4P16A

Crystal structure of the papain-like protease of middle-east respiratory syndrome coronavirus
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
319
structure length
314
Chain Sequence
b'QLTIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF1a
publication title Crystal structure of the papain-like protease of MERS coronavirus reveals unusual, potentially druggable active-site features.
pubmed doi rcsb
source organism Human betacoronavirus 2c emc/2012
molecule tags Hydrolase
total genus 84
structure length 314
sequence length 319
ec nomenclature
pdb deposition date 2014-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4p16A02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4p16A01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4p16A03
5KO3A 4MM3B 4OVZB 4M0WA 4P16A 3MJ5A 4PT5A 4REZA 2FE8A 5E6JA 4OVZA 3E9SA 4RNAA 4R3DA 4WURA 4OW0A 4RF0A 4RF1A 3MP2A
chains in the Genus database with same CATH superfamily
3GP1A 3FTCA 1P7FA 3MJWA 3HM3A 1EU4A 2REXA 2D10A 3K92A 2QHOB 4QHTA 1WGGA 2JRHA 3RN9C 1DOIA 3Q8GA 2ZPNA 4WWOA 3T38A 1FM0D 2N7JA 2KJ6A 5ITUA 2LVNC 2WXJA 2WXOA 1DGBA 2CUZA 1E8YA 4JI5M 1WZ3A 3RNBC 4BOSC 2XU1A 4ZYSA 4MSQB 1U5IA 3AE3B 2DAFA 2JQGR 3LVVA 3KS8A 2KLGA 4QHSA 3EFUA 4WJNA 1YQ3B 2PJHA 1WY8A 3PRMA 1IXSA 1FPYA 3V61A 3ML8A 1WE7A 3W9CB 4AXLA 1V1PB 5CHVC 2EELA 1RRBA 2XLJA 3OF8A 1NHWC 3LB8C 3BPFA 1NYRA 3UK6A 2KC1A 2LD9A 3TMPA 2UWQA 2M5ZA 1PIPA 3DA1A 5CVMA 5LMUM 5DYIA 3K9PB 3CBJA 2G1EA 3A4RA 4N4ZA 1Z2MA 3VRAB 5G5GA 3PGEA 2LHDA 1YK8A 4P17A 3E56A 4BBAA 1DF0A 2DYMA 2JXNA 5FTMA 2WDQB 2P5TA 2Y5BA 2KWDA 1HT1E 3H4MA 4ZRKA 3N3GA 3DBRB 1WXSA 2WXHA 3TJPA 2CEAA 5D7GA 4X62M 1P9DU 3Q3OC 2DAKA 4XBOA 3L08A 4WWMA 1OFHA 1WJ7A 3HKPA 4BLCA 3I06A 3JR4A 4AJWA 1DOXA 1TTEA 5ITXE 1OEYA 1Z5AA 3BYTB 4D81A 3KOZE 1OFIA 4RF1A 3SATA 2RPVA 2HD5B 4G54A 2DZMA 4LJPB 1QLBB 1ET9A 1WIVA 2LJIA 2VIIA 3R9XB 2JWZA 1QYRA 3NS8A 2KDMA 1DGGA 4B7GA 1L0XB 1VZ6A 1XLQA 2KQ7A 3FYCA 1Z6TA 2WXFA 4GUAA 1POPA 1VG5A 2MBBB 3UINB 3GLGB 1RYJA 1N6ZA 4W5CA 3VDPA 1SJHD 2EKFA 4Z6YA 1KXRA 3IG5A 2GBKA 2I7NA 1J7BA 2BWBA 4ITQA 4WWPA 5FK9C 3RT3B 2J7NA 4GITA 3K1JA 1KLGD 2KN4A 3IG3A 4ZTBA 1I4GA 5KQ8A 1WE6A 4CHKA 3DBLI 2DAJA 1FCLA 3OJ4B 4URKA 1D5MC 1JWMD 2RPQA 1KOTA 1QMYA 1X9YA 5J2RA 1AN8A 4BOQA 1GMYA 2ZEQA 1ZV1A 5IO9A 4YY3M 1MX0A 3ONSA 2Q5WD 4BKSA 1PJIA 2AL3A 4YSYB 4AKGA 2WQYB 3A9KA 4II7A 2NQAA 4C4VA 1WJUA 4JI2M 4AG5A 1UZXB 1EWMA 1TS2A 1TKYA 4TV3A 3ZVVA 1QZEA 5EP4A 1HTQA 2BYFA 3B89A 3M95A 3RE8A 4PP2E 4BAXA 3HHWA 1WGHA 1DGFA 3FYDA 4AOFA 3MHSA 3DVGY 4NAMA 3IFUA 1ZUD2 3HU2A 2E01A 1C1YB 5FR3A 1L1ZA 1KLUD 4RY2A 2KYWA 2PADA 1F2CA 2FUHB 2W3SA 3TRKA 1N36M 3AB5A 4FK5A 3HU1A 1CPJA 1AYUA 3OQCA 2UXDM 1Y08A 3AE2B 3AE7B 3FUXA 1PJSA 2BB6A 5EF4A 1GB1A 3EGRA 4HEOA 2IY1B 2J7OA 1GOZA 2Z4RA 1T0RC 2LVQD 1YMHE 4KDIC 4D8BA 3AEBB 1WXVA 2K25A 4IUMB 5D3IB 3PDFA 4GEWA 1KFXL 3I3TB 1HJPA 3TEXA 4LZJA 5JHAA 3HU3A 3OAWA 2LEKA 3NZ3A 1BUIC 1UBQA 4IJFA 4KGSA 2L4FA 2QZ4A 3DQVA 1FO4A 2J7QC 3Q69A 3HHAA 5BMIA 2PLPA 2RD0A 2LVOA 2DXIA 1OTRA 2BS3B 1F2AA 2AUZA 2UXCM 1T0YA 2C5RA 3MP9A 4MZOA 4DV4M 3RCZA 3HRDD 5EE3A 2D7GA 1EM7A 3AL0C 4FN2A 1ZMWA 4BOZB 3FILA 2KFKA 2L0TA 3U61A 3FKYA 1Y8GA 2G3QA 2OO9A 4W9KA 3KDSE 5BR8M 3TSSA 4A3VB 2JRIA 1NVID 2O25A 2NTSA 3HVDA 3VRBB 2NQGA 2K9DA 1LTMA 2HHNA 4DR2M 3NS1A 2JYEA 1CJLA 3CH2X 4IBFA 4NSOB 2RDHA 2APLA 3KW6A 1D4BA 1DGHA 4DV1M 2F4VM 4YSZB 2V3NA 2FUDA 1GJSA 2MLBA 1XD3B 2AWTA 2YJ8A 4B3TM 3JSVB 3T1YM 2DZZA 1PPNA 2KQSA 4LF8M 4B3RM 1E94E 2FCSA 5JZEA 2KHHA 3NRZA 1WX7A 1NBFC 1J7KA 3H9DA 3GLIE 3KYDD 1FXIA 2NVUI 3W2DA 4PDGA 2YJ9A 2HE7A 1FCCC 1PFDA 1MHWA 1FRDA 2LTUA 2WSCF 2UUCM 4JI0M 4W9IA 2C60A 3I51A 3TWMA 1WYWB 2FCNA 2L4EA 4M9XA 4Q7JA 3B0AA 4FA6A 2N9EB 2LUEA 1FJGM 1L6VA 4DR1M 3U6QA 3PW3A 1SSNA 3LVWA 4AZFA 2ON8A 1VCBA 4WWNA 2LWXA 2VHSA 3P63A 4Z8XA 4I6LB 1XT9B 4W9HA 2DWMA 4L8RC 3WAPA 4LDTB 2DENB 1VZ7A 3FAHA 2R6NA 5HHDG 1KJTA 3GRUA 5FTNA 1WI0A 3ZGZA 1WR1A 5EE1A 2LASA 1V80A 4CYEA 3HHYA 4DV6M 1FMAD 4XK8F 2WXQA 2FH0A 3FRIA 5KPTA 1YX5B 2OZ2A 4MH0E 3J80S 2CE7A 3NVZA 1S4VA 3U5ZB 3PRZA 4GH9A 1HUCB 3KS4A 4QNMA 1WGYA 3QWZB 2G6DA 1MHHE 5C1ZA 2KDEB 4PS3A 3RGPA 1U9XA 1T3TA 2R6FA 3ZJUA 4BB9A 3HHMA 4IBGA 5HI1A 2D7EA 3ALBA 3IT6B 3BZDB 2MEKA 3F5VA 1QZMA 2CRUA 3H8BA 3GLHA 3GE3C 4P7IA 5KPZA 1WR6E 3AV8A 4RM9A 3KOWE 2LXCA 2P0RA 2M0XA 5JHBA 1GJTA 2V1CA 4JYAM 2O6VD 2PE6B 3VUYA 3SAVA 4AUQC 4JI7M 3W1SA 1GC7A 1K52A 1SXJA 1V86A 2AGAA 4GHAA 2HJ1A 3BPMA 2NBVB 1KM7A 3BINA 2DC6A 2FAZA 3KQ4A 1MU5A 4F1SA 1AYVA 2LRWA 3FE3A 3Q8EA 4MJSB 4DXAB 2AUXA 3LQRA 1XC8A 1G8PA 4XYCA 2NBWB 1WYGA 1IN5A 5FSWA 2M8SA 4BS5A 4N59A 4P6GA 2NCNA 3RPFC 1GLNA 1VLBA 3PHXB 4NAWA 4I8OA 1L2BA 2R2OA 2FIDA 3GQ3A 1WMHA 4ANRA 1YQBA 2HXZA 4JGHB 2KEBA 3IEJA 1JB0F 2H5XA 2ACTA 2F5QA 3ZQ4A 4IP3A 2L7IA 3WHLA 4YL8A 5IOIA 2LRUA 1XLOA 3R3MA 1YQ4B 4QOSA 1SIJA 3JAMS 3H7SA 2ASQA 5CHVA 1QOLA 2J0MA 3KSXA 2G4SA 4K0KM 2ZW1A 3CWIA 2ATOA 4IM3A 3KKUA 2XN9C 1E7PB 3O0UA 4PDIA 1MG4A 2C7NB 2G7YA 3JR5A 5KO3A 4MM3B 3NJTA 3P5VA 2KVRA 3L10B 1VJVA 3KW9A 4A5UA 1F77A 2F5SA 1TKGA 3NG0A 3VQIA 3PHWA 4X6HA 2DZLA 4BFRA 5GXGB 3VKHA 4BZAA 2OOBB 3OISA 1EF1A 2JPHA 1WGRA 1PUTA 4A6QA 4LF9M 1N5XA 3SHFA 4M8NA 2FYEA 2CHZA 4US9A 4WAAA 3BVZA 2DAGA 2XH9A 4LFBM 1G71A 2LXAA 2VQEM 1K82A 3CF0A 1YD8U 2KMMA 4GDKB 2V0GA 1ROEA 3KXEC 4PK1A 3W67A 5IWAM 4KVGB 1KFUL 3VXWA 4P16A 4AKIA 4R71A 4FLHA 3NWLA 1K8RB 1P1AA 2JY8A 3PTFC 4JIOU 3ZTCA 2K0PA 3IXSA 2BKFA 4ACFA 4GIVA 1D0LA 4HROA 1WM3A 1ET6A 3C9EA 2DKLA 2D3CA 2PE9A 2KRKA 3OF9A 1NJFA 1I4RA 4LJ6A 3OLMD 2K8CA 2ZAMA 3WAOA 3DWGC 3ZLZA 4LNFA 2W54A 2QBYB 4KODA 1I4WA 1JMLA 3R66C 3L54A 1ZAEA 2QJLA 4ZUXU 2K0BX 2GBRA 2K5PA 5BMHA 1DO0A 4KX6B 1HNWM 5AZHA 4A90A 2AQ1B 1FXTB 2R0IA 1JCKB 1SE4A 1VSNA 3SU8X 4FIPA 5ITXA 1PJTA 2EA0A 1SNKA 1E9MA 3RNEC 1TH4A 3CTWB 1TZ1A 4X66M 3DF0A 4IWOA 3RI7C 1YJIA 1C1KA 2ICIA 3SDLC 1UM8A 3PSEA 1V33A 5C3JB 1C4AA 2MSED 4FJCA 3Q3FA 4DXGA 4IBBA 1G6JA 3T15A 1ENFA 1HTOA 2AYOB 1Z5BA 5A2QS 2LGYA 2B3TA 1HNXM 1RM6C 1YIWA 3M63B 3S2AA 5ITRA 1V8CA 4I4LA 7PCKA 3WXGA 4E71A 3GOEA 4DBGB 1E8ZA 1WRIA 5JA7A 1S3SG 3GRYA 3KUCB 2K8BA 4D8EA 4REZA 1AU2A 1XNRM 2JVCA 3I57A 1SIFA 5IREB 3VTUA 1L2CA 1GC6A 5E6JA 3NHEB 3ZNHA 4XZ4A 3IVFA 1YVBA 3GQ4A 3B2GA 1YE9A 4KT0F 5BO4B 1PGYA 1TJEA 3TL4X 4TUUA 8CATA 4JWUC 3E4RA 1CV8A 2K1FA 3N30A 1IFYA 1I35A 4G4NA 2DWZB 1TZOA 3M99A 1O0EA 2R18A 1N63A 4XDCA 3APCA 4QNRA 1NY5A 1VEKA 2D3BA 1HQRD 2KXJA 1E7UA 1WGLA 1CK1A 4IKGA 3QJ3A 3EFCA 1QAMA 5H37D 2XEPA 3OG5A 4FJYA 3QX1A 4XE0A 3ZNZB 1ATKA 3L29A 4XUIA 2V6ZM 3U60B 4LRTA 4FXCA 1E5WA 2JXXA 1Q02A 1JRUA 3ZNID 3SMSA 4OW0A 4GXBA 1GECE 3RYTA 1PADA 2FRQA 1KYIA 3SHGB 4GC5A 2BS4B 1QDQA 2DC8A 1HR0M 1ME4A 4NQLB 1QQRA 4LLGM 3U2SC 3MFGA 3AFHA 3KFQA 1RWSA 1VQ1A 1ORYB 1SJED 1NB3A 2J7QA 1SB3C 3Q8FA 4L4UA 3GE8C 4K7SA 5DPWA 2LVPC 2O6VB 2BU3A 4WJOA 4M0WB 4AWJA 2PREA 2KQ4X 4AJYB 2JA2A 2OOAA 2R2QA 3VR9B 2D07B 2DCCA 1WM2A 3Q14C 1KFVA 3SC3A 2LZ6A 2MX2A 1ZPSA 3DWMA 3AM9A 3NZUA 3CGWA 1EWPA 3NBIA 2IGGA 2KT7A 2VF8A 1YK7A 3I63C 1EWYC 2GQFA 1FNVA 3KW5B 3WHKA 3O65A 3Q6BA 2BYTA 2LVQA 3IECA 3KLSX 3PRPA 4XZXA 1MIRA 2L7RA 1C3TA 3AE8B 1ZDVA 1GL7A 4OVZA 2K6DB 3KVFB 4EUTA 4B7HA 2HWJA 2RKOA 1G41A 3ZC7B 2WSEF 2UUBM 1PPPA 1QUSA 3M0EA 1ME3A 3ZXVA 2LHEA 2WX1A 3TWLA 1TBEA 3WALA 2E3TA 4W9EA 4CO7A 1IN4A 1XXGA 1XXHA 2UXBM 4ARIA 2D2QA 2ZVOA 1BP4A 2ZCBA 2KHWB 2DWLA 3RZWC 1MJGM 3V62A 1JROA 5L8RF 3FTEA 5IA7A 3C3EA 5T8IA 4OVVA 2WU5B 2DBYA 1K3XA 2HTME 2BS2B 3JYUA 2DHRA 3B2FA 2B1MA 2N35A 4DUZM 3U6DA 2BKRB 4HWIB 5IKCM 1AIMA 4M9SA 1KH0A 2DJFB 1ZW7A 3IHPA 3MP2A 4J3OD 3H6SA 5JI2E 2XK5A 5EJCA 2OEDA 2YR0A 3NVVA 3M62B 3GLFB 4C4VB 3DCGA 4BBNF 2OP3A 3W0LB 5FLXS 1WJ4A 4W9GA 4KZCA 2NTTA 2Z8LA 1STFE 3A1QB 1WGNA 3RNVA 3U7ZA 1GKIA 3LYYA 4OELA 4YVAA 2O2VA 2MJ3A 3PVLA 3X23A 4KIKB 3L25A 2H89B 4KSLC 3PLUA 4MGZE 3KSEA 2N9XA 2QMTA 3HWNA 2ZZPB 3PO0A 1V5TA 4F1IA 3P4RB 2WXLA 4ICVA 2GFOA 2OHFA 5C18A 2QSFX 2MJDA 3NUHB 3P5XA 3BWKA 1R7RA 2KWUB 2ZTCA 3Q8XA 4P6EA 5J18A 1EWOA 2KDFB 4KKIA 1UUPA 1Z5CA 2JZ0A 2NPTA 3J7AS 1Y4HA 2L09A 5EP2A 2BWEA 2PW9A 1Z5SB 4LDTD 3VFKA 1TL9A 1JQJC 4K3CA 3RGSA 2CV2A 4WA6A 4L23A 3QARA 5L95C 3UQBA 1E9SA 3HGIA 4YHHM 3C8YA 2KNVA 3VUWA 2M19A 4AG6A 3QYEA 2K3UA 4GKKM 2N9LA 4TQ1A 2WDTB 5F3WA 3K8UA 1GO5A 2EUCA 3ZRCA 2N7EA 4ZPXA 1JR3D 1T5XD 2JT4B 2WXIA 4GU2A 4QRXA 2J5YA 3MHHA 1HZ5A 2Y21A 1FNNA 1MN3A 1KTKA 3P5UA 3AV0A 3W0FA 3ECIA 2ZW0A 3VK7A 2RDGA 1TY2A 1V92A 4JX1C 2LVAA 2LHCA 4LNIA 2Z4SA 1TKEA 2ARYA 4HLEA 2FUG1 4A8XC 1NVMA 3TEZA 1UKFA 2WS3B 2WXMA 3DBHI 3IG8A 1C7YA 1M6DA 1JR3E 1TGUA 1L0YB 1QOBA 4QRVA 1E7VA 2DZOB 2Y0TA 1N60A 4HRSA 1A5RA 4D82A 3L17A 2DNFA 1W5SA 1G59A 3AKZA 1C77A 1N61A 1R5LA 4NJ6A 1AARA 2PEAA 3PPAA 1NYQA 1D6EC 1GAQB 3QHTA 1ZCMA 3FUUA 1L0VB 1OEYJ 1UBIA 2GOWA 3T9LA 4TQ0A 2HJ8A 1ZIVA 3SR6A 3UQAA 3AEAB 3AE4B 4IBCA 4EIWA 3K9OB 4BSQA 4E74A 2JZ3B 2VRRB 1F52A 3N3KA 4S17A 4B9KA 1GABA 3PZ7A 3F92A 4DMYA 1JQ4A 2G8LA 2HAKA 2UU9M 2VH1A 2QNJA 2XGNA 2BVCA 4MACA 4S0RA 1E32A 3LCUA 5JXVA 3KWVA 4K7UA 4NZLB 1NL6A 5JH5C 1XWIA 4RGMA 1L2NA 4W5WA 1QVRA 4K3BA 1BY8A 1QAQA 4LFAM 4LF5M 1K3WA 2ZJDA 1V97A 2JY6A 5E6OA 1IYFA 1L5PA 1XLPA 4RMAA 1WZ0A 1XLNA 2W55A 1H4RA 1JWAD 4US8A 1WRDB 2M0AA 1R2ZA 4HDOA 3D8LA 3KP0E 2XF3A 1QKZA 1GPXA 3FKEA 4GSWA 4CDFB 2N7DA 1F29A 3DVGX 2QC8A 1JWBD 4CZWA 1TF0B 5ITQA 1ZDXA 2QHOA 2VH2A 4B95A 4KHPM 1VZ8A 3L26A 4HJGE 5E6NA 2IJ0A 2XU5A 5H92C 2BW2A 3UZUA 2BGFA 3CF2A 2KDIA 2NBUA 5EGWA 4HLQA 1CJEA 2KMCA 1P3QU 1MPEA 4FD2A 4LJ9A 2JZZA 1FIQA 3V6CB 6PADA 1AYWA 3PVSA 2NS5A 2DZIA 4QRGA 2IDYA 2XEWA 4MGYE 4M02A 2E00A 1BVSA 3DBLB 1J7AA 1YJ1A 1CMXB 1GUAB 1IBKM 1IWDA 4FWHA 4FULA 3ABVB 3USVA 1V1PA 4C00A 3TL5A 2LXEA 2DC7A 2GMIC 2KD0A 4A3OA 4X6JA 1WIAA 3L4PA 4C7YA 3K24A 4ZRIA 2R46A 3PXGA 4YT0B 3MTNB 1SBBB 3FTDA 2XBBC 2BB5A 3AEEB 1QF6A 3AI8A 5FTKA 2ZAOA 2BDZA 3Q3NC 4MSMB 3K9PA 3ILKA 3L16A 1RLFA 1P3QQ 4DDGD 3BK2A 3B1LX 4DV7M 3H7PB 4KDLB 4HK2A 4OVUA 2IO1B 3W31A 1CQVA 4I6PA 3H8CA 4EZJA 4JI3M 2QQ8A 2JX5A 4LNKA 4LNOA 1KF6B 2C7HA 2GHUA 4A3PA 2JY5A 1C76A 3CH3X 3PREA 4WH4A 4G0NB 5KQDA 2N4FA 2JWSA 1Q39A 1J19A 2XSZD 4GKJM 3P5WA 3RNCC 1XCQL 2H7JA 2WXRA 3V3XA 3KYCD 3TEYA 1YSYA 2EMTA 2K22A 2Y0QA 4DQOC 5DCNA 3ZUAA 4I6NB 2MBOA 3IFWB 1TS5A 3PT2B 2A5YB 2CFOA 1OFFA 4N58A 5AUIA 4FADA 3R2IA 4NOOB 2G4DB 4LZZA 3AE5B 4KGRA 2HD5A 1MJDA 2FCMA 1V49A 2BT6A 3CSTA 3GCBA 2LGDA 4R3DA 1WJNA 1KHPA 3KH0A 3AOEA 3GRVA 3MHVC 2DAMA 2H1RA 3D8BA 2SEBD 2N1VA 4CDEB 1EIJA 4C80A 4DK5A 5JH3A 2PVOD 1T6BX 3B9JA 3GLGA 3KSJA 1NO1A 3MJ5A 4ARCA 4RCOA 2BTWB 1Q1OA 5DPTA 3TBLD 1PGBA 1OAIA 1R4MI 3S3RA 1QDTA 1V5OA 4HCPB 4X64M 2R9OA 1TIFA 3K8ZA 2AVWA 1FRRA 1IY0A 3GPXA 2NMQA 3MC0B 3ZW3A 4CQNA 3GZNI 1XEEA 5BMGA 3H7DA 2CR5A 3HHIA 1LGRA 2WBFX 2HWKA 2M17A 1FNUA 2BPSA 4DWFA 1PBHA 4CDDB 4HL4A 2HL7A 4WAFA 4DMXA 3M7GA 3RFWA 2PIAA 4GN1A 2J52A 2KC2A 3KOYE 5DNYA 1X1MA 2XU3A 2D3AA 2E02A 4D8IA 2KWCA 1NI3A 3LW5F 1GLOA 3K2LA 2YFQA 3AH7A 3C0RB 2QENA 1Q5WB 3B7QA 3A9JB 3KFUG 4LNNA 5LMNM 1EFUB 1Z59A 4DR7M 3SARA 2K8HA 4HPMB 1F1HA 1QQWA 2IBIB 1TY0A 3N20C 4IW0A 1KRHA 2DHZA 2ZTDA 2GRIA 1UGMA 4HPLB 2BF8B 2XZFA 2DYBA 4XDDA 2KFJA 1I7HA 1V6EA 2YNMD 4JV5M 3WA0A 3NVYA 3BY4B 2DLBA 4PS7A 2MROB 2AL6A 5DPSA 5E6PA 5TR5A 4YYRA 2YEPB 1WGKA 4FW9A 8PCHA 1N32M 1VRAB 4MGKE 1PGXA 1CS8A 3IAM1 2PVGC 2CHVA 4FWDA 1ZKHA 4M01A 4NRWA 3OVZA 1F2BA 3Q8CA 4OZCA 3B74A 3MTVA 1U9WA 4IUMA 2DC9A 1ICFA 1I94M 3AMZA 2HDEA 4LRSA 4TKNA 5A24A 3U6EA 1NENB 4G4QA 2KTRB 4EOYA 1YX6B 2YLMA 1IM2A 3P2BA 4BOSA 2OJRA 2GB1A 1XMOM 1FNWA 1NB5A 2D3GA 3APFA 4MGHA 4B08A 4JQWC 4DR5M 1GNUA 2KMAA 2DAIA 5E26A 4W9FA 4K1RB 2GLSA 2R65A 3BIID 4RKXA 2GBMA 5D94A 3KUDB 4G11A 4RGNA 1OQYA 2VF7A 2EKKA 2XNAC 3RD2A 4NC6A 4LJAA 3JW0X 3DPDA 3MC9A 4DV3M 1ZQ9A 1R2YA 1BXTA 1FD6A 2WYQA 2MBQA 2VZKD 3DOWA 4ASWC 3HY5A 2WP9B 2AQ3B 1SEBD 2KWVB 4O1NA 3QK0A 4ZRQA 4BKSD 1F2RI 5CHFA 1CSBB 1TDHA 2DX5B 2MWSB 3P4SB 3SASA 3U6SA 2J53A 4BKGA 3JSVA 4PYZA 3E9SA 2BJWA 3QC8B 5GKNA 1NLJA 3FUWA 4CISA 2AU1A 2C9WB 1UD7A 4A9AA 2H88B 3EIEA 2WSFF 5DFLA 2R44A 4D2KA 1E9RA 4DXFA 2KX0A 1XMQM 3B21A 2K47A 4X6IA 3VKGA 1QOGA 2QIEB 1IBXB 3GLFE 2DVWB 4FCTA 4WQMA 2JXTA 2MBEA 1AIPC 2N1WA 4LJOB 2LNHC 2KK8A 3BXWA 2FE8A 7CATA 4B0MA 4G50A 3HVZA 4GRIA 3U8ZA 4WP2A 2KRUA 1F9JA 3IMAA 2F1GA 2AIMA 5EXXA 2HH5A 2W3RA 3WAMA 2CWBA 5FTLA 2DENA 2V4IB 1U4AA 3L2AA 3VTWA 1SF0A 2AQ2B 2DZYA 2N9PC 2PMVA 4LGMA 3AJIB 1Y8RC 2MGWA 3QYBA 3V6EA 3TQSA 4GDLB 3U5ZA 1TS4A 4ANUA 1FXAA 2DZNB 2Z0DB 4AXMA 4B7FA 1XXHB 2X4AA 2BNKA 5EDSA 2MP2B 3LMMA 3SBJA 4WURA 4NXNM 2BTEA 5CHWA 2MJ5B 4IM0A 4WIPA 3WCQA 3A46A 2G5GX 3AULA 2IPPB 1PJQA 1K53A 4A55A 2R4EA 2LGIA 4XWTA 4XGIA 4IDIA 1WH3A 3RFZB 2KACA 3SEBA 4LJ7A 4F2LA 1K50A 4I07A 5FR6A 1Q0WB 4B3SM 5J94A 3A98B 3M3JA 1BGOA 3SHQA 3U4EG 2KZUA 1GG3A 4OX9M 3BOSA 3QA8A 3RULA 4L16A 1VDVA 2CJOA 1HNZM 5LXHA 5DYGA 2XZUA 2DZJA 3GS2A 2FO5A 2L05A 1R6BX 4MJSA 4NSRA 1LV7A 4DV5M 1N5WA 4K7CA 3I4VA 2O2VB 3ZJVA 3MORA 1M94A 2FFJA 1IQPA 1MI0A 4JI8M 1V9JA 3HZJA 4JXJA 3U6MA 2DWNA 4OHJA 3PRMB 1IXSB 1D5XC 3RVVA 4LFCM 3PHXA 2FS1A 2LVOC 1L2DA 4LTUA 1V34A 1HA5A 1AW7A 1YN5A 4W9LA 4IBKA 3E1ZB 2VQFM 3PHUA 1UNSA 4HXDA 2MH7A 1U9VA 3DZDA 5BYQA 3W5UB 1EWCA 2Z8YM 2R45A 1C4PA 2MJEA 3TMPB 3QCAA 3P1MA 4K81A 1YN3A 3VR8B 1YLAA 3U6PA 4QOZC 5K16A 3DOAA 1HQCA 3I4YA 2JUOA 2L00B 3AE6B 4YYSA 3ETRA 3LJ3A 1SP4B 4UDUC 4JI1M 1SE9A 4YSXB 1ZMVA 2PKOA 3PS6A 4GHLA 3VHTC 4MM3A 4I81A 5EXTA 2RGFA 2V4LA 4JI4M 2WX0A 2Y5BB 1JALA 4HKZE 3LDZE 3LQQA 4IBIA 3UIPB 2GBJA 3O1GA 2CHGA 2OOBA 1LO5D 3ZNGC 2CHXA 1HT2E 3UMMA 3ML9A 1IXZA 2FBWB 4HPPA 3AXCA 3HIZA 2PTLA 2RSUA 1MFWA 3RVXA 2B1NA 4KLNA 3LXSA 3IT4B 3GO8A 2DCBA 1WWTA 4EZKA 4YV8A 1E8WA 2AX5A 2IPKD 4GDKA 4YTNB 3KWZA 3PLVA 3H6NA 5IN7A 2QEJC 4BS6A 1VJKA 3NZSA 1S1QB 1AU3A 3J27B 1P7EA 2EJSA 3BVMA 4RF0A 2B76B 4EEWA 4NJCA 1IN7A 4W9DA 1EWLA 1NJGA 1WXAA 5EXSA 1N33M 4ITKA 3RUIB 2QP9X 2YQZA 2IO0B 5TSSA 3V05A 3FUTA 3DFZA 4MSXA 2FNAA 3BCNA 2MW5A 3SFDB 1I4HA 4YWGG 2HCBA 4Q8HA 2QBYA 3B79A 4GB9A 4AQYM 4E3CA 3R2TA 4II2B 4ZDVA 2IGHA 3GP7A 1PXVA 1TYGB 4GMVA 4J6IA 2VZKB 4DDID 2J42A 2XSZA 3GLIA 2DCAA 3IBEA 3KVWA 2VDBB 2CP8A 4M0DA 3WIMA 2L0FA 3VFDA 1DO2A 3RMKC 1L1TA 4TMAB 3A9KB 1CVZA 3L28A 4XGAB 2AHMA 3V76A 5BYRA 2Z84A 3ZYYX 2JQRB 3L27A 3W1SC 3UI3A 1WX9A 4NNJB 4MELA 4GC9A 1FFVA 2EKIA 2AYOA 1I4XA 5G2NA 3TUOA 4IJEA 2M60A 1VR9A 4CGYB 2HTHA 4NRVA 3QT4A 4DBGA 1YZBA 3DBRI 2XU4A 5CX3A 1VEGA 4HWYA 3NHEA 3ZKJC 1JWUD 3ZDTA 1BT0A 2W9NA 1MEGA 4KSKC 1D0KA 2LMCA 2CJNA 1EU3A 5DPRA 3A33B 4JPSA 2IYDB 3H1UA 1ZMUA 3BOWA 1D0MA 2KN5A 2BYEA 3PNYA 2D7HA 1RFAA 1J09A 4KKJA 1P0RA 2DZKA 3RNFC 2YJCA 3O13A 2I1KA 1MDWA 1AU0A 3LCVB 3ERVA 2M1MA 4LJ5A 1TLOA 2FTDA 9PAPA 4C7ZA 4FWGA 3U60A 3ZUNA 2Z7JA 3I01M 4S12A 5KHOA 3GPPA 1TH3A 2R9FA 1MG8A 2LJ5A 1SGHA 4DV0M 3U6CA 3BWUD 4EE2A 4H2AA 5KPRA 4YTPB 3T3OA 1OTRB 4RFBA 4I5SA 1YOVB 1ZGUB 4KV2A 3CBKA 4FCWA 1KFYB 1NEKB 2WU2B 2AYNA 4DR6M 1NSFA 4HCNB 4FJVB 3FILB 2KFKB 2ZNVC 4M9ZA 3U61B 2Q2EB 2G3QB 4MH8A 1SG9A 2C98A 1WXMA 5IZ7D 1IY1A 3UF8A 2JRIB 1KHQA 3H4JA 2O6VA 4M0WA 1IGCA 4PADA 1H6UA 3FTFA 4G4RA 3VK8A 3AE1B 4WQOB 1D3ZA 4FHKA 3AEDB 5D2MB 3AEFB 1DGHB 2I1JA 1J5EM 3RNGC 2G8EA 1N75A 2Z0EB 3QAUA 2JWUA 3P4PB 2FT2A 1UH6A 2YJ2A 2KOXA 2KNAA 1BMLC 3VUXA 1PDXA 2WNMA 4Q2JA 5JZEB 1IXRC 3TEWA 3IOQA 1W5TA 1PCIA 1DKIA 4MEMA 3BBZA 3CSFA 2PNSA 2IY0B 4ZYNA 2CU3A 1PPOA 2DNAA 1XNQM 2BBCA 3GPYA 3N1ZC 4LK0M 3DVNU 1PGAA 5D3DA 1X37A 1PJJA 2B3AA 2A4ZA 3VH4B 4UN2B 1BQIA 1C79A 2C9CA 3WXFA 2Z3XA 2O01F 2V3PA 2Y6EA 2LFIA 1K3BB 2JUJA 1V2YA 3SFEB 2ZCCA 1PE6A 1T3QA 3P42A 1QOFA 1NHGC 4RNAA 4DHJB 1QDRA 3KX1A 2TSSA 1WHCA 1DOYA 1DYQA 1TDZA 1IN6A 1WR1B 5LLIA 4Y28F 2M56B 4YYVA 1LM8B 2MCNB 5BPVA 4HDQA 2R9MA 2G45B 2OJWA 3H89A 3U6OA 2GBNA 3FD9A 5EE0A 1XHBA 4HJKA 2R9NA 2RRUA 1QILA 3RZFA 1N78A 2F5NA 1KLVA 3DBHB 2JNHA 1NDDA 2C7MB 2J0JA 4DHZB 4B6WA 2BJVA 3GLFA 1JQPA 2IGDA 1QAOA 5EP3A 3SYLA 2DI0A 3PZ8A 3VVWB 2JTCA 1YUBA 2YEPF 1UWXA 4KGTA 2JZPA 4RGOS 1WFYA 3A1QA 4PI3A 1WXQA 3NY5A 4G3OA 3HJ8A 2DWQA 3GLHB 3BB7A 3TNXA 3EC8A 2X38A 4KIKA 4L78A 1JWSD 2PPHA 2E6XA 2QDFA 3SD5A 2P7UA 2C9OA 2MA9B 3BYYB 1IBLM 4LF7M 1UFZA 3VAWA 1G4AE 1Q3CA 1SXJB 2HKJA 1T0SC 5BYSA 2WZJA 3C19A 3W68A 2L7HA 4FHJA 5IAAC 2FRAA 1ISNA 1ZXHA 3DVNV 2KANA 3KWLA 3TIXA 2DCDA 2L2DA 1L7YA 4N8WA 1TTNA 2JZ1A 1GL6A 1YN4A 3UGBB 4CIZA 3VLFB 3MK6A 2QILA 4RKUF 4USAA 1EF5A 2KNZA 2W82A 2M4NA 3T1HM 1F4IA 3ZRFA 4AP4C 2J0KA 5EP1A 4NAWB 2UZJA 4YXDB 2FOIC 1WMHB 1SE2A 4L2YA 3PNRA 4QH6A 2JF5A 3QSDA 3KP1E 4EKUA 4RM8A 3A45A 1R4GA 2YVCA 4OEMA 5F02A 4IWPA 2R9CA 4LG2A 2F5OA 4MZSA 3MHZA 2INNE 3HM6X 2DYOA 1XKGA 1VD2A 3B7NA 3F75A 3DHIC 1YT7A 3BBAA 4P1CC 2C0YA 1MEMA 3I9V1 3WXEA 4ANXA 3HJQA 4LF4M 4IBEA 4JI6M 2BYVE 4QBBA 2K9XA 2X8AA 3D32A 1TGZB 5EZSA 2KZRA 2RGHA 1NI2A 2L6OA 4JE3B 3CIRB 2K6QA 3PHWB 1XXHE 5HFYA 1MVKA 2WXKA 1OIPA 4F8CB 3HHXA 5LNK1 2ZNVB 2YJBA 1E6EB 1TT5B 1LFDA 2CHQA 3ZJTA 3N1XC 1H8CA 1PRBA 2LVPA 3ENEA 4K7WA 2I38A 1RFKA 1PM5A 1AUAA 1EE8A 4WJPA 2ZBKB 2F5PA 3Q3JA 3N4CA 4YYUA 4FJZA 2WGSA 2KTFA 4MB7A 1T6OA 4FBJB 3JVZX 3ZCBB 1VDDA 1IUEA 2BDLA 1IGDA 2CU1A 4IM2A 3K9OA 2JU6X 4ZRPA 2LGSA 4P6VF 2G8JA 1OGWA 5CHTA 1F2RC 3TCAA 4NXMM 1A6RA 4ZOHC 1A70A 5IP4D 4IBDA 3ZDMC 4AKHA 2NQIA 2MQJA 3N9YC 3CF6E 3IHPC 3OWEB 3GQ5A 2KJRA 1N77A 4RGTA 4W9CA 2C96A 4DR3M 5GMVA 4CDCB 5I4DA 1S3SA 2FIFA 5ITYA 4I04A 4BKTA 2BWFA 3M6AA 2UU7A 2WWZA 2K39A 2KNBA 4TUWA 3HX3A 2C5LC 3GB1A 3WANA 1CB5A 1I4PA 1J7CA 3V6EB 2FNJB 3QIJA 2IO3B 1I4QA 2KJHB 4LJ4A 3VDZA 4DUYM 3SAWA 4GLSC 2KW0A 3BK1A 4LCBA 2E03A 1WGDA 1ITOA 4B3MM 3QAQA 1PVJA 3IV2A 2R61A 4F7ZA 1QXPA 4IOIE 3PSEB 3SYKA 1QT9A 2L52A 2AS8A 2CS4A 3MMPA 4ANVA 3PFIA 4BOPA 3E46A 4Q8GA 3V6CA 2D5GA 2XFSA 3PZDA 2DJGB 1R4MB 2V9HA 1XB2B 3URYA 3A42A 3R8FA 3FUVA 4FCVA 1IY2A 1D2NA 1JW9D 3V60A 4JLCA 2J4XA 4L1BA 5CTRC 1IPGA 2WXGA 3I3TA 1NY6A 4GIPA 2ZANA 1PQSA 3ZNHB 3GZNB 2E5LM 2KVZA 2LHGA 2A5UA 4C56C 3DBSA 1QUTA 4N9F4 1L8QA 3ZO5B 4AI6A 3MTNA 2D11A 1M4VA 1DEUA 5HKHA 4TSSA 3L0WB 2CIOA 2JSVX 1T0QC 4PS8A 3TPZA 4LY6A 4YYWA 2JYTA 1HQYE 1MHXA 3OTOM 3H7PA 2KO3A 1D5ZC 3D6SA 3U6LA 4JL9A 4BOZA 2LI5A 1AYFA 3T3NA 1MS6A 4OZAA 1GJZA 4XC2A 1TR8A 4GGQA 5H8YE 3AI5A 4HXDB 2INCC 1EO6A 4X65M 1NNUC 5MPOA 2IZVB 4BOUA 1CTEA 4I05A 4W9JA 4WJQA 1IP9A 4JWSC 4DV2M 4KZ0A 2X49A 4XR7A 1RAXA 2ZVNA 4OU7A 1ESFA 4AW4A 1HZ6A 2KDLA 3W5VB 3PT2A 2J7QB 1A5TA 5G5HA 3ZXRA 3C3DA 2ERCA 4KO8A 2Y3AA 4ICUA 5FKAC 5C1BA 1STEA 5G55A 4ZHOA 5KHQA 1NPZA 4EFOA 4NY0A 3RVWA 3MHSD 3LFYA 1GB4A 3VDUA 2MRPA 1IN8A 3VTVA 2KDBA 3BVGA 3BC3A 1OQQA 1WX8A 2OPFA 1LXDA 1I42A 1L4DB 4P1BC 4EZLA 1OIZA 5CVOB 2C99A 1UF0A 1Q3BA 4CHTB 3CMMB 5JI3E 2OULA 3J7BA 2WDVB 4ZRJA 1HXYD 4ZHPA 3C58A 1E90A 2GNOA 3TE6A 3O65B 2BTWA 2R62A 4G4OA 1Q10A 4PCZA 1QOAA 1R4NI 5AUKA 3PRPB 1P98A 3SMPA 2L3ZA 2MR9A 3NBXX 4DR4M 1LQBA 3OJ3A 4OZBA 2O6XA 2RMMA 4N6EB 4OVZB 5IT9S 2CKHB 5C2TB 1J8CA 2ZM6M 3EA6A 2N0SB 3B9PA 3AU5A 1ACCA 2JQFR 5EZQA 3R8BA 5AZGA 3T8MA 1XF5L 5EQTA 1N62A 2Y20A 4GOCA 2CB5A 1WF9A 2QPAA 1SXTA 4LF6M 1JR3A 2JY7A 2KAJA 2BQQA 3Q2AC 3C0RA 1V81A 2FCQA 3HUIA 3A9JA 4M8MA 1ZE3D 1XCTL 2INPE 2L83A 1VEJA 4MI7A 3J9CA 2K6BA 2IO2B 1TH2A 3AE9B 1E10A 4XX5A 2UYZB 4CJ6A 3U7DA 2R4JA 2LH0A 2DOSA 3KOXE 3AU4A 3AN1A 2IBIA 3N1YC 3SFZA 3DDCB 3EIHA 3L13A 4IWQA 2NR2A 2G9HD 1ZOYB 3H8HA 4BVUC 3E21A 3GLIB 4PT5A 4KLBA 5J17A 2V1UA 1YALA 1N34M 1DGJA 3EHVA 1AWDA 1OAOC 4HVBA 2XK5B 2CV0A 2RDBC 5CVNB 1CQDA 3S3QA 3FC4A 4PP1A 3P4QB 3PNVA 2HHHM 3BY4A 1RU3A 4G3XB 4ANWA 5AZFA 1HEZE 2N9KA 3IAS1 1L4ZB 1AECA 2WDRB 2EMSA 2MH8A 1TS3A 2Y5PA 1KSFX 2WLBA 4BQVA 1UELA 3AEGB 2KZSA 3EECA 4AS1A 1R4NB 1FFUA 4IG7B 1THEA 1XO3A 3APDA 3KWBX 2KA6B 1C4CA 4R7GA 3U52E 2MHJA 4BPVA 2LUMA 2CV1A 2NQ8C 5D6JB 4NL4H 1L6UA 2WXNA 5L83A 2DAEA 3J81S 4QAYA 4YYQA 3QQ8B 1PPDA 2KTRA 4GMQA 1HE8A 2KX3A 3KUZA 1FH0A 4HKQA 2LGXA 1GVNA 4XWWA 4PYUA 2KKCA 3QWLA 3QJZA 3Q8BA 2L8JA 1NQCA 4NPNA 2NPTB 1G3IA 3A4SC 5EE9A 3NOBA 4DHJD 2CHWA 4G6ZA 4W5BA 4M00A 4II3B 4L6V6 1IBMM 1E0ZA 3B08A 2EO2A 2LWPA 2L76A 5ITTA 3GLGE 3THGA 3HD3A 4A20A 2RGOA 3EUB2 3PV1A 5LXIB 3VH3B 3RNAC 3MC8A 3SAUA 5FPWA 4MDKE 4PD2A 4WW0A 3TWKA 3W30A 1Y56A 3W1YA 3HWSA 3ZIMA 2QSDA 4X57B 2WHIA 1C9FA 1YJJA 3B7ZA 3HHZA 3DHGC 2Z59B 4IIWA 1WJ6A 2QCUA 4B0EA 3AOEC 1F0ZA 1E8XA 3LXFA 1YNTE 2L1AA 3U30A 3J2PB 3HJSA 1T43A 4NJ7A 5EXPA 1WSPA 2LBCA 1OJLA 4MT5A 2VHFA 1UGJA 4MGIE 1XQQA 1B9RA 3PBHA 2INDC 3GRRA 4DHZE 3OVXA 4LJ8A 1NNJA 1IBXA 1TU6A 5FTJA 1ZXIA 1CZPA 4FVMA 1SXJD 2X8XX 5C23A 2O5RA 2SAKA 3X0WA 3IUTA 3K9MA 2MBHA 1ZP0B 4N79A 3C9PA 1UWMA 2PBHA 3U8EA 2OQ4A 1PYWD 1J0GA 5PADA 2F7DA 1CUKA 2ONQA 3GLHE 2JP7A 3I04M 1GCBA 1VDLA 1V1OA 4D80A 4AQ7A 3FRHA 2ACZB 2WXPA 2P86A 3T6PA 1SXJE 2KLCA 1NV9A 1K51A 3HK0A 3UJNA 1JRPA 4W4UA 4IBJA 2V3SA 1FEHA 3N3KB 3GPUA 3UIOB 3NVWA 1QANA 2I2YA 4L15A 1EF7A 1R7SA 3AOGA 4YTMB 4HEA1 4GDLA 3ZTDA 2QCZA 2XFTA 4JN6A 3ZQJA 2I7PA 2L32A 3ZH9B 3AECB 3I5JC 1Q6KA 5AEKB 3DHHC 2MP2A 3R7RA 3UGJA 1OQRA 2GI9A 3Q3MC 2NQDB 2ZPYA 1EUVB 2JY6B 1NV8A 2EKEC 1SXJC 1OKSA 2V1YA 3Q8AA 4NQKE 1DV0A 2DHYA 1B1ZA 3N32A 2FQ9A 4RH6A 1SE3A 4LGYA 4IC7B 4BBNC 3R7QA 2AEHA 2RR9A 4LCDE 5HG2A 1U9QX 2KXEA 1C78A 2UUAM 2Y5CA 1AU4A 2BWES
chains in the Genus database with same CATH topology
3GP1A 3FTCA 1P7FA 1EU4A 3K92A 4QHTA 1DOIA 3T38A 1FM0D 2N7JA 5ITUA 2WXJA 2WXOA 1DGBA 2CUZA 4JI5M 4ZYSA 3AE3B 3LVVA 3KS8A 4QHSA 1YQ3B 3PRMA 3W9CB 1V1PB 2EELA 2XLJA 1NHWC 3LB8C 1NYRA 3UK6A 3TMPA 2M5ZA 3DA1A 5LMUM 5DYIA 2G1EA 3VRAB 5G5GA 2LHDA 3E56A 4BBAA 2DYMA 5FTMA 2WDQB 2P5TA 2KWDA 1HT1E 3H4MA 2WXHA 2CEAA 5D7GA 4X62M 4XBOA 4WWMA 1OFHA 3HKPA 4BLCA 3JR4A 1DOXA 5ITXE 3BYTB 1Z5AA 4D81A 3KOZE 1OFIA 4RF1A 3SATA 2RPVA 1QLBB 1ET9A 2LJIA 2VIIA 3R9XB 1QYRA 2KDMA 1DGGA 4B7GA 1L0XB 1VZ6A 1XLQA 3FYCA 1Z6TA 2WXFA 4GUAA 3GLGB 1RYJA 3VDPA 1SJHD 4Z6YA 3IG5A 2I7NA 1J7BA 5FK9C 4ITQA 2J7NA 4GITA 3K1JA 1KLGD 2KN4A 4ZTBA 1I4GA 5KQ8A 1FCLA 1D5MC 1JWMD 1AN8A 4BOQA 4YY3M 1MX0A 2Q5WD 1PJIA 4YSYB 4AKGA 2WQYB 4II7A 4JI2M 4AG5A 1TS2A 1TKYA 5EP4A 3RE8A 3HHWA 1DGFA 3FYDA 4NAMA 3IFUA 1ZUD2 3HU2A 5FR3A 1L1ZA 1KLUD 3TRKA 2W3SA 1N36M 3AB5A 3HU1A 3OQCA 2UXDM 3AE2B 3AE7B 3FUXA 2BB6A 1GB1A 3EGRA 2J7OA 1GOZA 2Z4RA 1YMHE 4D8BA 3AEBB 5D3IB 3TEXA 4LZJA 3HU3A 2LEKA 3NZ3A 1BUIC 4IJFA 4KGSA 2QZ4A 1FO4A 2J7QC 3Q69A 5BMIA 2PLPA 2DXIA 2BS3B 2UXCM 2C5RA 3MP9A 4DV4M 3HRDD 5EE3A 2D7GA 1EM7A 3AL0C 3FILA 3U61A 3KDSE 5BR8M 3TSSA 4A3VB 2JRIA 1NVID 3HVDA 2NTSA 3VRBB 4DR2M 3NS1A 2JYEA 4IBFA 4NSOB 2RDHA 1D4BA 3KW6A 1DGHA 4DV1M 2F4VM 4YSZB 2V3NA 4B3TM 3T1YM 4LF8M 4B3RM 1E94E 5JZEA 3NRZA 1J7KA 1FXIA 3W2DA 4PDGA 1FCCC 1PFDA 1FRDA 2UUCM 4JI0M 3I51A 3TWMA 4M9XA 1FJGM 1L6VA 4DR1M 3U6QA 1SSNA 3LVWA 4AZFA 2ON8A 2LWXA 3P63A 4Z8XA 2DWMA 4L8RC 1VZ7A 3FAHA 5HHDG 3GRUA 5FTNA 3ZGZA 5EE1A 3HHYA 4DV6M 1FMAD 2WXQA 5KPTA 4MH0E 3J80S 2CE7A 3NVZA 3U5ZB 4GH9A 3KS4A 4QNMA 1MHHE 3RGPA 1T3TA 3ZJUA 4BB9A 4IBGA 5HI1A 2D7EA 3IT6B 3BZDB 2MEKA 1QZMA 3GLHA 5KPZA 3AV8A 3KOWE 4JYAM 2V1CA 3SAVA 4JI7M 3W1SA 2AGAA 1K52A 1SXJA 4GHAA 3KQ4A 1MU5A 3Q8EA 3LQRA 1XC8A 1G8PA 1WYGA 1IN5A 5FSWA 4N59A 3RPFC 1GLNA 1VLBA 4I8OA 1L2BA 3GQ3A 2KEBA 2F5QA 3ZQ4A 4IP3A 2L7IA 3WHLA 1XLOA 1YQ4B 4QOSA 1SIJA 3JAMS 3KSXA 3CWIA 4K0KM 2ZW1A 2XN9C 1E7PB 4PDIA 3JR5A 5KO3A 4MM3B 4A5UA 1F77A 2F5SA 1TKGA 3PHWA 3VQIA 5GXGB 3VKHA 1PUTA 4A6QA 4LF9M 1N5XA 3SHFA 4US9A 3BVZA 2XH9A 4LFBM 2VQEM 1K82A 3CF0A 2KMMA 4GDKB 2V0GA 1ROEA 3KXEC 5IWAM 4P16A 4AKIA 3NWLA 2K0PA 3IXSA 4HROA 1ET6A 2KRKA 1NJFA 1I4RA 4LJ6A 2ZAMA 3DWGC 2W54A 2QBYB 4KODA 1I4WA 1JMLA 1ZAEA 2QJLA 2K5PA 5BMHA 1DO0A 4KX6B 1HNWM 4A90A 2AQ1B 1SE4A 1JCKB 5ITXA 2EA0A 1E9MA 1TH4A 3CTWB 4X66M 1YJIA 1C1KA 2ICIA 1UM8A 3PSEA 5C3JB 1C4AA 4DXGA 4IBBA 3T15A 1ENFA 1Z5BA 5A2QS 1HNXM 1RM6C 5ITRA 1V8CA 4I4LA 1WRIA 3GRYA 4D8EA 4REZA 1XNRM 3I57A 5IREB 1L2CA 3ZNHA 5E6JA 3GQ4A 3B2GA 1YE9A 1TJEA 3TL4X 8CATA 4JWUC 3E4RA 4G4NA 2DWZB 1TZOA 2R18A 1N63A 4XDCA 4QNRA 1NY5A 1HQRD 1CK1A 4IKGA 1QAMA 5H37D 2XEPA 4XE0A 3L29A 2V6ZM 3U60B 4LRTA 4FXCA 3SMSA 4OW0A 1KYIA 3SHGB 4GC5A 2BS4B 1HR0M 1QQRA 4LLGM 3U2SC 3MFGA 3AFHA 1RWSA 1ORYB 1SJED 2J7QA 1SB3C 3Q8FA 4L4UA 2BU3A 2KQ4X 2JA2A 3VR9B 1KFVA 3SC3A 1ZPSA 3DWMA 3AM9A 3NBIA 2IGGA 1EWYC 1FNVA 3WHKA 3O65A 2BYTA 3KLSX 3PRPA 4XZXA 3AE8B 1ZDVA 1GL7A 4OVZA 4B7HA 2RKOA 1G41A 3ZC7B 2UUBM 3M0EA 2LHEA 3TWLA 2E3TA 1IN4A 1XXGA 1XXHA 2UXBM 4ARIA 2DWLA 1JROA 3FTEA 5T8IA 2WU5B 2DBYA 1K3XA 2HTME 2BS2B 2DHRA 3B2FA 4DUZM 3U6DA 4M9SA 1KH0A 3MP2A 4J3OD 5JI2E 5EJCA 2OEDA 2YR0A 3NVVA 3GLFB 3W0LB 5FLXS 2NTTA 2Z8LA 3RNVA 3U7ZA 1GKIA 3LYYA 2MJ3A 3L25A 2H89B 4MGZE 2QMTA 3PO0A 3P4RB 2WXLA 2OHFA 5C18A 2MJDA 3NUHB 1R7RA 3Q8XA 4KKIA 1UUPA 1Z5CA 3J7AS 2L09A 5EP2A 2PW9A 1JQJC 3RGSA 2CV2A 4L23A 1E9SA 3HGIA 4YHHM 3C8YA 2M19A 4AG6A 2K3UA 4GKKM 2N9LA 4TQ1A 5F3WA 2EUCA 4ZPXA 1JR3D 1T5XD 2WXIA 1HZ5A 2Y21A 1FNNA 1KTKA 3AV0A 3W0FA 2ZW0A 3VK7A 2RDGA 1TY2A 4JX1C 2Z4SA 1TKEA 2FUG1 4A8XC 1NVMA 3TEZA 1UKFA 2WS3B 2WXMA 3IG8A 1TGUA 1L0YB 1QOBA 2DZOB 2Y0TA 1N60A 4HRSA 4D82A 1W5SA 1G59A 3AKZA 1C77A 1N61A 1NYQA 1D6EC 1GAQB 3FUUA 1L0VB 4TQ0A 3SR6A 3AEAB 3AE4B 4IBCA 4EIWA 3PZ7A 1JQ4A 2G8LA 2UU9M 2XGNA 4MACA 1E32A 5JXVA 3KWVA 4NZLB 1XWIA 4RGMA 4W5WA 1QVRA 1QAQA 4LFAM 4LF5M 1K3WA 1V97A 1L5PA 1XLPA 1XLNA 2W55A 1JWAD 4US8A 2M0AA 1R2ZA 3D8LA 3KP0E 2XF3A 1QKZA 1GPXA 3FKEA 1JWBD 5ITQA 1ZDXA 4KHPM 1VZ8A 3L26A 4HJGE 2IJ0A 5H92C 2BW2A 3UZUA 3CF2A 4HLQA 1CJEA 1MPEA 4FD2A 4LJ9A 1FIQA 3PVSA 2IDYA 4MGYE 1J7AA 1IBKM 4FWHA 3ABVB 1V1PA 2LXEA 3L4PA 4C7YA 2R46A 3PXGA 4YT0B 1SBBB 3FTDA 2BB5A 3AEEB 1QF6A 5FTKA 2ZAOA 3ILKA 3BK2A 4DV7M 3W31A 1CQVA 4JI3M 2JX5A 1KF6B 1C76A 4WH4A 5KQDA 1Q39A 2XSZD 4GKJM 1XCQL 2WXRA 3V3XA 3TEYA 1YSYA 2K22A 2Y0QA 4DQOC 4N58A 5AUIA 1TS5A 2A5YB 2CFOA 1OFFA 3R2IA 4NOOB 4LZZA 3AE5B 4KGRA 2BT6A 4R3DA 3AOEA 3GRVA 3MHVC 2H1RA 3D8BA 2SEBD 4C80A 2PVOD 1T6BX 3B9JA 3GLGA 3KSJA 3MJ5A 4ARCA 4RCOA 2BTWB 1PGBA 4X64M 3K8ZA 1FRRA 1IY0A 3GPXA 2NMQA 3MC0B 4CQNA 1XEEA 5BMGA 2HWKA 1FNUA 4HL4A 2HL7A 4WAFA 3M7GA 3RFWA 2PIAA 2J52A 3KOYE 5DNYA 4D8IA 1NI3A 3K2LA 2YFQA 3AH7A 2QENA 3KFUG 5LMNM 1Z59A 4DR7M 3SARA 1QQWA 1TY0A 1KRHA 2GRIA 2XZFA 4XDDA 1I7HA 2YNMD 4JV5M 3NVYA 2DLBA 2YEPB 1WGKA 4FW9A 1N32M 1VRAB 4MGKE 1PGXA 3IAM1 2PVGC 2CHVA 4FWDA 4NRWA 3Q8CA 4OZCA 3MTVA 4IUMA 1I94M 3AMZA 2HDEA 4LRSA 3U6EA 1NENB 4G4QA 1IM2A 4BOSA 2GB1A 1XMOM 1FNWA 4MGHA 4B08A 4DR5M 5E26A 2R65A 3BIID 4RKXA 4RGNA 2XNAC 4LJAA 4DV3M 1ZQ9A 1R2YA 1BXTA 1FD6A 2VZKD 2WP9B 2AQ3B 1SEBD 4O1NA 4ZRQA 1F2RI 1TDHA 3P4SB 3SASA 3U6SA 2J53A 3E9SA 2BJWA 5GKNA 3FUWA 4CISA 4A9AA 2H88B 3EIEA 4D2KA 1E9RA 4DXFA 1XMQM 3B21A 2K47A 3VKGA 1QOGA 2QIEB 1IBXB 2DVWB 4FCTA 4WQMA 2JXTA 2LNHC 2FE8A 7CATA 4B0MA 3HVZA 4GRIA 2KRUA 5EXXA 2W3RA 5FTLA 2V4IB 3L2AA 1SF0A 2AQ2B 2PMVA 4LGMA 3AJIB 3TQSA 4GDLB 3U5ZA 1TS4A 1FXAA 2DZNB 4B7FA 1XXHB 2X4AA 2BNKA 3LMMA 3SBJA 4WURA 4NXNM 2BTEA 4WIPA 3WCQA 3A46A 2G5GX 1K53A 4A55A 2R4EA 2LGIA 4XWTA 4XGIA 4IDIA 3RFZB 2KACA 3SEBA 4LJ7A 1K50A 4B3SM 3A98B 3U4EG 2KZUA 4OX9M 3BOSA 4L16A 1VDVA 2CJOA 1HNZM 5DYGA 2XZUA 3GS2A 1R6BX 4NSRA 1LV7A 4DV5M 1N5WA 3I4VA 3ZJVA 2FFJA 1IQPA 1MI0A 4JI8M 4JXJA 3U6MA 2DWNA 4OHJA 1IXSB 1D5XC 4LFCM 3PHXA 1L2DA 4LTUA 1HA5A 1AW7A 1YN5A 4IBKA 2VQFM 3PHUA 1UNSA 2MH7A 3DZDA 5BYQA 3W5UB 1EWCA 2R45A 1C4PA 2MJEA 3P1MA 1YN3A 3VR8B 3U6PA 4QOZC 3DOAA 1HQCA 3I4YA 3AE6B 3ETRA 4UDUC 4JI1M 4YSXB 2PKOA 4GHLA 4I81A 5EXTA 4JI4M 1JALA 4HKZE 3LQQA 4IBIA 2CHGA 1LO5D 1HT2E 3UMMA 1IXZA 2FBWB 2PTLA 4KLNA 3IT4B 3GO8A 1WWTA 2AX5A 2IPKD 4YTNB 2QEJC 1VJKA 3J27B 1P7EA 3BVMA 4RF0A 2B76B 4NJCA 1IN7A 1NJGA 5EXSA 1N33M 4ITKA 2QP9X 2YQZA 5TSSA 3V05A 3FUTA 3DFZA 2FNAA 3SFDB 1I4HA 4YWGG 2HCBA 2QBYA 4AQYM 3R2TA 2IGHA 3GP7A 1TYGB 2VZKB 2J42A 2XSZA 3GLIA 3KVWA 4M0DA 3VFDA 1DO2A 1L1TA 4TMAB 3L28A 2AHMA 5BYRA 2Z84A 3ZYYX 2JQRB 3L27A 3UI3A 4GC9A 1FFVA 2EKIA 1I4XA 3TUOA 4IJEA 2M60A 1VR9A 4CGYB 4NRVA 1YZBA 1JWUD 2LMCA 2CJNA 1EU3A 4JPSA 3PNYA 2D7HA 1J09A 4KKJA 3O13A 4LJ5A 4C7ZA 4FWGA 3U60A 2Z7JA 4S12A 3GPPA 1TH3A 4DV0M 3U6CA 3BWUD 4EE2A 4H2AA 5KPRA 4YTPB 3T3OA 4RFBA 4I5SA 4FCWA 1KFYB 1NEKB 2WU2B 4DR6M 1NSFA 3FILB 4M9ZA 3U61B 2Q2EB 4MH8A 2C98A 5IZ7D 1IY1A 4M0WA 1IGCA 1H6UA 3FTFA 4G4RA 3VK8A 3AE1B 3AEDB 3AEFB 1DGHB 1J5EM 1N75A 3QAUA 2JWUA 3P4PB 1BMLC 1PDXA 2WNMA 4Q2JA 1IXRC 3TEWA 1W5TA 1DKIA 2CU3A 1XNQM 2BBCA 3GPYA 4LK0M 1PGAA 5D3DA 1X37A 1PJJA 1C79A 2C9CA 2Z3XA 2V3PA 2LFIA 3SFEB 1T3QA 3P42A 1QOFA 1NHGC 4RNAA 2TSSA 1DOYA 1DYQA 1TDZA 1IN6A 2M56B 5BPVA 3U6OA 3FD9A 5EE0A 1XHBA 1QILA 1N78A 2F5NA 2BJVA 3GLFA 2IGDA 1QAOA 5EP3A 3SYLA 3PZ8A 2JTCA 1YUBA 2YEPF 1UWXA 4KGTA 2JZPA 4RGOS 1WXQA 3HJ8A 2DWQA 3GLHB 3BB7A 2X38A 4L78A 1JWSD 2E6XA 2C9OA 3BYYB 1IBLM 4LF7M 1G4AE 1Q3CA 1SXJB 2HKJA 5BYSA 2L7HA 1ZXHA 3KWLA 1GL6A 1YN4A 3VLFB 3MK6A 2QILA 4USAA 2W82A 3T1HM 5EP1A 4NAWB 2UZJA 4YXDB 2FOIC 1SE2A 4L2YA 3KP1E 3A45A 4LG2A 2F5OA 3MHZA 2INNE 2DYOA 3BBAA 3I9V1 3HJQA 4LF4M 4IBEA 4JI6M 2K9XA 2X8AA 5EZSA 2RGHA 2L6OA 4JE3B 3CIRB 5HFYA 1MVKA 2WXKA 3HHXA 5LNK1 1E6EB 2CHQA 3ZJTA 2I38A 1RFKA 1PM5A 1EE8A 2ZBKB 2F5PA 4MB7A 3ZCBB 1VDDA 1IUEA 1IGDA 2JU6X 4ZRPA 4P6VF 1F2RC 4NXMM 4ZOHC 1A70A 4IBDA 4AKHA 3N9YC 3CF6E 3OWEB 3GQ5A 1N77A 4RGTA 2C96A 4DR3M 5I4DA 1S3SA 5ITYA 3M6AA 4TUWA 3GB1A 1I4PA 1J7CA 1I4QA 4LJ4A 4DUYM 3SAWA 4GLSC 2KW0A 3BK1A 4LCBA 4B3MM 1PVJA 2R61A 4IOIE 3SYKA 1QT9A 2L52A 3PFIA 4BOPA 2D5GA 2XFSA 3URYA 3A42A 3R8FA 3FUVA 4FCVA 1IY2A 1D2NA 1JW9D 2J4XA 4L1BA 2WXGA 1NY6A 4GIPA 2ZANA 2E5LM 4C56C 1L8QA 4AI6A 1M4VA 4TSSA 2JSVX 3TPZA 4LY6A 2JYTA 1HQYE 1MHXA 3OTOM 1D5ZC 3U6LA 4BOZA 1AYFA 3T3NA 4OZAA 5H8YE 4HXDB 4X65M 1NNUC 5MPOA 4BOUA 4JWSC 4DV2M 2X49A 4OU7A 1ESFA 4AW4A 1HZ6A 3W5VB 3PT2A 5G5HA 2ERCA 4KO8A 2Y3AA 5FKAC 4ZHOA 5C1BA 1STEA 1GB4A 3VDUA 1IN8A 3BVGA 1OQQA 2OPFA 1L4DB 2C99A 1Q3BA 4CHTB 5JI3E 3J7BA 2WDVB 1HXYD 4ZHPA 3C58A 3TE6A 2BTWA 2R62A 4G4OA 1Q10A 4PCZA 1QOAA 5AUKA 3SMPA 4DR4M 4OZBA 2RMMA 4N6EB 4OVZB 5IT9S 5C2TB 2ZM6M 3EA6A 2N0SB 3B9PA 1ACCA 5EZQA 3R8BA 1XF5L 5EQTA 1N62A 2Y20A 2QPAA 1SXTA 4LF6M 1JR3A 2KAJA 3C0RA 3HUIA 1ZE3D 1XCTL 2INPE 2L83A 4MI7A 3J9CA 1TH2A 3AE9B 1E10A 2DOSA 2R4JA 2LH0A 3KOXE 3AN1A 3SFZA 3EIHA 2G9HD 1ZOYB 3H8HA 3GLIB 4PT5A 2V1UA 1N34M 1DGJA 1AWDA 2CV0A 3FC4A 3P4QB 3PNVA 2HHHM 3BY4A 1HEZE 2N9KA 3IAS1 1L4ZB 2WDRB 1TS3A 2Y5PA 1KSFX 2WLBA 3AEGB 2KZSA 4AS1A 1FFUA 1XO3A 2KA6B 1C4CA 4R7GA 3U52E 2LUMA 2CV1A 2NQ8C 4NL4H 1L6UA 2WXNA 3J81S 4GMQA 4HKQA 1GVNA 4XWWA 3QWLA 3Q8BA 1G3IA 5EE9A 4G6ZA 1IBMM 1E0ZA 2EO2A 5ITTA 3THGA 2RGOA 3EUB2 3SAUA 4PD2A 4WW0A 3TWKA 3W30A 1Y56A 3HWSA 2QSDA 1C9FA 1YJJA 3HHZA 4IIWA 2QCUA 4B0EA 3AOEC 1F0ZA 3LXFA 1YNTE 2L1AA 3J2PB 3HJSA 5EXPA 1WSPA 1OJLA 4MT5A 1UGJA 4MGIE 1B9RA 3GRRA 4LJ8A 1NNJA 1IBXA 5FTJA 1ZXIA 1CZPA 4FVMA 1SXJD 2O5RA 2SAKA 1ZP0B 1UWMA 2OQ4A 1PYWD 2ONQA 1V1OA 4D80A 4AQ7A 2ACZB 2WXPA 1SXJE 1K51A 3UJNA 1JRPA 4IBJA 1FEHA 3GPUA 3NVWA 1QANA 2I2YA 4L15A 1R7SA 3AOGA 4YTMB 4HEA1 2XFTA 4JN6A 2L32A 2I7PA 3ZH9B 3AECB 3UGJA 1OQRA 2GI9A 1SXJC 3Q8AA 1B1ZA 4RH6A 1SE3A 4LGYA 5HG2A 2KXEA 1C78A 2UUAM 2Y5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KO3 A;  4MM3 B;  4OVZ B;  4M0W A;  4P16 A;  3MJ5 A;  4PT5 A;  4REZ A;  2FE8 A;  5E6J A;  4OVZ A;  3E9S A;  4RNA A;  4R3D A;  4WUR A;  4OW0 A;  4RF0 A;  4RF1 A;  3MP2 A; 
#chains in the Genus database with same CATH topology
 3GP1 A;  3FTC A;  1P7F A;  3MJW A;  3HM3 A;  1EU4 A;  2REX A;  2D10 A;  3K92 A;  2QHO B;  4QHT A;  1WGG A;  2JRH A;  3RN9 C;  1DOI A;  3Q8G A;  2ZPN A;  4WWO A;  3T38 A;  1FM0 D;  2N7J A;  2KJ6 A;  5ITU A;  2LVN C;  2WXJ A;  2WXO A;  1DGB A;  2CUZ A;  1E8Y A;  4JI5 M;  1WZ3 A;  3RNB C;  4BOS C;  2XU1 A;  4ZYS A;  4MSQ B;  1U5I A;  3AE3 B;  2DAF A;  2JQG R;  3LVV A;  3KS8 A;  2KLG A;  4QHS A;  3EFU A;  4WJN A;  1YQ3 B;  2PJH A;  1WY8 A;  3PRM A;  1IXS A;  1FPY A;  3V61 A;  3ML8 A;  1WE7 A;  3W9C B;  4AXL A;  1V1P B;  5CHV C;  2EEL A;  1RRB A;  2XLJ A;  3OF8 A;  1NHW C;  3LB8 C;  3BPF A;  1NYR A;  3UK6 A;  2KC1 A;  2LD9 A;  3TMP A;  2UWQ A;  2M5Z A;  1PIP A;  3DA1 A;  5CVM A;  5LMU M;  5DYI A;  3K9P B;  3CBJ A;  2G1E A;  3A4R A;  4N4Z A;  1Z2M A;  3VRA B;  5G5G A;  3PGE A;  2LHD A;  1YK8 A;  4P17 A;  3E56 A;  4BBA A;  1DF0 A;  2DYM A;  2JXN A;  5FTM A;  2WDQ B;  2P5T A;  2Y5B A;  2KWD A;  1HT1 E;  3H4M A;  4ZRK A;  3N3G A;  3DBR B;  1WXS A;  2WXH A;  3TJP A;  2CEA A;  5D7G A;  4X62 M;  1P9D U;  3Q3O C;  2DAK A;  4XBO A;  3L08 A;  4WWM A;  1OFH A;  1WJ7 A;  3HKP A;  4BLC A;  3I06 A;  3JR4 A;  4AJW A;  1DOX A;  1TTE A;  5ITX E;  1OEY A;  1Z5A A;  3BYT B;  4D81 A;  3KOZ E;  1OFI A;  4RF1 A;  3SAT A;  2RPV A;  2HD5 B;  4G54 A;  2DZM A;  4LJP B;  1QLB B;  1ET9 A;  1WIV A;  2LJI A;  2VII A;  3R9X B;  2JWZ A;  1QYR A;  3NS8 A;  2KDM A;  1DGG A;  4B7G A;  1L0X B;  1VZ6 A;  1XLQ A;  2KQ7 A;  3FYC A;  1Z6T A;  2WXF A;  4GUA A;  1POP A;  1VG5 A;  2MBB B;  3UIN B;  3GLG B;  1RYJ A;  1N6Z A;  4W5C A;  3VDP A;  1SJH D;  2EKF A;  4Z6Y A;  1KXR A;  3IG5 A;  2GBK A;  2I7N A;  1J7B A;  2BWB A;  4ITQ A;  4WWP A;  5FK9 C;  3RT3 B;  2J7N A;  4GIT A;  3K1J A;  1KLG D;  2KN4 A;  3IG3 A;  4ZTB A;  1I4G A;  5KQ8 A;  1WE6 A;  4CHK A;  3DBL I;  2DAJ A;  1FCL A;  3OJ4 B;  4URK A;  1D5M C;  1JWM D;  2RPQ A;  1KOT A;  1QMY A;  1X9Y A;  5J2R A;  1AN8 A;  4BOQ A;  1GMY A;  2ZEQ A;  1ZV1 A;  5IO9 A;  4YY3 M;  1MX0 A;  3ONS A;  2Q5W D;  4BKS A;  1PJI A;  2AL3 A;  4YSY B;  4AKG A;  2WQY B;  3A9K A;  4II7 A;  2NQA A;  4C4V A;  1WJU A;  4JI2 M;  4AG5 A;  1UZX B;  1EWM A;  1TS2 A;  1TKY A;  4TV3 A;  3ZVV A;  1QZE A;  5EP4 A;  1HTQ A;  2BYF A;  3B89 A;  3M95 A;  3RE8 A;  4PP2 E;  4BAX A;  3HHW A;  1WGH A;  1DGF A;  3FYD A;  4AOF A;  3MHS A;  3DVG Y;  4NAM A;  3IFU A;  1ZUD 2;  3HU2 A;  2E01 A;  1C1Y B;  5FR3 A;  1L1Z A;  1KLU D;  4RY2 A;  2KYW A;  2PAD A;  1F2C A;  2FUH B;  2W3S A;  3TRK A;  1N36 M;  3AB5 A;  4FK5 A;  3HU1 A;  1CPJ A;  1AYU A;  3OQC A;  2UXD M;  1Y08 A;  3AE2 B;  3AE7 B;  3FUX A;  1PJS A;  2BB6 A;  5EF4 A;  1GB1 A;  3EGR A;  4HEO A;  2IY1 B;  2J7O A;  1GOZ A;  2Z4R A;  1T0R C;  2LVQ D;  1YMH E;  4KDI C;  4D8B A;  3AEB B;  1WXV A;  2K25 A;  4IUM B;  5D3I B;  3PDF A;  4GEW A;  1KFX L;  3I3T B;  1HJP A;  3TEX A;  4LZJ A;  5JHA A;  3HU3 A;  3OAW A;  2LEK A;  3NZ3 A;  1BUI C;  1UBQ A;  4IJF A;  4KGS A;  2L4F A;  2QZ4 A;  3DQV A;  1FO4 A;  2J7Q C;  3Q69 A;  3HHA A;  5BMI A;  2PLP A;  2RD0 A;  2LVO A;  2DXI A;  1OTR A;  2BS3 B;  1F2A A;  2AUZ A;  2UXC M;  1T0Y A;  2C5R A;  3MP9 A;  4MZO A;  4DV4 M;  3RCZ A;  3HRD D;  5EE3 A;  2D7G A;  1EM7 A;  3AL0 C;  4FN2 A;  1ZMW A;  4BOZ B;  3FIL A;  2KFK A;  2L0T A;  3U61 A;  3FKY A;  1Y8G A;  2G3Q A;  2OO9 A;  4W9K A;  3KDS E;  5BR8 M;  3TSS A;  4A3V B;  2JRI A;  1NVI D;  2O25 A;  2NTS A;  3HVD A;  3VRB B;  2NQG A;  2K9D A;  1LTM A;  2HHN A;  4DR2 M;  3NS1 A;  2JYE A;  1CJL A;  3CH2 X;  4IBF A;  4NSO B;  2RDH A;  2APL A;  3KW6 A;  1D4B A;  1DGH A;  4DV1 M;  2F4V M;  4YSZ B;  2V3N A;  2FUD A;  1GJS A;  2MLB A;  1XD3 B;  2AWT A;  2YJ8 A;  4B3T M;  3JSV B;  3T1Y M;  2DZZ A;  1PPN A;  2KQS A;  4LF8 M;  4B3R M;  1E94 E;  2FCS A;  5JZE A;  2KHH A;  3NRZ A;  1WX7 A;  1NBF C;  1J7K A;  3H9D A;  3GLI E;  3KYD D;  1FXI A;  2NVU I;  3W2D A;  4PDG A;  2YJ9 A;  2HE7 A;  1FCC C;  1PFD A;  1MHW A;  1FRD A;  2LTU A;  2WSC F;  2UUC M;  4JI0 M;  4W9I A;  2C60 A;  3I51 A;  3TWM A;  1WYW B;  2FCN A;  2L4E A;  4M9X A;  4Q7J A;  3B0A A;  4FA6 A;  2N9E B;  2LUE A;  1FJG M;  1L6V A;  4DR1 M;  3U6Q A;  3PW3 A;  1SSN A;  3LVW A;  4AZF A;  2ON8 A;  1VCB A;  4WWN A;  2LWX A;  2VHS A;  3P63 A;  4Z8X A;  4I6L B;  1XT9 B;  4W9H A;  2DWM A;  4L8R C;  3WAP A;  4LDT B;  2DEN B;  1VZ7 A;  3FAH A;  2R6N A;  5HHD G;  1KJT A;  3GRU A;  5FTN A;  1WI0 A;  3ZGZ A;  1WR1 A;  5EE1 A;  2LAS A;  1V80 A;  4CYE A;  3HHY A;  4DV6 M;  1FMA D;  4XK8 F;  2WXQ A;  2FH0 A;  3FRI A;  5KPT A;  1YX5 B;  2OZ2 A;  4MH0 E;  3J80 S;  2CE7 A;  3NVZ A;  1S4V A;  3U5Z B;  3PRZ A;  4GH9 A;  1HUC B;  3KS4 A;  4QNM A;  1WGY A;  3QWZ B;  2G6D A;  1MHH E;  5C1Z A;  2KDE B;  4PS3 A;  3RGP A;  1U9X A;  1T3T A;  2R6F A;  3ZJU A;  4BB9 A;  3HHM A;  4IBG A;  5HI1 A;  2D7E A;  3ALB A;  3IT6 B;  3BZD B;  2MEK A;  3F5V A;  1QZM A;  2CRU A;  3H8B A;  3GLH A;  3GE3 C;  4P7I A;  5KPZ A;  1WR6 E;  3AV8 A;  4RM9 A;  3KOW E;  2LXC A;  2P0R A;  2M0X A;  5JHB A;  1GJT A;  2V1C A;  4JYA M;  2O6V D;  2PE6 B;  3VUY A;  3SAV A;  4AUQ C;  4JI7 M;  3W1S A;  1GC7 A;  1K52 A;  1SXJ A;  1V86 A;  2AGA A;  4GHA A;  2HJ1 A;  3BPM A;  2NBV B;  1KM7 A;  3BIN A;  2DC6 A;  2FAZ A;  3KQ4 A;  1MU5 A;  4F1S A;  1AYV A;  2LRW A;  3FE3 A;  3Q8E A;  4MJS B;  4DXA B;  2AUX A;  3LQR A;  1XC8 A;  1G8P A;  4XYC A;  2NBW B;  1WYG A;  1IN5 A;  5FSW A;  2M8S A;  4BS5 A;  4N59 A;  4P6G A;  2NCN A;  3RPF C;  1GLN A;  1VLB A;  3PHX B;  4NAW A;  4I8O A;  1L2B A;  2R2O A;  2FID A;  3GQ3 A;  1WMH A;  4ANR A;  1YQB A;  2HXZ A;  4JGH B;  2KEB A;  3IEJ A;  1JB0 F;  2H5X A;  2ACT A;  2F5Q A;  3ZQ4 A;  4IP3 A;  2L7I A;  3WHL A;  4YL8 A;  5IOI A;  2LRU A;  1XLO A;  3R3M A;  1YQ4 B;  4QOS A;  1SIJ A;  3JAM S;  3H7S A;  2ASQ A;  5CHV A;  1QOL A;  2J0M A;  3KSX A;  2G4S A;  4K0K M;  2ZW1 A;  3CWI A;  2ATO A;  4IM3 A;  3KKU A;  2XN9 C;  1E7P B;  3O0U A;  4PDI A;  1MG4 A;  2C7N B;  2G7Y A;  3JR5 A;  5KO3 A;  4MM3 B;  3NJT A;  3P5V A;  2KVR A;  3L10 B;  1VJV A;  3KW9 A;  4A5U A;  1F77 A;  2F5S A;  1TKG A;  3NG0 A;  3VQI A;  3PHW A;  4X6H A;  2DZL A;  4BFR A;  5GXG B;  3VKH A;  4BZA A;  2OOB B;  3OIS A;  1EF1 A;  2JPH A;  1WGR A;  1PUT A;  4A6Q A;  4LF9 M;  1N5X A;  3SHF A;  4M8N A;  2FYE A;  2CHZ A;  4US9 A;  4WAA A;  3BVZ A;  2DAG A;  2XH9 A;  4LFB M;  1G71 A;  2LXA A;  2VQE M;  1K82 A;  3CF0 A;  1YD8 U;  2KMM A;  4GDK B;  2V0G A;  1ROE A;  3KXE C;  4PK1 A;  3W67 A;  5IWA M;  4KVG B;  1KFU L;  3VXW A;  4P16 A;  4AKI A;  4R71 A;  4FLH A;  3NWL A;  1K8R B;  1P1A A;  2JY8 A;  3PTF C;  4JIO U;  3ZTC A;  2K0P A;  3IXS A;  2BKF A;  4ACF A;  4GIV A;  1D0L A;  4HRO A;  1WM3 A;  1ET6 A;  3C9E A;  2DKL A;  2D3C A;  2PE9 A;  2KRK A;  3OF9 A;  1NJF A;  1I4R A;  4LJ6 A;  3OLM D;  2K8C A;  2ZAM A;  3WAO A;  3DWG C;  3ZLZ A;  4LNF A;  2W54 A;  2QBY B;  4KOD A;  1I4W A;  1JML A;  3R66 C;  3L54 A;  1ZAE A;  2QJL A;  4ZUX U;  2K0B X;  2GBR A;  2K5P A;  5BMH A;  1DO0 A;  4KX6 B;  1HNW M;  5AZH A;  4A90 A;  2AQ1 B;  1FXT B;  2R0I A;  1JCK B;  1SE4 A;  1VSN A;  3SU8 X;  4FIP A;  5ITX A;  1PJT A;  2EA0 A;  1SNK A;  1E9M A;  3RNE C;  1TH4 A;  3CTW B;  1TZ1 A;  4X66 M;  3DF0 A;  4IWO A;  3RI7 C;  1YJI A;  1C1K A;  2ICI A;  3SDL C;  1UM8 A;  3PSE A;  1V33 A;  5C3J B;  1C4A A;  2MSE D;  4FJC A;  3Q3F A;  4DXG A;  4IBB A;  1G6J A;  3T15 A;  1ENF A;  1HTO A;  2AYO B;  1Z5B A;  5A2Q S;  2LGY A;  2B3T A;  1HNX M;  1RM6 C;  1YIW A;  3M63 B;  3S2A A;  5ITR A;  1V8C A;  4I4L A;  7PCK A;  3WXG A;  4E71 A;  3GOE A;  4DBG B;  1E8Z A;  1WRI A;  5JA7 A;  1S3S G;  3GRY A;  3KUC B;  2K8B A;  4D8E A;  4REZ A;  1AU2 A;  1XNR M;  2JVC A;  3I57 A;  1SIF A;  5IRE B;  3VTU A;  1L2C A;  1GC6 A;  5E6J A;  3NHE B;  3ZNH A;  4XZ4 A;  3IVF A;  1YVB A;  3GQ4 A;  3B2G A;  1YE9 A;  4KT0 F;  5BO4 B;  1PGY A;  1TJE A;  3TL4 X;  4TUU A;  8CAT A;  4JWU C;  3E4R A;  1CV8 A;  2K1F A;  3N30 A;  1IFY A;  1I35 A;  4G4N A;  2DWZ B;  1TZO A;  3M99 A;  1O0E A;  2R18 A;  1N63 A;  4XDC A;  3APC A;  4QNR A;  1NY5 A;  1VEK A;  2D3B A;  1HQR D;  2KXJ A;  1E7U A;  1WGL A;  1CK1 A;  4IKG A;  3QJ3 A;  3EFC A;  1QAM A;  5H37 D;  2XEP A;  3OG5 A;  4FJY A;  3QX1 A;  4XE0 A;  3ZNZ B;  1ATK A;  3L29 A;  4XUI A;  2V6Z M;  3U60 B;  4LRT A;  4FXC A;  1E5W A;  2JXX A;  1Q02 A;  1JRU A;  3ZNI D;  3SMS A;  4OW0 A;  4GXB A;  1GEC E;  3RYT A;  1PAD A;  2FRQ A;  1KYI A;  3SHG B;  4GC5 A;  2BS4 B;  1QDQ A;  2DC8 A;  1HR0 M;  1ME4 A;  4NQL B;  1QQR A;  4LLG M;  3U2S C;  3MFG A;  3AFH A;  3KFQ A;  1RWS A;  1VQ1 A;  1ORY B;  1SJE D;  1NB3 A;  2J7Q A;  1SB3 C;  3Q8F A;  4L4U A;  3GE8 C;  4K7S A;  5DPW A;  2LVP C;  2O6V B;  2BU3 A;  4WJO A;  4M0W B;  4AWJ A;  2PRE A;  2KQ4 X;  4AJY B;  2JA2 A;  2OOA A;  2R2Q A;  3VR9 B;  2D07 B;  2DCC A;  1WM2 A;  3Q14 C;  1KFV A;  3SC3 A;  2LZ6 A;  2MX2 A;  1ZPS A;  3DWM A;  3AM9 A;  3NZU A;  3CGW A;  1EWP A;  3NBI A;  2IGG A;  2KT7 A;  2VF8 A;  1YK7 A;  3I63 C;  1EWY C;  2GQF A;  1FNV A;  3KW5 B;  3WHK A;  3O65 A;  3Q6B A;  2BYT A;  2LVQ A;  3IEC A;  3KLS X;  3PRP A;  4XZX A;  1MIR A;  2L7R A;  1C3T A;  3AE8 B;  1ZDV A;  1GL7 A;  4OVZ A;  2K6D B;  3KVF B;  4EUT A;  4B7H A;  2HWJ A;  2RKO A;  1G41 A;  3ZC7 B;  2WSE F;  2UUB M;  1PPP A;  1QUS A;  3M0E A;  1ME3 A;  3ZXV A;  2LHE A;  2WX1 A;  3TWL A;  1TBE A;  3WAL A;  2E3T A;  4W9E A;  4CO7 A;  1IN4 A;  1XXG A;  1XXH A;  2UXB M;  4ARI A;  2D2Q A;  2ZVO A;  1BP4 A;  2ZCB A;  2KHW B;  2DWL A;  3RZW C;  1MJG M;  3V62 A;  1JRO A;  5L8R F;  3FTE A;  5IA7 A;  3C3E A;  5T8I A;  4OVV A;  2WU5 B;  2DBY A;  1K3X A;  2HTM E;  2BS2 B;  3JYU A;  2DHR A;  3B2F A;  2B1M A;  2N35 A;  4DUZ M;  3U6D A;  2BKR B;  4HWI B;  5IKC M;  1AIM A;  4M9S A;  1KH0 A;  2DJF B;  1ZW7 A;  3IHP A;  3MP2 A;  4J3O D;  3H6S A;  5JI2 E;  2XK5 A;  5EJC A;  2OED A;  2YR0 A;  3NVV A;  3M62 B;  3GLF B;  4C4V B;  3DCG A;  4BBN F;  2OP3 A;  3W0L B;  5FLX S;  1WJ4 A;  4W9G A;  4KZC A;  2NTT A;  2Z8L A;  1STF E;  3A1Q B;  1WGN A;  3RNV A;  3U7Z A;  1GKI A;  3LYY A;  4OEL A;  4YVA A;  2O2V A;  2MJ3 A;  3PVL A;  3X23 A;  4KIK B;  3L25 A;  2H89 B;  4KSL C;  3PLU A;  4MGZ E;  3KSE A;  2N9X A;  2QMT A;  3HWN A;  2ZZP B;  3PO0 A;  1V5T A;  4F1I A;  3P4R B;  2WXL A;  4ICV A;  2GFO A;  2OHF A;  5C18 A;  2QSF X;  2MJD A;  3NUH B;  3P5X A;  3BWK A;  1R7R A;  2KWU B;  2ZTC A;  3Q8X A;  4P6E A;  5J18 A;  1EWO A;  2KDF B;  4KKI A;  1UUP A;  1Z5C A;  2JZ0 A;  2NPT A;  3J7A S;  1Y4H A;  2L09 A;  5EP2 A;  2BWE A;  2PW9 A;  1Z5S B;  4LDT D;  3VFK A;  1TL9 A;  1JQJ C;  4K3C A;  3RGS A;  2CV2 A;  4WA6 A;  4L23 A;  3QAR A;  5L95 C;  3UQB A;  1E9S A;  3HGI A;  4YHH M;  3C8Y A;  2KNV A;  3VUW A;  2M19 A;  4AG6 A;  3QYE A;  2K3U A;  4GKK M;  2N9L A;  4TQ1 A;  2WDT B;  5F3W A;  3K8U A;  1GO5 A;  2EUC A;  3ZRC A;  2N7E A;  4ZPX A;  1JR3 D;  1T5X D;  2JT4 B;  2WXI A;  4GU2 A;  4QRX A;  2J5Y A;  3MHH A;  1HZ5 A;  2Y21 A;  1FNN A;  1MN3 A;  1KTK A;  3P5U A;  3AV0 A;  3W0F A;  3ECI A;  2ZW0 A;  3VK7 A;  2RDG A;  1TY2 A;  1V92 A;  4JX1 C;  2LVA A;  2LHC A;  4LNI A;  2Z4S A;  1TKE A;  2ARY A;  4HLE A;  2FUG 1;  4A8X C;  1NVM A;  3TEZ A;  1UKF A;  2WS3 B;  2WXM A;  3DBH I;  3IG8 A;  1C7Y A;  1M6D A;  1JR3 E;  1TGU A;  1L0Y B;  1QOB A;  4QRV A;  1E7V A;  2DZO B;  2Y0T A;  1N60 A;  4HRS A;  1A5R A;  4D82 A;  3L17 A;  2DNF A;  1W5S A;  1G59 A;  3AKZ A;  1C77 A;  1N61 A;  1R5L A;  4NJ6 A;  1AAR A;  2PEA A;  3PPA A;  1NYQ A;  1D6E C;  1GAQ B;  3QHT A;  1ZCM A;  3FUU A;  1L0V B;  1OEY J;  1UBI A;  2GOW A;  3T9L A;  4TQ0 A;  2HJ8 A;  1ZIV A;  3SR6 A;  3UQA A;  3AEA B;  3AE4 B;  4IBC A;  4EIW A;  3K9O B;  4BSQ A;  4E74 A;  2JZ3 B;  2VRR B;  1F52 A;  3N3K A;  4S17 A;  4B9K A;  1GAB A;  3PZ7 A;  3F92 A;  4DMY A;  1JQ4 A;  2G8L A;  2HAK A;  2UU9 M;  2VH1 A;  2QNJ A;  2XGN A;  2BVC A;  4MAC A;  4S0R A;  1E32 A;  3LCU A;  5JXV A;  3KWV A;  4K7U A;  4NZL B;  1NL6 A;  5JH5 C;  1XWI A;  4RGM A;  1L2N A;  4W5W A;  1QVR A;  4K3B A;  1BY8 A;  1QAQ A;  4LFA M;  4LF5 M;  1K3W A;  2ZJD A;  1V97 A;  2JY6 A;  5E6O A;  1IYF A;  1L5P A;  1XLP A;  4RMA A;  1WZ0 A;  1XLN A;  2W55 A;  1H4R A;  1JWA D;  4US8 A;  1WRD B;  2M0A A;  1R2Z A;  4HDO A;  3D8L A;  3KP0 E;  2XF3 A;  1QKZ A;  1GPX A;  3FKE A;  4GSW A;  4CDF B;  2N7D A;  1F29 A;  3DVG X;  2QC8 A;  1JWB D;  4CZW A;  1TF0 B;  5ITQ A;  1ZDX A;  2QHO A;  2VH2 A;  4B95 A;  4KHP M;  1VZ8 A;  3L26 A;  4HJG E;  5E6N A;  2IJ0 A;  2XU5 A;  5H92 C;  2BW2 A;  3UZU A;  2BGF A;  3CF2 A;  2KDI A;  2NBU A;  5EGW A;  4HLQ A;  1CJE A;  2KMC A;  1P3Q U;  1MPE A;  4FD2 A;  4LJ9 A;  2JZZ A;  1FIQ A;  3V6C B;  6PAD A;  1AYW A;  3PVS A;  2NS5 A;  2DZI A;  4QRG A;  2IDY A;  2XEW A;  4MGY E;  4M02 A;  2E00 A;  1BVS A;  3DBL B;  1J7A A;  1YJ1 A;  1CMX B;  1GUA B;  1IBK M;  1IWD A;  4FWH A;  4FUL A;  3ABV B;  3USV A;  1V1P A;  4C00 A;  3TL5 A;  2LXE A;  2DC7 A;  2GMI C;  2KD0 A;  4A3O A;  4X6J A;  1WIA A;  3L4P A;  4C7Y A;  3K24 A;  4ZRI A;  2R46 A;  3PXG A;  4YT0 B;  3MTN B;  1SBB B;  3FTD A;  2XBB C;  2BB5 A;  3AEE B;  1QF6 A;  3AI8 A;  5FTK A;  2ZAO A;  2BDZ A;  3Q3N C;  4MSM B;  3K9P A;  3ILK A;  3L16 A;  1RLF A;  1P3Q Q;  4DDG D;  3BK2 A;  3B1L X;  4DV7 M;  3H7P B;  4KDL B;  4HK2 A;  4OVU A;  2IO1 B;  3W31 A;  1CQV A;  4I6P A;  3H8C A;  4EZJ A;  4JI3 M;  2QQ8 A;  2JX5 A;  4LNK A;  4LNO A;  1KF6 B;  2C7H A;  2GHU A;  4A3P A;  2JY5 A;  1C76 A;  3CH3 X;  3PRE A;  4WH4 A;  4G0N B;  5KQD A;  2N4F A;  2JWS A;  1Q39 A;  1J19 A;  2XSZ D;  4GKJ M;  3P5W A;  3RNC C;  1XCQ L;  2H7J A;  2WXR A;  3V3X A;  3KYC D;  3TEY A;  1YSY A;  2EMT A;  2K22 A;  2Y0Q A;  4DQO C;  5DCN A;  3ZUA A;  4I6N B;  2MBO A;  3IFW B;  1TS5 A;  3PT2 B;  2A5Y B;  2CFO A;  1OFF A;  4N58 A;  5AUI A;  4FAD A;  3R2I A;  4NOO B;  2G4D B;  4LZZ A;  3AE5 B;  4KGR A;  2HD5 A;  1MJD A;  2FCM A;  1V49 A;  2BT6 A;  3CST A;  3GCB A;  2LGD A;  4R3D A;  1WJN A;  1KHP A;  3KH0 A;  3AOE A;  3GRV A;  3MHV C;  2DAM A;  2H1R A;  3D8B A;  2SEB D;  2N1V A;  4CDE B;  1EIJ A;  4C80 A;  4DK5 A;  5JH3 A;  2PVO D;  1T6B X;  3B9J A;  3GLG A;  3KSJ A;  1NO1 A;  3MJ5 A;  4ARC A;  4RCO A;  2BTW B;  1Q1O A;  5DPT A;  3TBL D;  1PGB A;  1OAI A;  1R4M I;  3S3R A;  1QDT A;  1V5O A;  4HCP B;  4X64 M;  2R9O A;  1TIF A;  3K8Z A;  2AVW A;  1FRR A;  1IY0 A;  3GPX A;  2NMQ A;  3MC0 B;  3ZW3 A;  4CQN A;  3GZN I;  1XEE A;  5BMG A;  3H7D A;  2CR5 A;  3HHI A;  1LGR A;  2WBF X;  2HWK A;  2M17 A;  1FNU A;  2BPS A;  4DWF A;  1PBH A;  4CDD B;  4HL4 A;  2HL7 A;  4WAF A;  4DMX A;  3M7G A;  3RFW A;  2PIA A;  4GN1 A;  2J52 A;  2KC2 A;  3KOY E;  5DNY A;  1X1M A;  2XU3 A;  2D3A A;  2E02 A;  4D8I A;  2KWC A;  1NI3 A;  3LW5 F;  1GLO A;  3K2L A;  2YFQ A;  3AH7 A;  3C0R B;  2QEN A;  1Q5W B;  3B7Q A;  3A9J B;  3KFU G;  4LNN A;  5LMN M;  1EFU B;  1Z59 A;  4DR7 M;  3SAR A;  2K8H A;  4HPM B;  1F1H A;  1QQW A;  2IBI B;  1TY0 A;  3N20 C;  4IW0 A;  1KRH A;  2DHZ A;  2ZTD A;  2GRI A;  1UGM A;  4HPL B;  2BF8 B;  2XZF A;  2DYB A;  4XDD A;  2KFJ A;  1I7H A;  1V6E A;  2YNM D;  4JV5 M;  3WA0 A;  3NVY A;  3BY4 B;  2DLB A;  4PS7 A;  2MRO B;  2AL6 A;  5DPS A;  5E6P A;  5TR5 A;  4YYR A;  2YEP B;  1WGK A;  4FW9 A;  8PCH A;  1N32 M;  1VRA B;  4MGK E;  1PGX A;  1CS8 A;  3IAM 1;  2PVG C;  2CHV A;  4FWD A;  1ZKH A;  4M01 A;  4NRW A;  3OVZ A;  1F2B A;  3Q8C A;  4OZC A;  3B74 A;  3MTV A;  1U9W A;  4IUM A;  2DC9 A;  1ICF A;  1I94 M;  3AMZ A;  2HDE A;  4LRS A;  4TKN A;  5A24 A;  3U6E A;  1NEN B;  4G4Q A;  2KTR B;  4EOY A;  1YX6 B;  2YLM A;  1IM2 A;  3P2B A;  4BOS A;  2OJR A;  2GB1 A;  1XMO M;  1FNW A;  1NB5 A;  2D3G A;  3APF A;  4MGH A;  4B08 A;  4JQW C;  4DR5 M;  1GNU A;  2KMA A;  2DAI A;  5E26 A;  4W9F A;  4K1R B;  2GLS A;  2R65 A;  3BII D;  4RKX A;  2GBM A;  5D94 A;  3KUD B;  4G11 A;  4RGN A;  1OQY A;  2VF7 A;  2EKK A;  2XNA C;  3RD2 A;  4NC6 A;  4LJA A;  3JW0 X;  3DPD A;  3MC9 A;  4DV3 M;  1ZQ9 A;  1R2Y A;  1BXT A;  1FD6 A;  2WYQ A;  2MBQ A;  2VZK D;  3DOW A;  4ASW C;  3HY5 A;  2WP9 B;  2AQ3 B;  1SEB D;  2KWV B;  4O1N A;  3QK0 A;  4ZRQ A;  4BKS D;  1F2R I;  5CHF A;  1CSB B;  1TDH A;  2DX5 B;  2MWS B;  3P4S B;  3SAS A;  3U6S A;  2J53 A;  4BKG A;  3JSV A;  4PYZ A;  3E9S A;  2BJW A;  3QC8 B;  5GKN A;  1NLJ A;  3FUW A;  4CIS A;  2AU1 A;  2C9W B;  1UD7 A;  4A9A A;  2H88 B;  3EIE A;  2WSF F;  5DFL A;  2R44 A;  4D2K A;  1E9R A;  4DXF A;  2KX0 A;  1XMQ M;  3B21 A;  2K47 A;  4X6I A;  3VKG A;  1QOG A;  2QIE B;  1IBX B;  3GLF E;  2DVW B;  4FCT A;  4WQM A;  2JXT A;  2MBE A;  1AIP C;  2N1W A;  4LJO B;  2LNH C;  2KK8 A;  3BXW A;  2FE8 A;  7CAT A;  4B0M A;  4G50 A;  3HVZ A;  4GRI A;  3U8Z A;  4WP2 A;  2KRU A;  1F9J A;  3IMA A;  2F1G A;  2AIM A;  5EXX A;  2HH5 A;  2W3R A;  3WAM A;  2CWB A;  5FTL A;  2DEN A;  2V4I B;  1U4A A;  3L2A A;  3VTW A;  1SF0 A;  2AQ2 B;  2DZY A;  2N9P C;  2PMV A;  4LGM A;  3AJI B;  1Y8R C;  2MGW A;  3QYB A;  3V6E A;  3TQS A;  4GDL B;  3U5Z A;  1TS4 A;  4ANU A;  1FXA A;  2DZN B;  2Z0D B;  4AXM A;  4B7F A;  1XXH B;  2X4A A;  2BNK A;  5EDS A;  2MP2 B;  3LMM A;  3SBJ A;  4WUR A;  4NXN M;  2BTE A;  5CHW A;  2MJ5 B;  4IM0 A;  4WIP A;  3WCQ A;  3A46 A;  2G5G X;  3AUL A;  2IPP B;  1PJQ A;  1K53 A;  4A55 A;  2R4E A;  2LGI A;  4XWT A;  4XGI A;  4IDI A;  1WH3 A;  3RFZ B;  2KAC A;  3SEB A;  4LJ7 A;  4F2L A;  1K50 A;  4I07 A;  5FR6 A;  1Q0W B;  4B3S M;  5J94 A;  3A98 B;  3M3J A;  1BGO A;  3SHQ A;  3U4E G;  2KZU A;  1GG3 A;  4OX9 M;  3BOS A;  3QA8 A;  3RUL A;  4L16 A;  1VDV A;  2CJO A;  1HNZ M;  5LXH A;  5DYG A;  2XZU A;  2DZJ A;  3GS2 A;  2FO5 A;  2L05 A;  1R6B X;  4MJS A;  4NSR A;  1LV7 A;  4DV5 M;  1N5W A;  4K7C A;  3I4V A;  2O2V B;  3ZJV A;  3MOR A;  1M94 A;  2FFJ A;  1IQP A;  1MI0 A;  4JI8 M;  1V9J A;  3HZJ A;  4JXJ A;  3U6M A;  2DWN A;  4OHJ A;  3PRM B;  1IXS B;  1D5X C;  3RVV A;  4LFC M;  3PHX A;  2FS1 A;  2LVO C;  1L2D A;  4LTU A;  1V34 A;  1HA5 A;  1AW7 A;  1YN5 A;  4W9L A;  4IBK A;  3E1Z B;  2VQF M;  3PHU A;  1UNS A;  4HXD A;  2MH7 A;  1U9V A;  3DZD A;  5BYQ A;  3W5U B;  1EWC A;  2Z8Y M;  2R45 A;  1C4P A;  2MJE A;  3TMP B;  3QCA A;  3P1M A;  4K81 A;  1YN3 A;  3VR8 B;  1YLA A;  3U6P A;  4QOZ C;  5K16 A;  3DOA A;  1HQC A;  3I4Y A;  2JUO A;  2L00 B;  3AE6 B;  4YYS A;  3ETR A;  3LJ3 A;  1SP4 B;  4UDU C;  4JI1 M;  1SE9 A;  4YSX B;  1ZMV A;  2PKO A;  3PS6 A;  4GHL A;  3VHT C;  4MM3 A;  4I81 A;  5EXT A;  2RGF A;  2V4L A;  4JI4 M;  2WX0 A;  2Y5B B;  1JAL A;  4HKZ E;  3LDZ E;  3LQQ A;  4IBI A;  3UIP B;  2GBJ A;  3O1G A;  2CHG A;  2OOB A;  1LO5 D;  3ZNG C;  2CHX A;  1HT2 E;  3UMM A;  3ML9 A;  1IXZ A;  2FBW B;  4HPP A;  3AXC A;  3HIZ A;  2PTL A;  2RSU A;  1MFW A;  3RVX A;  2B1N A;  4KLN A;  3LXS A;  3IT4 B;  3GO8 A;  2DCB A;  1WWT A;  4EZK A;  4YV8 A;  1E8W A;  2AX5 A;  2IPK D;  4GDK A;  4YTN B;  3KWZ A;  3PLV A;  3H6N A;  5IN7 A;  2QEJ C;  4BS6 A;  1VJK A;  3NZS A;  1S1Q B;  1AU3 A;  3J27 B;  1P7E A;  2EJS A;  3BVM A;  4RF0 A;  2B76 B;  4EEW A;  4NJC A;  1IN7 A;  4W9D A;  1EWL A;  1NJG A;  1WXA A;  5EXS A;  1N33 M;  4ITK A;  3RUI B;  2QP9 X;  2YQZ A;  2IO0 B;  5TSS A;  3V05 A;  3FUT A;  3DFZ A;  4MSX A;  2FNA A;  3BCN A;  2MW5 A;  3SFD B;  1I4H A;  4YWG G;  2HCB A;  4Q8H A;  2QBY A;  3B79 A;  4GB9 A;  4AQY M;  4E3C A;  3R2T A;  4II2 B;  4ZDV A;  2IGH A;  3GP7 A;  1PXV A;  1TYG B;  4GMV A;  4J6I A;  2VZK B;  4DDI D;  2J42 A;  2XSZ A;  3GLI A;  2DCA A;  3IBE A;  3KVW A;  2VDB B;  2CP8 A;  4M0D A;  3WIM A;  2L0F A;  3VFD A;  1DO2 A;  3RMK C;  1L1T A;  4TMA B;  3A9K B;  1CVZ A;  3L28 A;  4XGA B;  2AHM A;  3V76 A;  5BYR A;  2Z84 A;  3ZYY X;  2JQR B;  3L27 A;  3W1S C;  3UI3 A;  1WX9 A;  4NNJ B;  4MEL A;  4GC9 A;  1FFV A;  2EKI A;  2AYO A;  1I4X A;  5G2N A;  3TUO A;  4IJE A;  2M60 A;  1VR9 A;  4CGY B;  2HTH A;  4NRV A;  3QT4 A;  4DBG A;  1YZB A;  3DBR I;  2XU4 A;  5CX3 A;  1VEG A;  4HWY A;  3NHE A;  3ZKJ C;  1JWU D;  3ZDT A;  1BT0 A;  2W9N A;  1MEG A;  4KSK C;  1D0K A;  2LMC A;  2CJN A;  1EU3 A;  5DPR A;  3A33 B;  4JPS A;  2IYD B;  3H1U A;  1ZMU A;  3BOW A;  1D0M A;  2KN5 A;  2BYE A;  3PNY A;  2D7H A;  1RFA A;  1J09 A;  4KKJ A;  1P0R A;  2DZK A;  3RNF C;  2YJC A;  3O13 A;  2I1K A;  1MDW A;  1AU0 A;  3LCV B;  3ERV A;  2M1M A;  4LJ5 A;  1TLO A;  2FTD A;  9PAP A;  4C7Z A;  4FWG A;  3U60 A;  3ZUN A;  2Z7J A;  3I01 M;  4S12 A;  5KHO A;  3GPP A;  1TH3 A;  2R9F A;  1MG8 A;  2LJ5 A;  1SGH A;  4DV0 M;  3U6C A;  3BWU D;  4EE2 A;  4H2A A;  5KPR A;  4YTP B;  3T3O A;  1OTR B;  4RFB A;  4I5S A;  1YOV B;  1ZGU B;  4KV2 A;  3CBK A;  4FCW A;  1KFY B;  1NEK B;  2WU2 B;  2AYN A;  4DR6 M;  1NSF A;  4HCN B;  4FJV B;  3FIL B;  2KFK B;  2ZNV C;  4M9Z A;  3U61 B;  2Q2E B;  2G3Q B;  4MH8 A;  1SG9 A;  2C98 A;  1WXM A;  5IZ7 D;  1IY1 A;  3UF8 A;  2JRI B;  1KHQ A;  3H4J A;  2O6V A;  4M0W A;  1IGC A;  4PAD A;  1H6U A;  3FTF A;  4G4R A;  3VK8 A;  3AE1 B;  4WQO B;  1D3Z A;  4FHK A;  3AED B;  5D2M B;  3AEF B;  1DGH B;  2I1J A;  1J5E M;  3RNG C;  2G8E A;  1N75 A;  2Z0E B;  3QAU A;  2JWU A;  3P4P B;  2FT2 A;  1UH6 A;  2YJ2 A;  2KOX A;  2KNA A;  1BML C;  3VUX A;  1PDX A;  2WNM A;  4Q2J A;  5JZE B;  1IXR C;  3TEW A;  3IOQ A;  1W5T A;  1PCI A;  1DKI A;  4MEM A;  3BBZ A;  3CSF A;  2PNS A;  2IY0 B;  4ZYN A;  2CU3 A;  1PPO A;  2DNA A;  1XNQ M;  2BBC A;  3GPY A;  3N1Z C;  4LK0 M;  3DVN U;  1PGA A;  5D3D A;  1X37 A;  1PJJ A;  2B3A A;  2A4Z A;  3VH4 B;  4UN2 B;  1BQI A;  1C79 A;  2C9C A;  3WXF A;  2Z3X A;  2O01 F;  2V3P A;  2Y6E A;  2LFI A;  1K3B B;  2JUJ A;  1V2Y A;  3SFE B;  2ZCC A;  1PE6 A;  1T3Q A;  3P42 A;  1QOF A;  1NHG C;  4RNA A;  4DHJ B;  1QDR A;  3KX1 A;  2TSS A;  1WHC A;  1DOY A;  1DYQ A;  1TDZ A;  1IN6 A;  1WR1 B;  5LLI A;  4Y28 F;  2M56 B;  4YYV A;  1LM8 B;  2MCN B;  5BPV A;  4HDQ A;  2R9M A;  2G45 B;  2OJW A;  3H89 A;  3U6O A;  2GBN A;  3FD9 A;  5EE0 A;  1XHB A;  4HJK A;  2R9N A;  2RRU A;  1QIL A;  3RZF A;  1N78 A;  2F5N A;  1KLV A;  3DBH B;  2JNH A;  1NDD A;  2C7M B;  2J0J A;  4DHZ B;  4B6W A;  2BJV A;  3GLF A;  1JQP A;  2IGD A;  1QAO A;  5EP3 A;  3SYL A;  2DI0 A;  3PZ8 A;  3VVW B;  2JTC A;  1YUB A;  2YEP F;  1UWX A;  4KGT A;  2JZP A;  4RGO S;  1WFY A;  3A1Q A;  4PI3 A;  1WXQ A;  3NY5 A;  4G3O A;  3HJ8 A;  2DWQ A;  3GLH B;  3BB7 A;  3TNX A;  3EC8 A;  2X38 A;  4KIK A;  4L78 A;  1JWS D;  2PPH A;  2E6X A;  2QDF A;  3SD5 A;  2P7U A;  2C9O A;  2MA9 B;  3BYY B;  1IBL M;  4LF7 M;  1UFZ A;  3VAW A;  1G4A E;  1Q3C A;  1SXJ B;  2HKJ A;  1T0S C;  5BYS A;  2WZJ A;  3C19 A;  3W68 A;  2L7H A;  4FHJ A;  5IAA C;  2FRA A;  1ISN A;  1ZXH A;  3DVN V;  2KAN A;  3KWL A;  3TIX A;  2DCD A;  2L2D A;  1L7Y A;  4N8W A;  1TTN A;  2JZ1 A;  1GL6 A;  1YN4 A;  3UGB B;  4CIZ A;  3VLF B;  3MK6 A;  2QIL A;  4RKU F;  4USA A;  1EF5 A;  2KNZ A;  2W82 A;  2M4N A;  3T1H M;  1F4I A;  3ZRF A;  4AP4 C;  2J0K A;  5EP1 A;  4NAW B;  2UZJ A;  4YXD B;  2FOI C;  1WMH B;  1SE2 A;  4L2Y A;  3PNR A;  4QH6 A;  2JF5 A;  3QSD A;  3KP1 E;  4EKU A;  4RM8 A;  3A45 A;  1R4G A;  2YVC A;  4OEM A;  5F02 A;  4IWP A;  2R9C A;  4LG2 A;  2F5O A;  4MZS A;  3MHZ A;  2INN E;  3HM6 X;  2DYO A;  1XKG A;  1VD2 A;  3B7N A;  3F75 A;  3DHI C;  1YT7 A;  3BBA A;  4P1C C;  2C0Y A;  1MEM A;  3I9V 1;  3WXE A;  4ANX A;  3HJQ A;  4LF4 M;  4IBE A;  4JI6 M;  2BYV E;  4QBB A;  2K9X A;  2X8A A;  3D32 A;  1TGZ B;  5EZS A;  2KZR A;  2RGH A;  1NI2 A;  2L6O A;  4JE3 B;  3CIR B;  2K6Q A;  3PHW B;  1XXH E;  5HFY A;  1MVK A;  2WXK A;  1OIP A;  4F8C B;  3HHX A;  5LNK 1;  2ZNV B;  2YJB A;  1E6E B;  1TT5 B;  1LFD A;  2CHQ A;  3ZJT A;  3N1X C;  1H8C A;  1PRB A;  2LVP A;  3ENE A;  4K7W A;  2I38 A;  1RFK A;  1PM5 A;  1AUA A;  1EE8 A;  4WJP A;  2ZBK B;  2F5P A;  3Q3J A;  3N4C A;  4YYU A;  4FJZ A;  2WGS A;  2KTF A;  4MB7 A;  1T6O A;  4FBJ B;  3JVZ X;  3ZCB B;  1VDD A;  1IUE A;  2BDL A;  1IGD A;  2CU1 A;  4IM2 A;  3K9O A;  2JU6 X;  4ZRP A;  2LGS A;  4P6V F;  2G8J A;  1OGW A;  5CHT A;  1F2R C;  3TCA A;  4NXM M;  1A6R A;  4ZOH C;  1A70 A;  5IP4 D;  4IBD A;  3ZDM C;  4AKH A;  2NQI A;  2MQJ A;  3N9Y C;  3CF6 E;  3IHP C;  3OWE B;  3GQ5 A;  2KJR A;  1N77 A;  4RGT A;  4W9C A;  2C96 A;  4DR3 M;  5GMV A;  4CDC B;  5I4D A;  1S3S A;  2FIF A;  5ITY A;  4I04 A;  4BKT A;  2BWF A;  3M6A A;  2UU7 A;  2WWZ A;  2K39 A;  2KNB A;  4TUW A;  3HX3 A;  2C5L C;  3GB1 A;  3WAN A;  1CB5 A;  1I4P A;  1J7C A;  3V6E B;  2FNJ B;  3QIJ A;  2IO3 B;  1I4Q A;  2KJH B;  4LJ4 A;  3VDZ A;  4DUY M;  3SAW A;  4GLS C;  2KW0 A;  3BK1 A;  4LCB A;  2E03 A;  1WGD A;  1ITO A;  4B3M M;  3QAQ A;  1PVJ A;  3IV2 A;  2R61 A;  4F7Z A;  1QXP A;  4IOI E;  3PSE B;  3SYK A;  1QT9 A;  2L52 A;  2AS8 A;  2CS4 A;  3MMP A;  4ANV A;  3PFI A;  4BOP A;  3E46 A;  4Q8G A;  3V6C A;  2D5G A;  2XFS A;  3PZD A;  2DJG B;  1R4M B;  2V9H A;  1XB2 B;  3URY A;  3A42 A;  3R8F A;  3FUV A;  4FCV A;  1IY2 A;  1D2N A;  1JW9 D;  3V60 A;  4JLC A;  2J4X A;  4L1B A;  5CTR C;  1IPG A;  2WXG A;  3I3T A;  1NY6 A;  4GIP A;  2ZAN A;  1PQS A;  3ZNH B;  3GZN B;  2E5L M;  2KVZ A;  2LHG A;  2A5U A;  4C56 C;  3DBS A;  1QUT A;  4N9F 4;  1L8Q A;  3ZO5 B;  4AI6 A;  3MTN A;  2D11 A;  1M4V A;  1DEU A;  5HKH A;  4TSS A;  3L0W B;  2CIO A;  2JSV X;  1T0Q C;  4PS8 A;  3TPZ A;  4LY6 A;  4YYW A;  2JYT A;  1HQY E;  1MHX A;  3OTO M;  3H7P A;  2KO3 A;  1D5Z C;  3D6S A;  3U6L A;  4JL9 A;  4BOZ A;  2LI5 A;  1AYF A;  3T3N A;  1MS6 A;  4OZA A;  1GJZ A;  4XC2 A;  1TR8 A;  4GGQ A;  5H8Y E;  3AI5 A;  4HXD B;  2INC C;  1EO6 A;  4X65 M;  1NNU C;  5MPO A;  2IZV B;  4BOU A;  1CTE A;  4I05 A;  4W9J A;  4WJQ A;  1IP9 A;  4JWS C;  4DV2 M;  4KZ0 A;  2X49 A;  4XR7 A;  1RAX A;  2ZVN A;  4OU7 A;  1ESF A;  4AW4 A;  1HZ6 A;  2KDL A;  3W5V B;  3PT2 A;  2J7Q B;  1A5T A;  5G5H A;  3ZXR A;  3C3D A;  2ERC A;  4KO8 A;  2Y3A A;  4ICU A;  5FKA C;  5C1B A;  1STE A;  5G55 A;  4ZHO A;  5KHQ A;  1NPZ A;  4EFO A;  4NY0 A;  3RVW A;  3MHS D;  3LFY A;  1GB4 A;  3VDU A;  2MRP A;  1IN8 A;  3VTV A;  2KDB A;  3BVG A;  3BC3 A;  1OQQ A;  1WX8 A;  2OPF A;  1LXD A;  1I42 A;  1L4D B;  4P1B C;  4EZL A;  1OIZ A;  5CVO B;  2C99 A;  1UF0 A;  1Q3B A;  4CHT B;  3CMM B;  5JI3 E;  2OUL A;  3J7B A;  2WDV B;  4ZRJ A;  1HXY D;  4ZHP A;  3C58 A;  1E90 A;  2GNO A;  3TE6 A;  3O65 B;  2BTW A;  2R62 A;  4G4O A;  1Q10 A;  4PCZ A;  1QOA A;  1R4N I;  5AUK A;  3PRP B;  1P98 A;  3SMP A;  2L3Z A;  2MR9 A;  3NBX X;  4DR4 M;  1LQB A;  3OJ3 A;  4OZB A;  2O6X A;  2RMM A;  4N6E B;  4OVZ B;  5IT9 S;  2CKH B;  5C2T B;  1J8C A;  2ZM6 M;  3EA6 A;  2N0S B;  3B9P A;  3AU5 A;  1ACC A;  2JQF R;  5EZQ A;  3R8B A;  5AZG A;  3T8M A;  1XF5 L;  5EQT A;  1N62 A;  2Y20 A;  4GOC A;  2CB5 A;  1WF9 A;  2QPA A;  1SXT A;  4LF6 M;  1JR3 A;  2JY7 A;  2KAJ A;  2BQQ A;  3Q2A C;  3C0R A;  1V81 A;  2FCQ A;  3HUI A;  3A9J A;  4M8M A;  1ZE3 D;  1XCT L;  2INP E;  2L83 A;  1VEJ A;  4MI7 A;  3J9C A;  2K6B A;  2IO2 B;  1TH2 A;  3AE9 B;  1E10 A;  4XX5 A;  2UYZ B;  4CJ6 A;  3U7D A;  2R4J A;  2LH0 A;  2DOS A;  3KOX E;  3AU4 A;  3AN1 A;  2IBI A;  3N1Y C;  3SFZ A;  3DDC B;  3EIH A;  3L13 A;  4IWQ A;  2NR2 A;  2G9H D;  1ZOY B;  3H8H A;  4BVU C;  3E21 A;  3GLI B;  4PT5 A;  4KLB A;  5J17 A;  2V1U A;  1YAL A;  1N34 M;  1DGJ A;  3EHV A;  1AWD A;  1OAO C;  4HVB A;  2XK5 B;  2CV0 A;  2RDB C;  5CVN B;  1CQD A;  3S3Q A;  3FC4 A;  4PP1 A;  3P4Q B;  3PNV A;  2HHH M;  3BY4 A;  1RU3 A;  4G3X B;  4ANW A;  5AZF A;  1HEZ E;  2N9K A;  3IAS 1;  1L4Z B;  1AEC A;  2WDR B;  2EMS A;  2MH8 A;  1TS3 A;  2Y5P A;  1KSF X;  2WLB A;  4BQV A;  1UEL A;  3AEG B;  2KZS A;  3EEC A;  4AS1 A;  1R4N B;  1FFU A;  4IG7 B;  1THE A;  1XO3 A;  3APD A;  3KWB X;  2KA6 B;  1C4C A;  4R7G A;  3U52 E;  2MHJ A;  4BPV A;  2LUM A;  2CV1 A;  2NQ8 C;  5D6J B;  4NL4 H;  1L6U A;  2WXN A;  5L83 A;  2DAE A;  3J81 S;  4QAY A;  4YYQ A;  3QQ8 B;  1PPD A;  2KTR A;  4GMQ A;  1HE8 A;  2KX3 A;  3KUZ A;  1FH0 A;  4HKQ A;  2LGX A;  1GVN A;  4XWW A;  4PYU A;  2KKC A;  3QWL A;  3QJZ A;  3Q8B A;  2L8J A;  1NQC A;  4NPN A;  2NPT B;  1G3I A;  3A4S C;  5EE9 A;  3NOB A;  4DHJ D;  2CHW A;  4G6Z A;  4W5B A;  4M00 A;  4II3 B;  4L6V 6;  1IBM M;  1E0Z A;  3B08 A;  2EO2 A;  2LWP A;  2L76 A;  5ITT A;  3GLG E;  3THG A;  3HD3 A;  4A20 A;  2RGO A;  3EUB 2;  3PV1 A;  5LXI B;  3VH3 B;  3RNA C;  3MC8 A;  3SAU A;  5FPW A;  4MDK E;  4PD2 A;  4WW0 A;  3TWK A;  3W30 A;  1Y56 A;  3W1Y A;  3HWS A;  3ZIM A;  2QSD A;  4X57 B;  2WHI A;  1C9F A;  1YJJ A;  3B7Z A;  3HHZ A;  3DHG C;  2Z59 B;  4IIW A;  1WJ6 A;  2QCU A;  4B0E A;  3AOE C;  1F0Z A;  1E8X A;  3LXF A;  1YNT E;  2L1A A;  3U30 A;  3J2P B;  3HJS A;  1T43 A;  4NJ7 A;  5EXP A;  1WSP A;  2LBC A;  1OJL A;  4MT5 A;  2VHF A;  1UGJ A;  4MGI E;  1XQQ A;  1B9R A;  3PBH A;  2IND C;  3GRR A;  4DHZ E;  3OVX A;  4LJ8 A;  1NNJ A;  1IBX A;  1TU6 A;  5FTJ A;  1ZXI A;  1CZP A;  4FVM A;  1SXJ D;  2X8X X;  5C23 A;  2O5R A;  2SAK A;  3X0W A;  3IUT A;  3K9M A;  2MBH A;  1ZP0 B;  4N79 A;  3C9P A;  1UWM A;  2PBH A;  3U8E A;  2OQ4 A;  1PYW D;  1J0G A;  5PAD A;  2F7D A;  1CUK A;  2ONQ A;  3GLH E;  2JP7 A;  3I04 M;  1GCB A;  1VDL A;  1V1O A;  4D80 A;  4AQ7 A;  3FRH A;  2ACZ B;  2WXP A;  2P86 A;  3T6P A;  1SXJ E;  2KLC A;  1NV9 A;  1K51 A;  3HK0 A;  3UJN A;  1JRP A;  4W4U A;  4IBJ A;  2V3S A;  1FEH A;  3N3K B;  3GPU A;  3UIO B;  3NVW A;  1QAN A;  2I2Y A;  4L15 A;  1EF7 A;  1R7S A;  3AOG A;  4YTM B;  4HEA 1;  4GDL A;  3ZTD A;  2QCZ A;  2XFT A;  4JN6 A;  3ZQJ A;  2I7P A;  2L32 A;  3ZH9 B;  3AEC B;  3I5J C;  1Q6K A;  5AEK B;  3DHH C;  2MP2 A;  3R7R A;  3UGJ A;  1OQR A;  2GI9 A;  3Q3M C;  2NQD B;  2ZPY A;  1EUV B;  2JY6 B;  1NV8 A;  2EKE C;  1SXJ C;  1OKS A;  2V1Y A;  3Q8A A;  4NQK E;  1DV0 A;  2DHY A;  1B1Z A;  3N32 A;  2FQ9 A;  4RH6 A;  1SE3 A;  4LGY A;  4IC7 B;  4BBN C;  3R7Q A;  2AEH A;  2RR9 A;  4LCD E;  5HG2 A;  1U9Q X;  2KXE A;  1C78 A;  2UUA M;  2Y5C A;  1AU4 A;  2BWE S; 
#chains in the Genus database with same CATH homology
 3GP1 A;  3FTC A;  1P7F A;  1EU4 A;  3K92 A;  4QHT A;  1DOI A;  3T38 A;  1FM0 D;  2N7J A;  5ITU A;  2WXJ A;  2WXO A;  1DGB A;  2CUZ A;  4JI5 M;  4ZYS A;  3AE3 B;  3LVV A;  3KS8 A;  4QHS A;  1YQ3 B;  3PRM A;  3W9C B;  1V1P B;  2EEL A;  2XLJ A;  1NHW C;  3LB8 C;  1NYR A;  3UK6 A;  3TMP A;  2M5Z A;  3DA1 A;  5LMU M;  5DYI A;  2G1E A;  3VRA B;  5G5G A;  2LHD A;  3E56 A;  4BBA A;  2DYM A;  5FTM A;  2WDQ B;  2P5T A;  2KWD A;  1HT1 E;  3H4M A;  2WXH A;  2CEA A;  5D7G A;  4X62 M;  4XBO A;  4WWM A;  1OFH A;  3HKP A;  4BLC A;  3JR4 A;  1DOX A;  5ITX E;  3BYT B;  1Z5A A;  4D81 A;  3KOZ E;  1OFI A;  4RF1 A;  3SAT A;  2RPV A;  1QLB B;  1ET9 A;  2LJI A;  2VII A;  3R9X B;  1QYR A;  2KDM A;  1DGG A;  4B7G A;  1L0X B;  1VZ6 A;  1XLQ A;  3FYC A;  1Z6T A;  2WXF A;  4GUA A;  3GLG B;  1RYJ A;  3VDP A;  1SJH D;  4Z6Y A;  3IG5 A;  2I7N A;  1J7B A;  5FK9 C;  4ITQ A;  2J7N A;  4GIT A;  3K1J A;  1KLG D;  2KN4 A;  4ZTB A;  1I4G A;  5KQ8 A;  1FCL A;  1D5M C;  1JWM D;  1AN8 A;  4BOQ A;  4YY3 M;  1MX0 A;  2Q5W D;  1PJI A;  4YSY B;  4AKG A;  2WQY B;  4II7 A;  4JI2 M;  4AG5 A;  1TS2 A;  1TKY A;  5EP4 A;  3RE8 A;  3HHW A;  1DGF A;  3FYD A;  4NAM A;  3IFU A;  1ZUD 2;  3HU2 A;  5FR3 A;  1L1Z A;  1KLU D;  3TRK A;  2W3S A;  1N36 M;  3AB5 A;  3HU1 A;  3OQC A;  2UXD M;  3AE2 B;  3AE7 B;  3FUX A;  2BB6 A;  1GB1 A;  3EGR A;  2J7O A;  1GOZ A;  2Z4R A;  1YMH E;  4D8B A;  3AEB B;  5D3I B;  3TEX A;  4LZJ A;  3HU3 A;  2LEK A;  3NZ3 A;  1BUI C;  4IJF A;  4KGS A;  2QZ4 A;  1FO4 A;  2J7Q C;  3Q69 A;  5BMI A;  2PLP A;  2DXI A;  2BS3 B;  2UXC M;  2C5R A;  3MP9 A;  4DV4 M;  3HRD D;  5EE3 A;  2D7G A;  1EM7 A;  3AL0 C;  3FIL A;  3U61 A;  3KDS E;  5BR8 M;  3TSS A;  4A3V B;  2JRI A;  1NVI D;  3HVD A;  2NTS A;  3VRB B;  4DR2 M;  3NS1 A;  2JYE A;  4IBF A;  4NSO B;  2RDH A;  1D4B A;  3KW6 A;  1DGH A;  4DV1 M;  2F4V M;  4YSZ B;  2V3N A;  4B3T M;  3T1Y M;  4LF8 M;  4B3R M;  1E94 E;  5JZE A;  3NRZ A;  1J7K A;  1FXI A;  3W2D A;  4PDG A;  1FCC C;  1PFD A;  1FRD A;  2UUC M;  4JI0 M;  3I51 A;  3TWM A;  4M9X A;  1FJG M;  1L6V A;  4DR1 M;  3U6Q A;  1SSN A;  3LVW A;  4AZF A;  2ON8 A;  2LWX A;  3P63 A;  4Z8X A;  2DWM A;  4L8R C;  1VZ7 A;  3FAH A;  5HHD G;  3GRU A;  5FTN A;  3ZGZ A;  5EE1 A;  3HHY A;  4DV6 M;  1FMA D;  2WXQ A;  5KPT A;  4MH0 E;  3J80 S;  2CE7 A;  3NVZ A;  3U5Z B;  4GH9 A;  3KS4 A;  4QNM A;  1MHH E;  3RGP A;  1T3T A;  3ZJU A;  4BB9 A;  4IBG A;  5HI1 A;  2D7E A;  3IT6 B;  3BZD B;  2MEK A;  1QZM A;  3GLH A;  5KPZ A;  3AV8 A;  3KOW E;  4JYA M;  2V1C A;  3SAV A;  4JI7 M;  3W1S A;  2AGA A;  1K52 A;  1SXJ A;  4GHA A;  3KQ4 A;  1MU5 A;  3Q8E A;  3LQR A;  1XC8 A;  1G8P A;  1WYG A;  1IN5 A;  5FSW A;  4N59 A;  3RPF C;  1GLN A;  1VLB A;  4I8O A;  1L2B A;  3GQ3 A;  2KEB A;  2F5Q A;  3ZQ4 A;  4IP3 A;  2L7I A;  3WHL A;  1XLO A;  1YQ4 B;  4QOS A;  1SIJ A;  3JAM S;  3KSX A;  3CWI A;  4K0K M;  2ZW1 A;  2XN9 C;  1E7P B;  4PDI A;  3JR5 A;  5KO3 A;  4MM3 B;  4A5U A;  1F77 A;  2F5S A;  1TKG A;  3PHW A;  3VQI A;  5GXG B;  3VKH A;  1PUT A;  4A6Q A;  4LF9 M;  1N5X A;  3SHF A;  4US9 A;  3BVZ A;  2XH9 A;  4LFB M;  2VQE M;  1K82 A;  3CF0 A;  2KMM A;  4GDK B;  2V0G A;  1ROE A;  3KXE C;  5IWA M;  4P16 A;  4AKI A;  3NWL A;  2K0P A;  3IXS A;  4HRO A;  1ET6 A;  2KRK A;  1NJF A;  1I4R A;  4LJ6 A;  2ZAM A;  3DWG C;  2W54 A;  2QBY B;  4KOD A;  1I4W A;  1JML A;  1ZAE A;  2QJL A;  2K5P A;  5BMH A;  1DO0 A;  4KX6 B;  1HNW M;  4A90 A;  2AQ1 B;  1SE4 A;  1JCK B;  5ITX A;  2EA0 A;  1E9M A;  1TH4 A;  3CTW B;  4X66 M;  1YJI A;  1C1K A;  2ICI A;  1UM8 A;  3PSE A;  5C3J B;  1C4A A;  4DXG A;  4IBB A;  3T15 A;  1ENF A;  1Z5B A;  5A2Q S;  1HNX M;  1RM6 C;  5ITR A;  1V8C A;  4I4L A;  1WRI A;  3GRY A;  4D8E A;  4REZ A;  1XNR M;  3I57 A;  5IRE B;  1L2C A;  3ZNH A;  5E6J A;  3GQ4 A;  3B2G A;  1YE9 A;  1TJE A;  3TL4 X;  8CAT A;  4JWU C;  3E4R A;  4G4N A;  2DWZ B;  1TZO A;  2R18 A;  1N63 A;  4XDC A;  4QNR A;  1NY5 A;  1HQR D;  1CK1 A;  4IKG A;  1QAM A;  5H37 D;  2XEP A;  4XE0 A;  3L29 A;  2V6Z M;  3U60 B;  4LRT A;  4FXC A;  3SMS A;  4OW0 A;  1KYI A;  3SHG B;  4GC5 A;  2BS4 B;  1HR0 M;  1QQR A;  4LLG M;  3U2S C;  3MFG A;  3AFH A;  1RWS A;  1ORY B;  1SJE D;  2J7Q A;  1SB3 C;  3Q8F A;  4L4U A;  2BU3 A;  2KQ4 X;  2JA2 A;  3VR9 B;  1KFV A;  3SC3 A;  1ZPS A;  3DWM A;  3AM9 A;  3NBI A;  2IGG A;  1EWY C;  1FNV A;  3WHK A;  3O65 A;  2BYT A;  3KLS X;  3PRP A;  4XZX A;  3AE8 B;  1ZDV A;  1GL7 A;  4OVZ A;  4B7H A;  2RKO A;  1G41 A;  3ZC7 B;  2UUB M;  3M0E A;  2LHE A;  3TWL A;  2E3T A;  1IN4 A;  1XXG A;  1XXH A;  2UXB M;  4ARI A;  2DWL A;  1JRO A;  3FTE A;  5T8I A;  2WU5 B;  2DBY A;  1K3X A;  2HTM E;  2BS2 B;  2DHR A;  3B2F A;  4DUZ M;  3U6D A;  4M9S A;  1KH0 A;  3MP2 A;  4J3O D;  5JI2 E;  5EJC A;  2OED A;  2YR0 A;  3NVV A;  3GLF B;  3W0L B;  5FLX S;  2NTT A;  2Z8L A;  3RNV A;  3U7Z A;  1GKI A;  3LYY A;  2MJ3 A;  3L25 A;  2H89 B;  4MGZ E;  2QMT A;  3PO0 A;  3P4R B;  2WXL A;  2OHF A;  5C18 A;  2MJD A;  3NUH B;  1R7R A;  3Q8X A;  4KKI A;  1UUP A;  1Z5C A;  3J7A S;  2L09 A;  5EP2 A;  2PW9 A;  1JQJ C;  3RGS A;  2CV2 A;  4L23 A;  1E9S A;  3HGI A;  4YHH M;  3C8Y A;  2M19 A;  4AG6 A;  2K3U A;  4GKK M;  2N9L A;  4TQ1 A;  5F3W A;  2EUC A;  4ZPX A;  1JR3 D;  1T5X D;  2WXI A;  1HZ5 A;  2Y21 A;  1FNN A;  1KTK A;  3AV0 A;  3W0F A;  2ZW0 A;  3VK7 A;  2RDG A;  1TY2 A;  4JX1 C;  2Z4S A;  1TKE A;  2FUG 1;  4A8X C;  1NVM A;  3TEZ A;  1UKF A;  2WS3 B;  2WXM A;  3IG8 A;  1TGU A;  1L0Y B;  1QOB A;  2DZO B;  2Y0T A;  1N60 A;  4HRS A;  4D82 A;  1W5S A;  1G59 A;  3AKZ A;  1C77 A;  1N61 A;  1NYQ A;  1D6E C;  1GAQ B;  3FUU A;  1L0V B;  4TQ0 A;  3SR6 A;  3AEA B;  3AE4 B;  4IBC A;  4EIW A;  3PZ7 A;  1JQ4 A;  2G8L A;  2UU9 M;  2XGN A;  4MAC A;  1E32 A;  5JXV A;  3KWV A;  4NZL B;  1XWI A;  4RGM A;  4W5W A;  1QVR A;  1QAQ A;  4LFA M;  4LF5 M;  1K3W A;  1V97 A;  1L5P A;  1XLP A;  1XLN A;  2W55 A;  1JWA D;  4US8 A;  2M0A A;  1R2Z A;  3D8L A;  3KP0 E;  2XF3 A;  1QKZ A;  1GPX A;  3FKE A;  1JWB D;  5ITQ A;  1ZDX A;  4KHP M;  1VZ8 A;  3L26 A;  4HJG E;  2IJ0 A;  5H92 C;  2BW2 A;  3UZU A;  3CF2 A;  4HLQ A;  1CJE A;  1MPE A;  4FD2 A;  4LJ9 A;  1FIQ A;  3PVS A;  2IDY A;  4MGY E;  1J7A A;  1IBK M;  4FWH A;  3ABV B;  1V1P A;  2LXE A;  3L4P A;  4C7Y A;  2R46 A;  3PXG A;  4YT0 B;  1SBB B;  3FTD A;  2BB5 A;  3AEE B;  1QF6 A;  5FTK A;  2ZAO A;  3ILK A;  3BK2 A;  4DV7 M;  3W31 A;  1CQV A;  4JI3 M;  2JX5 A;  1KF6 B;  1C76 A;  4WH4 A;  5KQD A;  1Q39 A;  2XSZ D;  4GKJ M;  1XCQ L;  2WXR A;  3V3X A;  3TEY A;  1YSY A;  2K22 A;  2Y0Q A;  4DQO C;  4N58 A;  5AUI A;  1TS5 A;  2A5Y B;  2CFO A;  1OFF A;  3R2I A;  4NOO B;  4LZZ A;  3AE5 B;  4KGR A;  2BT6 A;  4R3D A;  3AOE A;  3GRV A;  3MHV C;  2H1R A;  3D8B A;  2SEB D;  4C80 A;  2PVO D;  1T6B X;  3B9J A;  3GLG A;  3KSJ A;  3MJ5 A;  4ARC A;  4RCO A;  2BTW B;  1PGB A;  4X64 M;  3K8Z A;  1FRR A;  1IY0 A;  3GPX A;  2NMQ A;  3MC0 B;  4CQN A;  1XEE A;  5BMG A;  2HWK A;  1FNU A;  4HL4 A;  2HL7 A;  4WAF A;  3M7G A;  3RFW A;  2PIA A;  2J52 A;  3KOY E;  5DNY A;  4D8I A;  1NI3 A;  3K2L A;  2YFQ A;  3AH7 A;  2QEN A;  3KFU G;  5LMN M;  1Z59 A;  4DR7 M;  3SAR A;  1QQW A;  1TY0 A;  1KRH A;  2GRI A;  2XZF A;  4XDD A;  1I7H A;  2YNM D;  4JV5 M;  3NVY A;  2DLB A;  2YEP B;  1WGK A;  4FW9 A;  1N32 M;  1VRA B;  4MGK E;  1PGX A;  3IAM 1;  2PVG C;  2CHV A;  4FWD A;  4NRW A;  3Q8C A;  4OZC A;  3MTV A;  4IUM A;  1I94 M;  3AMZ A;  2HDE A;  4LRS A;  3U6E A;  1NEN B;  4G4Q A;  1IM2 A;  4BOS A;  2GB1 A;  1XMO M;  1FNW A;  4MGH A;  4B08 A;  4DR5 M;  5E26 A;  2R65 A;  3BII D;  4RKX A;  4RGN A;  2XNA C;  4LJA A;  4DV3 M;  1ZQ9 A;  1R2Y A;  1BXT A;  1FD6 A;  2VZK D;  2WP9 B;  2AQ3 B;  1SEB D;  4O1N A;  4ZRQ A;  1F2R I;  1TDH A;  3P4S B;  3SAS A;  3U6S A;  2J53 A;  3E9S A;  2BJW A;  5GKN A;  3FUW A;  4CIS A;  4A9A A;  2H88 B;  3EIE A;  4D2K A;  1E9R A;  4DXF A;  1XMQ M;  3B21 A;  2K47 A;  3VKG A;  1QOG A;  2QIE B;  1IBX B;  2DVW B;  4FCT A;  4WQM A;  2JXT A;  2LNH C;  2FE8 A;  7CAT A;  4B0M A;  3HVZ A;  4GRI A;  2KRU A;  5EXX A;  2W3R A;  5FTL A;  2V4I B;  3L2A A;  1SF0 A;  2AQ2 B;  2PMV A;  4LGM A;  3AJI B;  3TQS A;  4GDL B;  3U5Z A;  1TS4 A;  1FXA A;  2DZN B;  4B7F A;  1XXH B;  2X4A A;  2BNK A;  3LMM A;  3SBJ A;  4WUR A;  4NXN M;  2BTE A;  4WIP A;  3WCQ A;  3A46 A;  2G5G X;  1K53 A;  4A55 A;  2R4E A;  2LGI A;  4XWT A;  4XGI A;  4IDI A;  3RFZ B;  2KAC A;  3SEB A;  4LJ7 A;  1K50 A;  4B3S M;  3A98 B;  3U4E G;  2KZU A;  4OX9 M;  3BOS A;  4L16 A;  1VDV A;  2CJO A;  1HNZ M;  5DYG A;  2XZU A;  3GS2 A;  1R6B X;  4NSR A;  1LV7 A;  4DV5 M;  1N5W A;  3I4V A;  3ZJV A;  2FFJ A;  1IQP A;  1MI0 A;  4JI8 M;  4JXJ A;  3U6M A;  2DWN A;  4OHJ A;  1IXS B;  1D5X C;  4LFC M;  3PHX A;  1L2D A;  4LTU A;  1HA5 A;  1AW7 A;  1YN5 A;  4IBK A;  2VQF M;  3PHU A;  1UNS A;  2MH7 A;  3DZD A;  5BYQ A;  3W5U B;  1EWC A;  2R45 A;  1C4P A;  2MJE A;  3P1M A;  1YN3 A;  3VR8 B;  3U6P A;  4QOZ C;  3DOA A;  1HQC A;  3I4Y A;  3AE6 B;  3ETR A;  4UDU C;  4JI1 M;  4YSX B;  2PKO A;  4GHL A;  4I81 A;  5EXT A;  4JI4 M;  1JAL A;  4HKZ E;  3LQQ A;  4IBI A;  2CHG A;  1LO5 D;  1HT2 E;  3UMM A;  1IXZ A;  2FBW B;  2PTL A;  4KLN A;  3IT4 B;  3GO8 A;  1WWT A;  2AX5 A;  2IPK D;  4YTN B;  2QEJ C;  1VJK A;  3J27 B;  1P7E A;  3BVM A;  4RF0 A;  2B76 B;  4NJC A;  1IN7 A;  1NJG A;  5EXS A;  1N33 M;  4ITK A;  2QP9 X;  2YQZ A;  5TSS A;  3V05 A;  3FUT A;  3DFZ A;  2FNA A;  3SFD B;  1I4H A;  4YWG G;  2HCB A;  2QBY A;  4AQY M;  3R2T A;  2IGH A;  3GP7 A;  1TYG B;  2VZK B;  2J42 A;  2XSZ A;  3GLI A;  3KVW A;  4M0D A;  3VFD A;  1DO2 A;  1L1T A;  4TMA B;  3L28 A;  2AHM A;  5BYR A;  2Z84 A;  3ZYY X;  2JQR B;  3L27 A;  3UI3 A;  4GC9 A;  1FFV A;  2EKI A;  1I4X A;  3TUO A;  4IJE A;  2M60 A;  1VR9 A;  4CGY B;  4NRV A;  1YZB A;  1JWU D;  2LMC A;  2CJN A;  1EU3 A;  4JPS A;  3PNY A;  2D7H A;  1J09 A;  4KKJ A;  3O13 A;  4LJ5 A;  4C7Z A;  4FWG A;  3U60 A;  2Z7J A;  4S12 A;  3GPP A;  1TH3 A;  4DV0 M;  3U6C A;  3BWU D;  4EE2 A;  4H2A A;  5KPR A;  4YTP B;  3T3O A;  4RFB A;  4I5S A;  4FCW A;  1KFY B;  1NEK B;  2WU2 B;  4DR6 M;  1NSF A;  3FIL B;  4M9Z A;  3U61 B;  2Q2E B;  4MH8 A;  2C98 A;  5IZ7 D;  1IY1 A;  4M0W A;  1IGC A;  1H6U A;  3FTF A;  4G4R A;  3VK8 A;  3AE1 B;  3AED B;  3AEF B;  1DGH B;  1J5E M;  1N75 A;  3QAU A;  2JWU A;  3P4P B;  1BML C;  1PDX A;  2WNM A;  4Q2J A;  1IXR C;  3TEW A;  1W5T A;  1DKI A;  2CU3 A;  1XNQ M;  2BBC A;  3GPY A;  4LK0 M;  1PGA A;  5D3D A;  1X37 A;  1PJJ A;  1C79 A;  2C9C A;  2Z3X A;  2V3P A;  2LFI A;  3SFE B;  1T3Q A;  3P42 A;  1QOF A;  1NHG C;  4RNA A;  2TSS A;  1DOY A;  1DYQ A;  1TDZ A;  1IN6 A;  2M56 B;  5BPV A;  3U6O A;  3FD9 A;  5EE0 A;  1XHB A;  1QIL A;  1N78 A;  2F5N A;  2BJV A;  3GLF A;  2IGD A;  1QAO A;  5EP3 A;  3SYL A;  3PZ8 A;  2JTC A;  1YUB A;  2YEP F;  1UWX A;  4KGT A;  2JZP A;  4RGO S;  1WXQ A;  3HJ8 A;  2DWQ A;  3GLH B;  3BB7 A;  2X38 A;  4L78 A;  1JWS D;  2E6X A;  2C9O A;  3BYY B;  1IBL M;  4LF7 M;  1G4A E;  1Q3C A;  1SXJ B;  2HKJ A;  5BYS A;  2L7H A;  1ZXH A;  3KWL A;  1GL6 A;  1YN4 A;  3VLF B;  3MK6 A;  2QIL A;  4USA A;  2W82 A;  3T1H M;  5EP1 A;  4NAW B;  2UZJ A;  4YXD B;  2FOI C;  1SE2 A;  4L2Y A;  3KP1 E;  3A45 A;  4LG2 A;  2F5O A;  3MHZ A;  2INN E;  2DYO A;  3BBA A;  3I9V 1;  3HJQ A;  4LF4 M;  4IBE A;  4JI6 M;  2K9X A;  2X8A A;  5EZS A;  2RGH A;  2L6O A;  4JE3 B;  3CIR B;  5HFY A;  1MVK A;  2WXK A;  3HHX A;  5LNK 1;  1E6E B;  2CHQ A;  3ZJT A;  2I38 A;  1RFK A;  1PM5 A;  1EE8 A;  2ZBK B;  2F5P A;  4MB7 A;  3ZCB B;  1VDD A;  1IUE A;  1IGD A;  2JU6 X;  4ZRP A;  4P6V F;  1F2R C;  4NXM M;  4ZOH C;  1A70 A;  4IBD A;  4AKH A;  3N9Y C;  3CF6 E;  3OWE B;  3GQ5 A;  1N77 A;  4RGT A;  2C96 A;  4DR3 M;  5I4D A;  1S3S A;  5ITY A;  3M6A A;  4TUW A;  3GB1 A;  1I4P A;  1J7C A;  1I4Q A;  4LJ4 A;  4DUY M;  3SAW A;  4GLS C;  2KW0 A;  3BK1 A;  4LCB A;  4B3M M;  1PVJ A;  2R61 A;  4IOI E;  3SYK A;  1QT9 A;  2L52 A;  3PFI A;  4BOP A;  2D5G A;  2XFS A;  3URY A;  3A42 A;  3R8F A;  3FUV A;  4FCV A;  1IY2 A;  1D2N A;  1JW9 D;  2J4X A;  4L1B A;  2WXG A;  1NY6 A;  4GIP A;  2ZAN A;  2E5L M;  4C56 C;  1L8Q A;  4AI6 A;  1M4V A;  4TSS A;  2JSV X;  3TPZ A;  4LY6 A;  2JYT A;  1HQY E;  1MHX A;  3OTO M;  1D5Z C;  3U6L A;  4BOZ A;  1AYF A;  3T3N A;  4OZA A;  5H8Y E;  4HXD B;  4X65 M;  1NNU C;  5MPO A;  4BOU A;  4JWS C;  4DV2 M;  2X49 A;  4OU7 A;  1ESF A;  4AW4 A;  1HZ6 A;  3W5V B;  3PT2 A;  5G5H A;  2ERC A;  4KO8 A;  2Y3A A;  5FKA C;  4ZHO A;  5C1B A;  1STE A;  1GB4 A;  3VDU A;  1IN8 A;  3BVG A;  1OQQ A;  2OPF A;  1L4D B;  2C99 A;  1Q3B A;  4CHT B;  5JI3 E;  3J7B A;  2WDV B;  1HXY D;  4ZHP A;  3C58 A;  3TE6 A;  2BTW A;  2R62 A;  4G4O A;  1Q10 A;  4PCZ A;  1QOA A;  5AUK A;  3SMP A;  4DR4 M;  4OZB A;  2RMM A;  4N6E B;  4OVZ B;  5IT9 S;  5C2T B;  2ZM6 M;  3EA6 A;  2N0S B;  3B9P A;  1ACC A;  5EZQ A;  3R8B A;  1XF5 L;  5EQT A;  1N62 A;  2Y20 A;  2QPA A;  1SXT A;  4LF6 M;  1JR3 A;  2KAJ A;  3C0R A;  3HUI A;  1ZE3 D;  1XCT L;  2INP E;  2L83 A;  4MI7 A;  3J9C A;  1TH2 A;  3AE9 B;  1E10 A;  2DOS A;  2R4J A;  2LH0 A;  3KOX E;  3AN1 A;  3SFZ A;  3EIH A;  2G9H D;  1ZOY B;  3H8H A;  3GLI B;  4PT5 A;  2V1U A;  1N34 M;  1DGJ A;  1AWD A;  2CV0 A;  3FC4 A;  3P4Q B;  3PNV A;  2HHH M;  3BY4 A;  1HEZ E;  2N9K A;  3IAS 1;  1L4Z B;  2WDR B;  1TS3 A;  2Y5P A;  1KSF X;  2WLB A;  3AEG B;  2KZS A;  4AS1 A;  1FFU A;  1XO3 A;  2KA6 B;  1C4C A;  4R7G A;  3U52 E;  2LUM A;  2CV1 A;  2NQ8 C;  4NL4 H;  1L6U A;  2WXN A;  3J81 S;  4GMQ A;  4HKQ A;  1GVN A;  4XWW A;  3QWL A;  3Q8B A;  1G3I A;  5EE9 A;  4G6Z A;  1IBM M;  1E0Z A;  2EO2 A;  5ITT A;  3THG A;  2RGO A;  3EUB 2;  3SAU A;  4PD2 A;  4WW0 A;  3TWK A;  3W30 A;  1Y56 A;  3HWS A;  2QSD A;  1C9F A;  1YJJ A;  3HHZ A;  4IIW A;  2QCU A;  4B0E A;  3AOE C;  1F0Z A;  3LXF A;  1YNT E;  2L1A A;  3J2P B;  3HJS A;  5EXP A;  1WSP A;  1OJL A;  4MT5 A;  1UGJ A;  4MGI E;  1B9R A;  3GRR A;  4LJ8 A;  1NNJ A;  1IBX A;  5FTJ A;  1ZXI A;  1CZP A;  4FVM A;  1SXJ D;  2O5R A;  2SAK A;  1ZP0 B;  1UWM A;  2OQ4 A;  1PYW D;  2ONQ A;  1V1O A;  4D80 A;  4AQ7 A;  2ACZ B;  2WXP A;  1SXJ E;  1K51 A;  3UJN A;  1JRP A;  4IBJ A;  1FEH A;  3GPU A;  3NVW A;  1QAN A;  2I2Y A;  4L15 A;  1R7S A;  3AOG A;  4YTM B;  4HEA 1;  2XFT A;  4JN6 A;  2L32 A;  2I7P A;  3ZH9 B;  3AEC B;  3UGJ A;  1OQR A;  2GI9 A;  1SXJ C;  3Q8A A;  1B1Z A;  4RH6 A;  1SE3 A;  4LGY A;  5HG2 A;  2KXE A;  1C78 A;  2UUA M;  2Y5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...