEUA 4QH6A 1FH0A 2B1MA 2R6NA 3PBHA 1CVZA 4FJCA 4BPVA 3BOWA 4Q8HA 3BB7A 3LXSA 2WBFX 3RVVA 3BCNA 1VJVA 2VHFA 5FPWA 4N8WA 2OULA 3CBKA 3OVXA 1NL6A 1GMYA 3PRMA 4K7CA 2FE8A 2DOSA 3S3RA 4MZSA 2E01A 4HWYA 2PBHA 3HWNA 2GHUA 3P5UA 1CQDA 1PPNA 4FK5A 1AYWA 1CSBB 1EWPA 2JQGR 3ERVA 4X6IA 4P6GA 3E1ZB 2R9CA 3RVWA 4DMXA 1O0EA 5CVMA 3N3GA 2AS8A 2CIOA 3KFQA 3MP2A 3PHUA 1QXPA 3PHXA 4D8BA 4YYQA 3O0UA 3AI8A 1MS6A 1EWMA 3I06A 1YVBA 4G54A 2R9NA 3IV2A 1KFUL 2R9FA 3CH2X 1HUCB 1UKFA 4BOQA 1U9WA 2PADA 2B1NA 2XU3A 3I3TA 3MORA 4IUMA 2BDLA 3WXGA 3P5WA 1MHWA 2UZJA 1YK8A 4BOUA 1XKGA 2O6XA 3B21A 3B79A 4QRGA 3V6CA 3K24A 2IPPB 1YZBA 3HHIA 3TRKA 4W4UA 1POPA 4N4ZA 3N3KA 4OW0A 1THEA 4BS5A 1ITOA 3QJ3A 2J7QC 3LFYA 4YVAA 1CTEA 4W5CA 1PIPA 3P5VA 4WURA 8PCHA 1EWLA 1ZIVA 1TL9A 1PXVA 2F1GA 4PT5A 1SP4B 1PVJA 2JTCA 2DC7A 1JQPA 1F29A 2C0YA 2AUXA 3H7DA 5CVNB 2FUDA 1KHPA 4BOSA 3TNXA 2NQIA 4PP1A 2DJGB 2CB5A 3D6SA 2JRIA 1YT7A 2AYNA 6PADA 1QOLA 4XZXA 1AU3A 2BU3A 3W30A 2FRQA 1MDWA 2FO5A 2FYEA 2DC8A 4PI3A 2HWKA 4XUIA 3OISA 4BSQA 2FTDA 2BTWA 3PSEA 2F7DA 4D8IA 1K3BB 4HXDB 4IP3A 1VSNA 2IBIA 2E03A 1PPOA 1Y4HA 2Y6EA 2AIMA 3H6SA 3O65A 3O1GA 4CZWA 9PAPA 1U9XA 2FQ9A 1U9VA 4BQVA 2NQGA 3OQCA 3E9SA 2G8JA 4WA6A 4MSXA 1CJLA 4BS6A 3IUTA 5CVOB 4YV8A 3S3QA 3MJ5A 1STFE 3MTVA 3GCBA 3H89A 2DCCA 4YYSA 2E00A 3IEJA 2Z84A 4CDFB 4A5UA 1MIRA 2GFOA 4FIPA 5EF4A 4MI7A 3H8CA 1F2AA 1ME3A 3BY4A 3PHWA 2YJBA 3PDFA 3IOQA 2FT2A 4X6HA 4OVZA 2JQFR 3N4CA 4YYRA 2AVWA 4AXLA 1AECA 4GUAA 1KHQA 3BPMA 3IFUA 5K16A 2BTWB 1BQIA 1TU6A 2DJFB 2G8EA 4Q8GA 4P16A 1GLOA 5A24A 4D8EA 3BWKA 4OELA 5JZEA 1AU2A 1NQCA 4AXMA 3HD3A 1EF7A 3BC3A 1KXRA
chains in the Genus database with same CATH topology
1PBHA 4PADA 4QRXA 3K9MA 3NHEA 2PNSA 4I05A 1YALA 1BP4A 1BGOA 3C9EA 1S4VA 1AU0A 1MEMA 4QRVA 3OF8A 1PPDA 2P86A 2Y5BA 5J94A 5PADA 1QMYA 2ARYA 3KKUA 1TLOA 2XU4A 1AYUA 3KSEA 4YYVA 2ATOA 2HHNA 1Y08A 2G6DA 3BPFA 1MEGA 3MHHA 3QT4A 1ICFA 2YJ9A 2DZZA 1GCBA 3V6EA 3KW9A 1EWOA 2VFBA 4I04A 3H8BA 4KLBA 3U8EA 1YK7A 2XU5A 2P0RA 2VFCA 2YJ2A 3F75A 1ZCMA 2R9MA 3PNRA 4MZOA 1U9QX 1U5IA 7PCKA 5JA7A 4X6JA 3WXEA 3M99A 3WXFA 1PPPA 2DC6A 3CH3X 2ACTA 2PREA 1KFXL 3MTNA 2DCDA 4CDDB 1NPZA 3OF9A 2DCBA 1AYVA 3KWZA 4PP2E 1NB5A 3HHAA 4YYWA 3IMAA 1CPJA 4I07A 4XR7A 2R9OA 4N79A 2FRAA 2AU1A 2HD5A 1F2CA 2BDZA 4C5PA 1CS8A 3KX1A 1M6DA 5EGWA 1GX3A 1GECE 4DMYA 1AIMA 2VHSA 3MHSA 1NB3A 4B55A 5CHVA 1ME4A 1A6RA 5JH3A 3OVZA 2DZYA 3KWBX 3USVA 2H7JA 1CB5A 2HH5A 2XU1A 4W5BA 1W4TA 1IWDA 4QBBA 3RVXA 3DF0A 1PCIA 3CBJA 3PW3A 1PE6A 3F5VA 1PADA 2G7YA 1CV8A 2BSZA 1AU4A 1NLJA 1Q6KA 4ZUXU 2OP3A 2DCAA 2NQAA 4P6EA 3P5XA 1BY8A 5F02A 1F2BA 4OEMA 2NQDB 5CHTA 3IHPA 4YYUA 2HXZA 2OZ2A 2E02A 1ATKA 2DC9A 4CDEB 2YJCA 2YJ8A 1QDQA 3QSDA 2AUZA 1X9YA 2AYOA 1DF0A 3K8UA 4CDCB 3ZUAA 4RY2A 2P7UA 1SNKA 4NV7A 1DEUA 4QH6A 1FH0A 2B1MA 2R6NA 3PBHA 4NV8A 1CVZA 4FJCA 4BPVA 3BOWA 4Q8HA 3LXSA 2WBFX 3RVVA 3BCNA 1VJVA 2VHFA 5FPWA 4N8WA 2OULA 3CBKA 3OVXA 1NL6A 1GMYA 4K7CA 3S3RA 4MZSA 2E01A 4HWYA 1W6FA 1E2TA 2PBHA 3HWNA 2GHUA 3P5UA 1CQDA 1PPNA 4FK5A 1AYWA 1CSBB 1EWPA 2JQGR 3ERVA 4X6IA 4P6GA 3E1ZB 2R9CA 3RVWA 4DMXA 1O0EA 5CVMA 3N3GA 2AS8A 2CIOA 3KFQA 1QXPA 4YYQA 3O0UA 3AI8A 1MS6A 1EWMA 3I06A 1YVBA 4G54A 2R9NA 3IV2A 1KFUL 2R9FA 3CH2X 1HUCB 1U9WA 2PADA 2B1NA 2XU3A 3I3TA 3MORA 2BDLA 1W5RA 3WXGA 3P5WA 1MHWA 1YK8A 1XKGA 2O6XA 3B79A 4QRGA 3V6CA 3K24A 2IPPB 3HHIA 4W4UA 4GUZA 1POPA 4N4ZA 3N3KA 1THEA 4BS5A 1ITOA 3QJ3A 3LFYA 4BGFA 4YVAA 1CTEA 4W5CA 1PIPA 3P5VA 8PCHA 1EWLA 1ZIVA 1TL9A 1PXVA 2F1GA 1SP4B 2DC7A 1JQPA 1F29A 2C0YA 2AUXA 3H7DA 5CVNB 2FUDA 1KHPA 3TNXA 2NQIA 4PP1A 2DJGB 2CB5A 3D6SA 1YT7A 2AYNA 6PADA 1QOLA 3D9WA 1AU3A 2FRQA 1MDWA 2FO5A 2FYEA 2DC8A 4PI3A 4XUIA 3OISA 4BSQA 2FTDA 2F7DA 1K3BB 1VSNA 2IBIA 2E03A 1PPOA 1Y4HA 2Y6EA 2AIMA 3H6SA 3LTWA 3O1GA 4CZWA 9PAPA 1U9XA 2FQ9A 1U9VA 4BQVA 2NQGA 2G8JA 4WA6A 4MSXA 1CJLA 4BS6A 3IUTA 5CVOB 4YV8A 3S3QA 1STFE 3GCBA 3H89A 2DCCA 4YYSA 2E00A 3IEJA 4CDFB 1MIRA 2GFOA 4FIPA 5EF4A 3H8CA 1F2AA 1ME3A 2YJBA 3PDFA 3IOQA 2FT2A 4X6HA 2JQFR 3N4CA 4YYRA 2AVWA 4AXLA 1AECA 1KHQA 3BPMA 5K16A 1BQIA 1TU6A 2DJFB 2G8EA 4Q8GA 5A24A 1GLOA 3BWKA 4OELA 1AU2A 1NQCA 4AXMA 3HD3A 1EF7A 3BC3A 1KXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PBH A;  4PAD A;  4QRX A;  3K9M A;  3NHE A;  2PNS A;  4I05 A;  1YAL A;  1BP4 A;  1BGO A;  3C9E A;  1S4V A;  1AU0 A;  1MEM A;  4QRV A;  3OF8 A;  1PPD A;  2P86 A;  2Y5B A;  5J94 A;  5PAD A;  1QMY A;  2ARY A;  3KKU A;  1TLO A;  2XU4 A;  1AYU A;  3KSE A;  4YYV A;  2ATO A;  2HHN A;  1Y08 A;  2G6D A;  3BPF A;  1MEG A;  3MHH A;  3QT4 A;  1ICF A;  2YJ9 A;  2DZZ A;  1GCB A;  3V6E A;  3KW9 A;  1EWO A;  4I04 A;  3H8B A;  4KLB A;  3U8E A;  1YK7 A;  2XU5 A;  2P0R A;  2YJ2 A;  3F75 A;  1ZCM A;  2R9M A;  3PNR A;  4MZO A;  1U9Q X;  1U5I A;  7PCK A;  5JA7 A;  4X6J A;  3WXE A;  3M99 A;  3WXF A;  1PPP A;  2DC6 A;  3CH3 X;  2ACT A;  2PRE A;  1KFX L;  3MTN A;  2DCD A;  4CDD B;  1NPZ A;  3OF9 A;  2DCB A;  1AYV A;  3KWZ A;  4PP2 E;  1NB5 A;  3HHA A;  4YYW A;  3IMA A;  1CPJ A;  4I07 A;  4XR7 A;  2R9O A;  4N79 A;  2FRA A;  2AU1 A;  2HD5 A;  1F2C A;  2BDZ A;  1CS8 A;  3KX1 A;  1M6D A;  5EGW A;  1GEC E;  4DMY A;  1AIM A;  2VHS A;  3MHS A;  1NB3 A;  5CHV A;  1ME4 A;  1A6R A;  5JH3 A;  3OVZ A;  2DZY A;  3KWB X;  3USV A;  2H7J A;  1CB5 A;  2HH5 A;  2XU1 A;  4W5B A;  1IWD A;  4QBB A;  3RVX A;  3DF0 A;  1PCI A;  3CBJ A;  3PW3 A;  1PE6 A;  3F5V A;  1PAD A;  2G7Y A;  1CV8 A;  1AU4 A;  1NLJ A;  1Q6K A;  4ZUX U;  2OP3 A;  2DCA A;  4P6E A;  2NQA A;  3P5X A;  1BY8 A;  5F02 A;  1F2B A;  4OEM A;  2NQD B;  5CHT A;  3IHP A;  4YYU A;  2HXZ A;  2OZ2 A;  2E02 A;  1ATK A;  2DC9 A;  4CDE B;  2YJC A;  2YJ8 A;  1QDQ A;  3QSD A;  2AUZ A;  1X9Y A;  2AYO A;  1DF0 A;  3K8U A;  4CDC B;  3ZUA A;  4RY2 A;  2P7U A;  1SNK A;  1DEU A;  4QH6 A;  1FH0 A;  2B1M A;  2R6N A;  3PBH A;  1CVZ A;  4FJC A;  4BPV A;  3BOW A;  4Q8H A;  3LXS A;  2WBF X;  3RVV A;  3BCN A;  1VJV A;  2VHF A;  5FPW A;  4N8W A;  2OUL A;  3CBK A;  3OVX A;  1NL6 A;  1GMY A;  4K7C A;  3S3R A;  4MZS A;  2E01 A;  4HWY A;  2PBH A;  3HWN A;  2GHU A;  3P5U A;  1CQD A;  1PPN A;  4FK5 A;  1AYW A;  1CSB B;  1EWP A;  2JQG R;  3ERV A;  4X6I A;  4P6G A;  3E1Z B;  2R9C A;  3RVW A;  4DMX A;  1O0E A;  5CVM A;  3N3G A;  2AS8 A;  2CIO A;  3KFQ A;  1QXP A;  4YYQ A;  3O0U A;  3AI8 A;  1MS6 A;  1EWM A;  3I06 A;  1YVB A;  4G54 A;  2R9N A;  3IV2 A;  1KFU L;  2R9F A;  3CH2 X;  1HUC B;  1U9W A;  2PAD A;  2B1N A;  2XU3 A;  3I3T A;  3MOR A;  2BDL A;  3WXG A;  3P5W A;  1MHW A;  1YK8 A;  1XKG A;  2O6X A;  3B79 A;  4QRG A;  3V6C A;  3K24 A;  2IPP B;  3HHI A;  4W4U A;  1POP A;  4N4Z A;  3N3K A;  1THE A;  4BS5 A;  1ITO A;  3QJ3 A;  3LFY A;  4YVA A;  1CTE A;  4W5C A;  1PIP A;  3P5V A;  8PCH A;  1EWL A;  1ZIV A;  1TL9 A;  1PXV A;  2F1G A;  1SP4 B;  2DC7 A;  1JQP A;  1F29 A;  2C0Y A;  2AUX A;  3H7D A;  5CVN B;  2FUD A;  1KHP A;  3TNX A;  2NQI A;  4PP1 A;  2DJG B;  2CB5 A;  3D6S A;  1YT7 A;  2AYN A;  6PAD A;  1QOL A;  1AU3 A;  2FRQ A;  1MDW A;  2FO5 A;  2FYE A;  2DC8 A;  4PI3 A;  4XUI A;  3OIS A;  4BSQ A;  2FTD A;  2F7D A;  1K3B B;  1VSN A;  2IBI A;  2E03 A;  1PPO A;  1Y4H A;  2Y6E A;  2AIM A;  3H6S A;  3O1G A;  4CZW A;  9PAP A;  1U9X A;  2FQ9 A;  1U9V A;  4BQV A;  2NQG A;  2G8J A;  4WA6 A;  4MSX A;  1CJL A;  4BS6 A;  3IUT A;  5CVO B;  4YV8 A;  3S3Q A;  1STF E;  3GCB A;  3H89 A;  2DCC A;  4YYS A;  2E00 A;  3IEJ A;  4CDF B;  1MIR A;  2GFO A;  4FIP A;  5EF4 A;  3H8C A;  1F2A A;  1ME3 A;  2YJB A;  3PDF A;  3IOQ A;  2FT2 A;  4X6H A;  2JQF R;  3N4C A;  4YYR A;  2AVW A;  4AXL A;  1AEC A;  1KHQ A;  3BPM A;  5K16 A;  1BQI A;  1TU6 A;  2DJF B;  2G8E A;  4Q8G A;  5A24 A;  1GLO A;  3BWK A;  4OEL A;  1AU2 A;  1NQC A;  4AXM A;  3HD3 A;  1EF7 A;  3BC3 A;  1KXR A; 
#chains in the Genus database with same CATH topology
 3PRP A;  1PBH A;  5EZS A;  4PAD A;  4QRX A;  1DKI A;  3K9M A;  3C0R A;  3NHE A;  2PNS A;  4I05 A;  1YAL A;  1BP4 A;  1BGO A;  3C9E A;  1S4V A;  1AU0 A;  1MEM A;  4QRV A;  3OF8 A;  3BBA A;  1PPD A;  2P86 A;  2Y5B A;  5J94 A;  5PAD A;  1QMY A;  2ARY A;  3KKU A;  1TLO A;  2XU4 A;  1AYU A;  3KSE A;  4YYV A;  2ATO A;  2HHN A;  1Y08 A;  2G6D A;  3BPF A;  1MEG A;  3MHH A;  3QT4 A;  1ICF A;  2YJ9 A;  2DZZ A;  1GCB A;  3V6E A;  3KW9 A;  1EWO A;  4I04 A;  4OVZ B;  3H8B A;  3PT2 A;  4KLB A;  3U8E A;  1YK7 A;  2XU5 A;  2P0R A;  2YJ2 A;  3F75 A;  1ZCM A;  2R9M A;  3PNR A;  4MZO A;  5EZQ A;  4RF0 A;  1U9Q X;  1U5I A;  7PCK A;  4M0W A;  5E6J A;  5JA7 A;  4X6J A;  3WXE A;  3RNV A;  3M99 A;  3WXF A;  4BOP A;  1PPP A;  2DC6 A;  3CH3 X;  2ACT A;  3TMP A;  2PRE A;  1KFX L;  3MTN A;  2DCD A;  4CDD B;  1NPZ A;  3OF9 A;  2DCB A;  4RF1 A;  1AYV A;  3KWZ A;  4PP2 E;  1NB5 A;  3HHA A;  4YYW A;  3IMA A;  1CPJ A;  4I07 A;  4XR7 A;  2R9O A;  3W31 A;  4N79 A;  2FRA A;  2AU1 A;  2HD5 A;  1F2C A;  2BDZ A;  1CS8 A;  3KX1 A;  2AGA A;  1M6D A;  5EGW A;  1GEC E;  4DMY A;  1AIM A;  2VHS A;  3MHS A;  2J7Q A;  1NB3 A;  5KO3 A;  5CHV A;  1ME4 A;  1A6R A;  5JH3 A;  3OVZ A;  2DZY A;  3KWB X;  3USV A;  2H7J A;  1CB5 A;  2HH5 A;  2XU1 A;  4RNA A;  4W5B A;  4MM3 B;  3ZNH A;  4BOZ A;  1IWD A;  4QBB A;  3RVX A;  4REZ A;  3DF0 A;  1PCI A;  3CBJ A;  3PW3 A;  1PE6 A;  3F5V A;  4R3D A;  1PAD A;  2G7Y A;  1CV8 A;  1AU4 A;  1NLJ A;  1Q6K A;  4ZUX U;  2OP3 A;  2DCA A;  2NQA A;  4P6E A;  4RKX A;  3P5X A;  1BY8 A;  5F02 A;  1F2B A;  4OEM A;  2NQD B;  5CHT A;  3IHP A;  4YYU A;  2HXZ A;  2OZ2 A;  2E02 A;  1ATK A;  2DC9 A;  4CDE B;  2YJC A;  2YJ8 A;  1QDQ A;  3QSD A;  2AUZ A;  4ZTB A;  1X9Y A;  2AYO A;  1DF0 A;  3K8U A;  4CDC B;  3ZUA A;  4RY2 A;  2P7U A;  1SNK A;  1DEU A;  4QH6 A;  1FH0 A;  2B1M A;  2R6N A;  3PBH A;  1CVZ A;  4FJC A;  4BPV A;  3BOW A;  4Q8H A;  3BB7 A;  3LXS A;  2WBF X;  3RVV A;  3BCN A;  1VJV A;  2VHF A;  5FPW A;  4N8W A;  2OUL A;  3CBK A;  3OVX A;  1NL6 A;  1GMY A;  3PRM A;  4K7C A;  2FE8 A;  2DOS A;  3S3R A;  4MZS A;  2E01 A;  4HWY A;  2PBH A;  3HWN A;  2GHU A;  3P5U A;  1CQD A;  1PPN A;  4FK5 A;  1AYW A;  1CSB B;  1EWP A;  2JQG R;  3ERV A;  4X6I A;  4P6G A;  3E1Z B;  2R9C A;  3RVW A;  4DMX A;  1O0E A;  5CVM A;  3N3G A;  2AS8 A;  2CIO A;  3KFQ A;  3MP2 A;  3PHU A;  1QXP A;  3PHX A;  4D8B A;  4YYQ A;  3O0U A;  3AI8 A;  1MS6 A;  1EWM A;  3I06 A;  1YVB A;  4G54 A;  2R9N A;  3IV2 A;  1KFU L;  2R9F A;  3CH2 X;  1HUC B;  1UKF A;  4BOQ A;  1U9W A;  2PAD A;  2B1N A;  2XU3 A;  3I3T A;  3MOR A;  4IUM A;  2BDL A;  3WXG A;  3P5W A;  1MHW A;  2UZJ A;  1YK8 A;  4BOU A;  1XKG A;  2O6X A;  3B21 A;  3B79 A;  4QRG A;  3V6C A;  3K24 A;  2IPP B;  1YZB A;  3HHI A;  3TRK A;  4W4U A;  1POP A;  4N4Z A;  3N3K A;  4OW0 A;  1THE A;  4BS5 A;  1ITO A;  3QJ3 A;  2J7Q C;  3LFY A;  4YVA A;  1CTE A;  4W5C A;  1PIP A;  3P5V A;  4WUR A;  8PCH A;  1EWL A;  1ZIV A;  1TL9 A;  1PXV A;  2F1G A;  4PT5 A;  1SP4 B;  1PVJ A;  2JTC A;  2DC7 A;  1JQP A;  1F29 A;  2C0Y A;  2AUX A;  3H7D A;  5CVN B;  2FUD A;  1KHP A;  4BOS A;  3TNX A;  2NQI A;  4PP1 A;  2DJG B;  2CB5 A;  3D6S A;  2JRI A;  1YT7 A;  2AYN A;  6PAD A;  1QOL A;  4XZX A;  1AU3 A;  2BU3 A;  3W30 A;  2FRQ A;  1MDW A;  2FO5 A;  2FYE A;  2DC8 A;  4PI3 A;  2HWK A;  4XUI A;  3OIS A;  4BSQ A;  2FTD A;  2BTW A;  3PSE A;  2F7D A;  4D8I A;  1K3B B;  4HXD B;  4IP3 A;  1VSN A;  2IBI A;  2E03 A;  1PPO A;  1Y4H A;  2Y6E A;  2AIM A;  3H6S A;  3O65 A;  3O1G A;  4CZW A;  9PAP A;  1U9X A;  2FQ9 A;  1U9V A;  4BQV A;  2NQG A;  3OQC A;  3E9S A;  2G8J A;  4WA6 A;  4MSX A;  1CJL A;  4BS6 A;  3IUT A;  5CVO B;  4YV8 A;  3S3Q A;  3MJ5 A;  1STF E;  3MTV A;  3GCB A;  3H89 A;  2DCC A;  4YYS A;  2E00 A;  3IEJ A;  2Z84 A;  4CDF B;  4A5U A;  1MIR A;  2GFO A;  4FIP A;  5EF4 A;  4MI7 A;  3H8C A;  1F2A A;  1ME3 A;  3BY4 A;  3PHW A;  2YJB A;  3PDF A;  3IOQ A;  2FT2 A;  4X6H A;  4OVZ A;  2JQF R;  3N4C A;  4YYR A;  2AVW A;  4AXL A;  1AEC A;  4GUA A;  1KHQ A;  3BPM A;  3IFU A;  5K16 A;  2BTW B;  1BQI A;  1TU6 A;  2DJF B;  2G8E A;  4Q8G A;  4P16 A;  1GLO A;  5A24 A;  4D8E A;  3BWK A;  4OEL A;  5JZE A;  1AU2 A;  1NQC A;  4AXM A;  3HD3 A;  1EF7 A;  3BC3 A;  1KXR A; 
#chains in the Genus database with same CATH homology
 1PBH A;  4PAD A;  4QRX A;  3K9M A;  3NHE A;  2PNS A;  4I05 A;  1YAL A;  1BP4 A;  1BGO A;  3C9E A;  1S4V A;  1AU0 A;  1MEM A;  4QRV A;  3OF8 A;  1PPD A;  2P86 A;  2Y5B A;  5J94 A;  5PAD A;  1QMY A;  2ARY A;  3KKU A;  1TLO A;  2XU4 A;  1AYU A;  3KSE A;  4YYV A;  2ATO A;  2HHN A;  1Y08 A;  2G6D A;  3BPF A;  1MEG A;  3MHH A;  3QT4 A;  1ICF A;  2YJ9 A;  2DZZ A;  1GCB A;  3V6E A;  3KW9 A;  1EWO A;  2VFB A;  4I04 A;  3H8B A;  4KLB A;  3U8E A;  1YK7 A;  2XU5 A;  2P0R A;  2VFC A;  2YJ2 A;  3F75 A;  1ZCM A;  2R9M A;  3PNR A;  4MZO A;  1U9Q X;  1U5I A;  7PCK A;  5JA7 A;  4X6J A;  3WXE A;  3M99 A;  3WXF A;  1PPP A;  2DC6 A;  3CH3 X;  2ACT A;  2PRE A;  1KFX L;  3MTN A;  2DCD A;  4CDD B;  1NPZ A;  3OF9 A;  2DCB A;  1AYV A;  3KWZ A;  4PP2 E;  1NB5 A;  3HHA A;  4YYW A;  3IMA A;  1CPJ A;  4I07 A;  4XR7 A;  2R9O A;  4N79 A;  2FRA A;  2AU1 A;  2HD5 A;  1F2C A;  2BDZ A;  4C5P A;  1CS8 A;  3KX1 A;  1M6D A;  5EGW A;  1GX3 A;  1GEC E;  4DMY A;  1AIM A;  2VHS A;  3MHS A;  1NB3 A;  4B55 A;  5CHV A;  1ME4 A;  1A6R A;  5JH3 A;  3OVZ A;  2DZY A;  3KWB X;  3USV A;  2H7J A;  1CB5 A;  2HH5 A;  2XU1 A;  4W5B A;  1W4T A;  1IWD A;  4QBB A;  3RVX A;  3DF0 A;  1PCI A;  3CBJ A;  3PW3 A;  1PE6 A;  3F5V A;  1PAD A;  2G7Y A;  1CV8 A;  2BSZ A;  1AU4 A;  1NLJ A;  1Q6K A;  4ZUX U;  2OP3 A;  2DCA A;  2NQA A;  4P6E A;  3P5X A;  1BY8 A;  5F02 A;  1F2B A;  4OEM A;  2NQD B;  5CHT A;  3IHP A;  4YYU A;  2HXZ A;  2OZ2 A;  2E02 A;  1ATK A;  2DC9 A;  4CDE B;  2YJC A;  2YJ8 A;  1QDQ A;  3QSD A;  2AUZ A;  1X9Y A;  2AYO A;  1DF0 A;  3K8U A;  4CDC B;  3ZUA A;  4RY2 A;  2P7U A;  1SNK A;  4NV7 A;  1DEU A;  4QH6 A;  1FH0 A;  2B1M A;  2R6N A;  3PBH A;  4NV8 A;  1CVZ A;  4FJC A;  4BPV A;  3BOW A;  4Q8H A;  3LXS A;  2WBF X;  3RVV A;  3BCN A;  1VJV A;  2VHF A;  5FPW A;  4N8W A;  2OUL A;  3CBK A;  3OVX A;  1NL6 A;  1GMY A;  4K7C A;  3S3R A;  4MZS A;  2E01 A;  4HWY A;  1W6F A;  1E2T A;  2PBH A;  3HWN A;  2GHU A;  3P5U A;  1CQD A;  1PPN A;  4FK5 A;  1AYW A;  1CSB B;  1EWP A;  2JQG R;  3ERV A;  4X6I A;  4P6G A;  3E1Z B;  2R9C A;  3RVW A;  4DMX A;  1O0E A;  5CVM A;  3N3G A;  2AS8 A;  2CIO A;  3KFQ A;  1QXP A;  4YYQ A;  3O0U A;  3AI8 A;  1MS6 A;  1EWM A;  3I06 A;  1YVB A;  4G54 A;  2R9N A;  3IV2 A;  1KFU L;  2R9F A;  3CH2 X;  1HUC B;  1U9W A;  2PAD A;  2B1N A;  2XU3 A;  3I3T A;  3MOR A;  2BDL A;  1W5R A;  3WXG A;  3P5W A;  1MHW A;  1YK8 A;  1XKG A;  2O6X A;  3B79 A;  4QRG A;  3V6C A;  3K24 A;  2IPP B;  3HHI A;  4W4U A;  4GUZ A;  1POP A;  4N4Z A;  3N3K A;  1THE A;  4BS5 A;  1ITO A;  3QJ3 A;  3LFY A;  4BGF A;  4YVA A;  1CTE A;  4W5C A;  1PIP A;  3P5V A;  8PCH A;  1EWL A;  1ZIV A;  1TL9 A;  1PXV A;  2F1G A;  1SP4 B;  2DC7 A;  1JQP A;  1F29 A;  2C0Y A;  2AUX A;  3H7D A;  5CVN B;  2FUD A;  1KHP A;  3TNX A;  2NQI A;  4PP1 A;  2DJG B;  2CB5 A;  3D6S A;  1YT7 A;  2AYN A;  6PAD A;  1QOL A;  3D9W A;  1AU3 A;  2FRQ A;  1MDW A;  2FO5 A;  2FYE A;  2DC8 A;  4PI3 A;  4XUI A;  3OIS A;  4BSQ A;  2FTD A;  2F7D A;  1K3B B;  1VSN A;  2IBI A;  2E03 A;  1PPO A;  1Y4H A;  2Y6E A;  2AIM A;  3H6S A;  3LTW A;  3O1G A;  4CZW A;  9PAP A;  1U9X A;  2FQ9 A;  1U9V A;  4BQV A;  2NQG A;  2G8J A;  4WA6 A;  4MSX A;  1CJL A;  4BS6 A;  3IUT A;  5CVO B;  4YV8 A;  3S3Q A;  1STF E;  3GCB A;  3H89 A;  2DCC A;  4YYS A;  2E00 A;  3IEJ A;  4CDF B;  1MIR A;  2GFO A;  4FIP A;  5EF4 A;  3H8C A;  1F2A A;  1ME3 A;  2YJB A;  3PDF A;  3IOQ A;  2FT2 A;  4X6H A;  2JQF R;  3N4C A;  4YYR A;  2AVW A;  4AXL A;  1AEC A;  1KHQ A;  3BPM A;  5K16 A;  1BQI A;  1TU6 A;  2DJF B;  2G8E A;  4Q8G A;  5A24 A;  1GLO A;  3BWK A;  4OEL A;  1AU2 A;  1NQC A;  4AXM A;  3HD3 A;  1EF7 A;  3BC3 A;  1KXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...