4P16A

Crystal structure of the papain-like protease of middle-east respiratory syndrome coronavirus
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
319
structure length
314
Chain Sequence
QLTIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the papain-like protease of MERS coronavirus reveals unusual, potentially druggable active-site features.
pubmed doi rcsb
source organism Human betacoronavirus 2c emc/2012
molecule tags Hydrolase
molecule keywords ORF1a
total genus 84
structure length 314
sequence length 319
ec nomenclature
pdb deposition date 2014-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4p16A02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4p16A01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4p16A03
4MM3B 4RF1A 4RF0A 4WURA 3MJ5A 4OVZA 4R3DA 3E9SA 5KO3A 5E6JA 4P16A 4PT5A 4RNAA 3MP2A 4OVZB 4M0WA 4REZA 2FE8A 4OW0A
chains in the Genus database with same CATH superfamily
2M60A 2KWDA 3DBSA 3BK1A 2FCQA 4FN2A 2OPFA 1ICFA 4HWYA 3H6NA 4KT0F 4RY2A 2JWSA 1ZDXA 4G4QA 5HG2A 3L25A 3KW5B 2L6OA 1ZGUB 5KQ8A 2KRKA 2C96A 3D8LA 3WXGA 2LGDA 2JRIB 3SAVA 4EZKA 1F29A 1P98A 3SC3A 2BTWA 2LRUA 4USAA 1GJZA 4M02A 2O01F 1AW7A 2MJ3A 2N9EB 2HDEA 3KUCB 2DC6A 4UN2B 1R4NI 2GBMA 2MW5A 4DXGA 3BZDB 3AE5B 3MC0B 4DHZE 4FCWA 1EE8A 2R61A 3T38A 4BBNC 2VDBB 2G9HD 1PYWD 1C1YB 3L10B 4IW0A 3GLGE 5EDSA 2GHUA 4P6EA 1E32A 3H7SA 1QUSA 3JAMS 4CISA 2DCBA 1HT1E 2N4FA 5JHAA 4I6PA 5EP4A 2R18A 1ZW7A 4I81A 3DWMA 1PQSA 2EKFA 3FUVA 1ROEA 2ZTCA 3OLMD 4DV4M 1GO5A 2C5RA 4I5SA 1E94E 3PZ8A 4AOFA 5IN7A 1XNRM 3AEAB 3W30A 4JI1M 2WNMA 3S2AA 2I7PA 2DAMA 1P9DU 2ICIA 3KXEC 4BKGA 2WXNA 1C9FA 2OZ2A 4DV0M 1T3QA 3PVSA 3EA6A 1PGBA 3A45A 4JI3M 2LVQA 1Y8GA 3M99A 5EE3A 1C4CA 1WH3A 3VR9B 3ZJVA 2H88B 3WCQA 2IYDB 3E4RA 2HHNA 4DHZB 4LF4M 3HX3A 2D3CA 1KH0A 2VZKD 1VG5A 5EP2A 1OEYA 1QQWA 3ZJTA 4MGZE 3OF9A 3R66C 4OEMA 9PAPA 2OHFA 3B7QA 1JWBD 2GBKA 5EF4A 5AZFA 1EF7A 5CVMA 4LGYA 4WURA 4TMAB 1QVRA 3WAOA 4GRIA 2OJWA 4KSLC 1T0RC 5FK9C 3O1GA 1V49A 1LGRA 1ZMUA 2LJIA 3CH3X 2FNJB 4NAWB 8PCHA 3T8MA 3W1SC 1U9QX 2QBYA 2N9PC 4B3RM 4LNOA 3P4PB 3KUDB 3HD3A 3V05A 4GGQA 1OIPA 2C98A 2YFQA 4FLHA 1UBQA 3RNGC 2KDMA 3AULA 3VTWA 4NPNA 1ACCA 3CBKA 3IAM1 8CATA 3PHWB 2CHZA 3GLGB 3QSDA 2DWLA 3IAS1 3V76A 3B7ZA 1XNQM 2WX1A 1SE4A 3B89A 1YZBA 2ZJDA 2NPTB 4HKZE 3PVLA 4JLCA 3QT4A 4O1NA 3AKZA 1IBMM 4CDCB 2JZ3B 1EWCA 1X37A 3B0AA 3NOBA 4DV1M 2NQGA 4TSSA 4GKJM 2YJ2A 2KJHB 1XLNA 3ZIMA 3GLIB 1UZXB 5AEKB 4LK0M 5MPOA 1WMHB 1XXGA 2LHGA 2KJ6A 2YJ9A 3U8EA 3ECIA 2AQ1B 1S3SA 3N1ZC 3U6PA 1AU3A 1F2RC 1I4QA 1FJGM 2DYBA 2Y20A 3FTDA 1ZV1A 3OAWA 4B3TM 1V34A 4EOYA 1P7FA 4BOSA 4NQLB 3VDPA 3HRDD 3W31A 4RGTA 3P4SB 3T3NA 2IPKD 1ZXHA 2WDQB 2MBBB 3TNXA 2IGDA 3KQ4A 4QAYA 1UGMA 1A6RA 4ARCA 2AYOA 1WE6A 1GC6A 1J7KA 1XWIA 2BYEA 3P4RB 2AEHA 4AQYM 3DZDA 3ZDTA 3WAPA 4LTUA 2BGFA 3QAQA 4IBGA 1IY0A 1KM7A 2C0YA 2G8EA 2KK8A 3GO8A 3A9KB 4XK8F 2L7HA 4W9JA 1KF6B 3AMZA 1D6EC 1K51A 1UWMA 2HD5B 4KLNA 2OEDA 1WGHA 4JL9A 3IT4B 5JI2E 4D2KA 2MA9B 3MTVA 5F02A 1JCKB 4AKGA 2KHWB 3AU5A 5FR3A 3ZUNA 3KSEA 4LJ7A 2D7GA 4FWGA 2R6NA 2QNJA 3GRYA 1DGHB 1F52A 2CU1A 3HKPA 4ZRIA 3WAMA 1VZ8A 1NNUC 2BVCA 2L52A 4WAAA 1Q10A 2PLPA 4DQOC 4KO8A 4P16A 4RH6A 2M17A 3UF8A 2DZIA 1SF0A 3B9PA 1J7CA 4M8MA 3NZUA 3AEBB 2YJBA 1NBFC 2JZ0A 1B9RA 2V0GA 2KT7A 2I1KA 3R3MA 1OAIA 3U6LA 2MEKA 3HJSA 3UZUA 5KPZA 3W0FA 2CE7A 1UNSA 1NQCA 2WDVB 1CSBB 1WGNA 2JXTA 3UK6A 2BWES 2Z0EB 3D8BA 5HKHA 2WSFF 4K1RB 2KDBA 2JZ1A 2J7QB 3EC8A 3OG5A 3BK2A 4W9CA 3ZNHB 1C3TA 5IOIA 1H8CA 1OFIA 3K9OA 4F1IA 2C9CA 1WRDB 3W5VB 2DENB 3HJQA 1SG9A 2BPSA 2DCDA 1N5XA 3PHXA 3KWZA 3LYYA 4A9AA 4IJFA 3VKHA 1E6EB 2A4ZA 1Z5CA 2LMCA 4JWSC 2K0BX 3V62A 1WJUA 3Q6BA 2G8LA 2Q2EB 3EUB2 3P1MA 2JY7A 1P1AA 1IGCA 2CWBA 5BMGA 3U8ZA 1R2YA 1ZQ9A 2Z84A 2C5LC 4MJSB 2YNMD 1G4AE 1TKEA 2AHMA 1K52A 4LF9M 1OAOC 4ACFA 1IYFA 3H6SA 2LBCA 4BBAA 2PTLA 4GHLA 1JWAD 4CHKA 2XK5B 3Q3OC 4MM3A 1NSFA 3TQSA 5DPTA 2DAGA 4RKXA 2HL7A 1L4ZB 1WX7A 4IBCA 4N6EB 5CHVC 1DO0A 1V86A 1N36M 5ITXA 4XZ4A 1WGRA 2KWUB 3A98B 2K22A 1PUTA 1O0EA 1SJED 3JR4A 2QJLA 3RFZB 1FMAD 1TTNA 1IWDA 2HH5A 2KFKA 1WHCA 2WXGA 3ZTDA 2H1RA 2XEWA 4HROA 3C9PA 4JE3B 4LJ5A 1DOYA 3BOWA 2KNAA 4PP1A 5C1BA 4BBNF 4XWWA 3J7BA 3IG3A 2D3AA 1TF0B 3FKEA 1JR3D 4X6HA 3RI7C 4FA6A 2W82A 3U60A 3SU8X 2R2OA 4ANVA 4W9FA 1NI2A 4PI3A 2JVCA 2J52A 1JW9D 1MG8A 1EO6A 1MG4A 2R0IA 1ME4A 3A46A 1VEJA 2PBHA 4XWTA 2QPAA 1KFXL 1WZ0A 3EFUA 4YL8A 3A1QA 2H7JA 3DFZA 4MI7A 2JRHA 4I04A 4X6JA 1NO1A 5CHVA 2C99A 2EUCA 2HE7A 1HQYE 1OFFA 2KW0A 3L2AA 1OTRB 1P7EA 2IO2B 3QHTA 4HEA1 1QKZA 1L6UA 2DNFA 3FUXA 2PW9A 2QEJC 1WFYA 2N9KA 1WY8A 1V5TA 3QQ8B 4ZRPA 3VKGA 2N1WA 4K7UA 1T5XD 1PE6A 3U52E 3K9PB 3FILA 1WI0A 4K0KM 1BQIA 3Q3NC 1ZIVA 4FK5A 2RD0A 4KIKB 4LNNA 3NG0A 3ZH9B 4R71A 3FUUA 1VDDA 4NJCA 1YK7A 2YJCA 1FD6A 3UGJA 1WIVA 4BQVA 2LGSA 3UQAA 4LJOB 2LI5A 5C1ZA 4IBJA 4FCTA 3ZRCA 2FUDA 3EFCA 3OF8A 3BWKA 3BYYB 3NS8A 3I04M 4LLGM 1POPA 4LDTD 4JI4M 2AL3A 2KVZA 3BCNA 2V1YA 2K6BA 1SE9A 4G4RA 2MH7A 3WALA 2ZPNA 2OULA 3RNEC 4RF0A 1NHGC 2V3NA 1VEGA 3LW5F 5JH3A 4R3DA 4NNJB 2DWNA 1MHXA 3N20C 4XR7A 2R4JA 1IN6A 4S12A 4GB9A 4ZRKA 5JXVA 4AXLA 4HL4A 2TSSA 2IO1B 4RMAA 3ZXVA 3HU1A 3RVXA 4OVVA 3Q8FA 4EKUA 2K8BA 1GKIA 3WHKA 3BYTB 3EHVA 4ICVA 3AECB 4HCPB 2Z7JA 2PJHA 4MT5A 3ZTCA 5EE1A 3KWVA 2WXIA 1IXSB 2PIAA 3KWLA 4LF8M 2W9NA 3W1YA 1AWDA 1TZOA 3SR6A 4IWOA 1MX0A 3HHAA 1QAQA 2PEAA 3ABVB 4ZRJA 1JR3E 1YJ1A 3QWLA 3BY4B 5AZGA 5IT9S 1K3XA 3CIRB 2D10A 3N3GA 1CQDA 4KGSA 4EZJA 4GIPA 2HTME 4GMVA 3VHTC 1AARA 5EE0A 2P86A 1WXMA 4BKSD 1MFWA 5IKCM 3AV8A 4EEWA 4G50A 5J18A 1K3BB 3I4VA 4GXBA 4WQMA 1V5OA 2OJRA 2QCZA 4S17A 2MBOA 3FRIA 2Y21A 1VCBA 3FTEA 1Y4HA 3F5VA 3DHIC 1TH4A 2WP9B 1V8CA 1TIFA 2W54A 1NV9A 2MHJA 4DMYA 3U6MA 2KDLA 1OKSA 3NWLA 2B3AA 1QXPA 1K8RB 3H7DA 3QCAA 2BWEA 2UYZB 1NY5A 2N9XA 4QRGA 2BQQA 4Z6YA 3R9XB 1RFKA 2LD9A 4HPPA 1CJEA 2HKJA 1D4BA 3AXCA 2KWVB 3PRZA 3DCGA 1L1TA 4IBIA 4ZUXU 3E1ZB 3VXWA 1WR1B 1WJNA 2D3BA 3DDCB 5ITQA 2O2VB 1QOAA 5CVOB 2KQ4X 2WQYB 5C2TB 1L1ZA 1TZ1A 4W9IA 3B79A 2RSUA 4LF5M 1AIMA 3H8BA 4QRVA 2LVOC 2JU6X 4II2B 1F9JA 4WA6A 3B7NA 1GCBA 3MTNA 3Q8EA 2FS1A 4DHJD 2WXRA 4AXMA 5IZ7D 4DR1M 3ML9A 2XF3A 2INNE 3M95A 4DMXA 3DPDA 1YLAA 2Y6EA 4K3CA 2NTSA 1F2CA 3KYDD 1D0MA 3TPZA 3T6PA 1FXIA 4E71A 3DWGC 3I63C 2WGSA 2UUBM 2MP2A 2NCNA 4YT0B 1K3WA 2KMAA 3LDZE 3AE1B 2JNHA 2WXHA 3ILKA 3P2BA 4TUUA 3I06A 2UUAM 2WDTB 1HEZE 2FNAA 5KQDA 1N61A 2R9OA 2G3QB 1AU2A 1EWLA 1ZDVA 2CV2A 1UM8A 3KSJA 2KACA 3EIEA 4GC5A 5A24A 2CV1A 1U9XA 2K25A 1CTEA 1IN8A 2G7YA 3FUTA 4LZJA 4BS5A 2ARYA 2AYNA 1DGGA 3PRPA 1WGGA 1EUVB 5BMHA 5TR5A 1RU3A 3FC4A 1MDWA 4QOSA 2KD0A 4NY0A 3BC3A 3LXSA 1RRBA 1IN7A 2RRUA 3I3TB 1TY0A 3L27A 2DZMA 4F7ZA 4AG6A 4A90A 1J7BA 2R62A 4PS3A 3GRUA 4LJAA 3AE4B 1MI0A 3P5UA 2BDZA 1SXJA 3PNYA 4G4NA 1SNKA 3K8UA 4MZSA 4CDFB 1ISNA 4GC9A 2SEBD 3VVWB 3CF6E 4OVZA 4HEOA 3QA8A 1T6BX 4LY6A 3HY5A 1GOZA 5FR6A 3LMMA 3JVZX 2PVOD 1MVKA 1N78A 2L0TA 1Z59A 4RCOA 4M9XA 2WLBA 3LCUA 4I8OA 2JSVX 5AUKA 3RNFC 1Y08A 3O65A 2UUCM 3HVDA 4IDIA 1DF0A 4BSQA 4NRWA 1U9WA 2Z4RA 2KDEB 1VJKA 3L26A 4W9EA 3MORA 3TMPB 3HWSA 1FPYA 5EE9A 3A4SC 3UGBB 1HTOA 3P4QB 3WXFA 4XC2A 3NHEB 2WSEF 3GCBA 3SYKA 4D8BA 3Q14C 1TS3A 1KHQA 3OVXA 4LF7M 4P6GA 3ZO5B 4OHJA 3A4RA 2DCAA 5FPWA 4NL4H 3PW3A 2K39A 2L1AA 2O25A 5ITRA 1WE7A 4ZPXA 2C7MB 2WXKA 2KTRB 3V3XA 1L6VA 3C19A 5CHFA 4CO7A 3CGWA 4A6QA 3KWBX 4N9F4 1QAOA 3L0WB 1LFDA 1IPGA 1PPNA 4L4UA 4NQKE 4X57B 1TT5B 2NTTA 3MHVC 3V6EB 4GIVA 3K8ZA 1IBXB 3C0RA 1GLNA 1HQCA 3UQBA 4CZWA 1YSYA 1YT7A 1RFAA 5FTMA 5I4DA 4E74A 1L2DA 2K0PA 3VK8A 2ZCCA 4US9A 1MHHE 1YN4A 1SBBB 2KJRA 2WXFA 1JB0F 1G6JA 1AIPC 5E26A 3RYTA 3U30A 1NYRA 1YVBA 5IREB 5L95C 2K5PA 3P5VA 5KHQA 2JXXA 2VIIA 1N32M 4KKIA 3D32A 2OO9A 1Q3CA 1XF5L 3R2IA 1TBEA 2X49A 2JY6A 3HHXA 1J0GA 4QNRA 2KKCA 4MH8A 1PJIA 1YK8A 2JXNA 2JYTA 3DBHI 5EJCA 2XU3A 3Q3JA 1FFVA 4W5BA 2CU3A 2VHFA 4CDDB 5L8RF 2KLCA 1H4RA 3RMKC 4C4VB 3KFQA 3KUZA 1PPPA 3ZNGC 3Q8XA 1WRIA 4ASWC 2CR5A 2Y0TA 4A5UA 1C77A 4N8WA 4HXDA 2INCC 1Q3BA 2FBWB 1UD7A 1EF1A 1OQQA 2FUHB 1IBLM 1NNJA 2BB6A 3IG5A 2DLBA 2LHDA 4K7WA 2JUJA 2KVRA 2PADA 2R9NA 1PM5A 3RE8A 3GZNB 3PREA 4BPVA 3HHYA 3CMMB 2ZPYA 3BVZA 3HM3A 2DAKA 3KOWE 4M0WB 1ESFA 4FD2A 2ZZPB 2CHQA 3RVVA 3GLFB 3IMAA 4DR5M 4FULA 3AJIB 2MX2A 2LASA 2BT6A 1IXRC 4BOQA 3OISA 2KLGA 3RD2A 4YXDB 2XBBC 5G5GA 3H9DA 2FRQA 2LXCA 4ANRA 2CEAA 4RGOS 1XCQL 3AOEA 1C1KA 3GLHB 3J80S 2J0MA 2N7EA 2ZNVB 3OWEB 4WWNA 1CB5A 1CS8A 3ZXRA 3N1XC 4HPMB 2MGWA 1EWPA 3APCA 2L4FA 1DKIA 2O6XA 1TR8A 2QCUA 2Y5CA 2FT2A 3NS1A 4ZYSA 1VSNA 3VFKA 3IVFA 3PT2B 3MJWA 2J7QC 4W9GA 1T6OA 2FO5A 3RZFA 1XQQA 1PXVA 4BB9A 4NXMM 3DBLI 1L2NA 2JF5A 2VZKB 3VUYA 1PCIA 2JPHA 2GBRA 3DVNV 1EM7A 1HT2E 2F5QA 5CHTA 1TGZB 2V4IB 2G4SA 1LV7A 2ZNVC 3KP0E 3PGEA 5BYSA 2KQSA 1M4VA 2DC8A 5LLIA 4M9SA 2BS3B 1NJFA 1A70A 4CGYB 1KOTA 2CHVA 2XU5A 3AN1A 1QMYA 3SMPA 2EMTA 4IWQA 2LGIA 3GQ4A 3LXFA 3RNCC 4A8XC 3H1UA 4B6WA 5EQTA 4JI8M 2WYQA 4ZHOA 5JHBA 3AOEC 2DCCA 1PFDA 2AL6A 2IBIA 4LJ6A 3JR5A 1ZE3D 2OQ4A 3U6CA 3IBEA 4IM3A 3UIOB 4XBOA 1W5TA 1ET9A 4MGKE 2Y5PA 2P5TA 3BVGA 1YQBA 3PV1A 3VUWA 1XXHE 3U6EA 3R7QA 2D11A 2JWUA 2PMVA 3U6QA 3R8FA 2K6DB 3H7PA 3M3JA 5JI3E 4GDLB 1M6DA 3RFWA 3MP9A 1FM0D 2JT4B 2BS4B 3QJZA 4X62M 5IO9A 2JZPA 2CV0A 2UXCM 3U61A 2IZVB 2IO0B 2V9HA 1BGOA 2E00A 1CZPA 1SSNA 1TS2A 3HWNA 4JN6A 3J9CA 4KDIC 3TRKA 2JYEA 3H8CA 1N33M 2ZBKB 1S3SG 2M8SA 3VRBB 2HHHM 2Z59B 4ITQA 2A5YB 3L4PA 2ACZB 1QF6A 1E90A 2IGGA 3KX1A 5FTJA 1XB2B 1XHBA 4DR6M 4YYSA 1FEHA 4DBGA 1Z5SB 1JQPA 1IXZA 1GPXA 2FIDA 3ZRFA 4CIZA 2MSED 4ICUA 1GB1A 2HAKA 5A2QS 4G0NB 4LJ9A 3R2TA 2OOAA 4W5WA 3IFUA 3DVGY 2LUEA 2ZM6M 1H6UA 4PD2A 4G4OA 2JRIA 1WGYA 1EWMA 1UGJA 1RM6C 3HHWA 4GITA 5ITUA 4MEMA 3ZVVA 3KOYE 3Q8GA 1J19A 5KHOA 2RPQA 4A3OA 4WH4A 1UWXA 4M8NA 3MHSA 3RNBC 1V80A 2BTWB 1KTKA 3TCAA 2MRPA 2WHIA 2ZAMA 3RN9C 3FYDA 3JSVB 3MMPA 1IQPA 2BKFA 3BINA 4MZOA 4S0RA 1W5SA 5EP1A 1NVID 3KDSE 4AUQC 3I4YA 3NVYA 4BAXA 3PLVA 2DZOB 5E6JA 2BJVA 2RGHA 3PS6A 2DAFA 4K7CA 1DOIA 3TJPA 4KGTA 2AUZA 3SFDB 3S3RA 5EZSA 4QNMA 2PKOA 4WAFA 4OZBA 1DEUA 2IO3B 1WXVA 4AJYB 1HZ6A 2K9DA 2KO3A 1NHWC 1JQJC 1TGUA 1IFYA 2Q5WD 4GU2A 2I7NA 4BOSC 3W2DA 3GLFE 3AV0A 1BT0A 4B7HA 2FH0A 1E9MA 2NVUI 3A42A 3IG8A 1THEA 1FIQA 3BBZA 3UJNA 2J7NA 2DYOA 1DGBA 1NPZA 3RCZA 2LFIA 2FAZA 4DWFA 1GJTA 2JQRB 3I9V1 2FFJA 1EWOA 2QHOA 1JRPA 2V3PA 2I1JA 2L7RA 3AE9B 2EELA 2WWZA 3SHGB 2DNAA 2D3GA 3NZSA 4KHPM 4YWGG 3RT3B 4YYUA 1C78A 3HU2A 4GOCA 4IWPA 3HHIA 3ZYYX 4FJCA 4MACA 3QC8B 4TKNA 3GLIE 2KOXA 5BMIA 1F4IA 1SIJA 3RGPA 1CK1A 1TL9A 3PPAA 4C56C 1QAMA 3MHZA 3J81S 1TDHA 2BF8B 2IY0B 1YN3A 3KOZE 3MJ5A 4AJWA 2NBWB 4L6V6 2UXBM 1Y8RC 3J2PB 4P1BC 3SARA 5E6OA 4L2YA 3DF0A 2ATOA 1N60A 1QANA 3U7DA 4B95A 3T9LA 2ZVNA 3E9SA 2QQ8A 1MHWA 2L05A 2M5ZA 2DVWB 4C7ZA 2LVPA 1Z5AA 3QYEA 1FRRA 3IT6B 3SHQA 4YHHM 4LCDE 4I6NB 5FKAC 2BDLA 1PJSA 4NC6A 1GAQB 3KP1E 1SXTA 4GDKB 4II3B 1CV8A 5AZHA 4NAWA 4IM2A 2CJOA 3L16A 2L09A 3GE3C 3JYUA 5HHDG 3CH2X 2R44A 2QBYB 2CKHB 4EZLA 2BTEA 4IIWA 2LXAA 4PP2E 2JWZA 3BPMA 1N62A 2EO2A 1WXSA 1I4RA 4G54A 3N3KA 2FUG1 1E9RA 2UU9M 2N7DA 1RWSA 2AVWA 3L54A 1UF0A 1NYQA 3PHWA 2BU3A 2J0JA 3WXEA 1YN5A 4WIPA 1YOVB 1U9VA 4FW9A 2X4AA 4MSMB 2DZLA 2G5GX 1VD2A 2BYVE 4D8IA 3B74A 1MPEA 1KHPA 1V1PB 1CUKA 2LZ6A 2Z0DB 2F5PA 1NJGA 3ZW3A 4JI2M 1TYGB 2MBHA 2XNAC 3BWUD 2X8AA 3GLIA 1HNWM 3BIID 3QX1A 2UXDM 4YY3M 4RF1A 2DHRA 2J5YA 1WMHA 2L76A 2KX0A 1YALA 2PREA 3IV2A 3AH7A 1PJQA 3ZJUA 4QHTA 3T1HM 1RYJA 3VUXA 3SASA 2AIMA 3GE8C 2ZW0A 3ONSA 5D7GA 4JI7M 2DZNB 2L7IA 2MJDA 1GNUA 5CTRC 4ZRQA 3PHUA 3U5ZB 3LFYA 2A5UA 3ETRA 3TSSA 1P3QU 2D5GA 3V6CB 4RM9A 3A33B 2IDYA 3BOSA 1AYUA 4FHKA 3A9JA 2WBFX 5DFLA 3P42A 3TE6A 4DUZM 5JZEA 4L78A 1E7PB 2KYWA 1J09A 2AYOB 2N9LA 4G11A 3PNVA 3PSEA 1I4GA 2BYTA 4LRSA 2OOBA 1IBKM 1CMXB 3ZNZB 3PRMA 1FCLA 3MP2A 3F75A 3FUWA 3VK7A 2M1MA 3AB5A 4GEWA 1NEKB 1ZXIA 2O6VA 3Q8CA 1EU3A 2ZCBA 3A9KA 3KW6A 1E5WA 3QYBA 4M0DA 1YQ4B 4L16A 1TY2A 1JQ4A 3NBIA 1A5TA 4AKHA 3N32A 4DHJB 4KX6B 1C4AA 3ZNID 4PK1A 2HD5A 1EFUB 1LXDA 1J7AA 4FJVB 2I2YA 4OU7A 4XGAB 1WSPA 4Z8XA 4OVUA 3HUIA 3S3QA 4M00A 5LMNM 3TWKA 2LXEA 4BLCA 1MU5A 3M62B 3VDZA 3LB8C 2V1CA 4XX5A 2LNHC 4P7IA 4ZHPA 2VF7A 1DGHA 1N63A 3BXWA 2F7DA 1AYFA 4DK5A 3CWIA 2L83A 4AWJA 3HK0A 4YTPB 3VLFB 1F0ZA 2HTHA 4B9KA 2QIEB 2KFJA 3B2FA 3GRRA 1TU6A 3UINB 2G8JA 4X65M 5G2NA 4MDKE 2RKOA 1KLVA 3DBRB 1B1ZA 4P17A 2ASQA 1FH0A 4XZXA 2FOIC 1WGKA 4OZAA 1WGDA 3T3OA 5F3WA 2WXOA 4KDLB 2DJFB 1XMOM 5EXPA 4CJ6A 2KZSA 1HA5A 2F1GA 2Y5BB 3PFIA 1LTMA 2AX5A 4BOZB 2M19A 2X38A 2DWQA 3W5UB 2J7QA 2ZAOA 1HE8A 5ITXE 1R7SA 3ZDMC 2CHWA 2GBNA 2ZEQA 4JYAM 4LDTB 1PGYA 2APLA 3PHXB 2C7HA 4HLQA 4IC7B 2D2QA 4LFBM 2NQAA 2L4EA 2W3RA 1VLBA 3GRVA 1VZ6A 2L3ZA 4YVAA 2KN5A 2DXIA 3LVVA 1TH3A 2EKKA 3GOEA 2PNSA 3PBHA 4L15A 4ARIA 4X66M 4HCNB 4BZAA 2ERCA 2KC2A 1OQYA 1XXHA 2G6DA 4TV3A 2B1MA 4GLSC 3IUTA 1G59A 4NOOB 1IGDA 2E5LM 2KNBA 2Z4SA 2IPPB 2G1EA 4MJSA 3OTOM 1WR6E 4N4ZA 3C3EA 1DGFA 2LRWA 4IUMB 3Q3MC 1VRAB 1NI3A 4F1SA 1FNNA 3U6SA 3FE3A 2MJEA 2I38A 2DOSA 1PDXA 2L00B 1AU4A 2NQDB 1DO2A 2ZANA 3Q8AA 1PJJA 3C8YA 3GP1A 1A5RA 4PADA 3H8HA 4Q8GA 1V33A 2XLJA 3RVWA 2JX5A 1GMYA 3Q3FA 1HQRD 2KN4A 3W0LB 1R4GA 4WWPA 2AQ2B 5H8YE 3FKYA 2BWBA 1GECE 2FQ9A 4JPSA 1MEGA 5JA7A 4OELA 2KFKB 2LEKA 3MC8A 4KLBA 2J53A 1QDTA 2LWPA 4BKSA 4KODA 4WWOA 1U4AA 2MCNB 4YSZB 1E10A 2GB1A 3E56A 3TWLA 4A3VB 3IFWB 4JQWC 1HNZM 3CBJA 1QLBB 3K92A 5FTNA 1PRBA 4W9LA 1IY2A 3FRHA 3SAWA 4IKGA 4PDIA 3U60B 2KXEA 1TS5A 4P6VF 1E8WA 4XDDA 3PNRA 1MS6A 1C76A 2KRUA 3SBJA 3LJ3A 3MK6A 4NJ7A 2JP7A 4G3OA 2QDFA 2REXA 4E3CA 3X23A 1R4NB 4YTMB 3BB7A 1G8PA 4EIWA 4X64M 1R4MI 1JR3A 3FYCA 2EA0A 5LXHA 2WU2B 1VQ1A 3DBRI 1KFUL 1WX9A 3MHHA 1X9YA 5IP4D 3TUOA 4XE0A 2BWFA 1J8CA 1TKGA 1QYRA 2MROB 4MGHA 1WXAA 2O6VD 1I4PA 3B9JA 3IXSA 3OJ4B 1TTEA 1GL7A 1VEKA 4F8CB 3DQVA 4RFBA 1NL6A 5BYRA 3FILB 2QP9X 4IBKA 3W67A 3W1SA 2M0AA 4KIKA 1QOBA 3L29A 3SMSA 5L83A 3ZKJC 1SEBD 1PPDA 3D6SA 1D5XC 1DOXA 3LVWA 1V2YA 2MH8A 1VDLA 1EIJA 1FFUA 1XKGA 4G6ZA 5HI1A 1IUEA 4WJNA 1V97A 1YJJA 1YE9A 1BXTA 4ZTBA 5C23A 4PYUA 5KO3A 4MSQB 5D6JB 4RNAA 4HDOA 1SB3C 2HJ8A 1R4MB 4W9DA 2CP8A 2PPHA 4JIOU 2CHXA 4LNFA 1VDVA 4M01A 3HHMA 2XU4A 3WHLA 3F92A 1YJIA 1AYVA 2LVAA 1XEEA 2IGHA 3GB1A 1ZMVA 1WJ7A 3M7GA 3AI5A 1IN4A 2DWMA 3J27B 3NBXX 4FCVA 1I4WA 3DHGC 3KYCD 2ZVOA 5CX3A 1VZ7A 2XSZA 2KAJA 1JWUD 2R9CA 2C9WB 4JX1C 3PDFA 3GQ5A 4WWMA 3PXGA 2KDFB 2XZFA 2KMMA 2MR9A 3U6DA 3B2GA 3B08A 5GXGB 3QIJA 3U7ZA 1NVMA 3GLGA 1WYGA 2MBQA 3AEGB 2GBJA 1Y56A 1C79A 1L0VB 1D3ZA 2NPTA 3N1YC 3BY4A 1YMHE 1ENFA 4IP3A 2ONQA 1I7HA 4LCBA 2Z8YM 3ZC7B 5KPTA 4W9KA 1N6ZA 3GPUA 1E0ZA 4MH0E 2K6QA 3QAUA 1FNUA 3NUHB 5D94A 3CF2A 1OGWA 4FJZA 2KWCA 1WM3A 2J42A 2EJSA 2JY8A 2OP3A 4I05A 3O0UA 1TDZA 1L2CA 2WXLA 3AE3B 3LQRA 2DAEA 3OQCA 1KYIA 2DX5B 1LM8B 3SAUA 4XGIA 2XN9C 3TEXA 1XT9B 3RGSA 4PCZA 3ZUAA 1FNVA 1L7YA 1YUBA 2KC1A 4JI5M 3IHPC 1FXTB 1MN3A 3PO0A 2CHGA 2DC9A 3W9CB 2JQFR 1UUPA 2NQIA 4ANWA 4J6IA 3NY5A 3QJ3A 2J0KA 2NBVB 2KQ7A 1JWSD 4JGHB 2O2VA 2M0XA 3GPXA 4BVUC 1QDQA 2AUXA 5E6NA 4Q8HA 4AW4A 2BW2A 1PGXA 2AGAA 1T0SC 2B76B 1FCCC 3UI3A 2JTCA 2UWQA 3X0WA 2RMMA 2FE8A 3CSTA 2FCSA 5D2MB 4P1CC 3KOXE 3MTNB 4AQ7A 2INDC 1CQVA 2KANA 4YTNB 3ZLZA 3GP7A 4FADA 1KFYB 2LGYA 5D3IB 4OW0A 2DZKA 5H92C 1HZ5A 3KVFB 1SXJE 2MP2B 4HRSA 2VH2A 2R9MA 2R9FA 4B08A 3BPFA 1JWMD 2F4VM 2L32A 1NDDA 1D5ZC 2LVOA 2YEPF 2LHCA 3C58A 3QWZB 1E8ZA 2WU5B 1UBIA 4L23A 1YIWA 3USVA 4YYRA 5DYGA 3PZ7A 1SJHD 1G41A 1G3IA 2DAJA 3ZNHA 3ZGZA 2N1VA 1P0RA 3K9OB 4FXCA 2DENA 1GABA 1ORYB 4CDEB 1T3TA 2SAKA 1T0YA 1F2AA 4N59A 1X1MA 3SFEB 3AE8B 3P5WA 2DKLA 3PTFC 2VH1A 2XFSA 3K9MA 2NQ8C 1TKYA 1Z6TA 1QILA 2E3TA 3HIZA 3PLUA 4KZ0A 4D82A 1ZCMA 1EU4A 1SXJB 2JY5A 4JWUC 2BJWA 2XH9A 2AS8A 4N79A 1TJEA 4QBBA 2YLMA 2PVGC 2BKRB 4OVZB 2LTUA 1BUIC 4CYEA 1FO4A 2R46A 1MJDA 3Q69A 3DOWA 5D3DA 5BYQA 1NLJA 2XK5A 1HXYD 3KS4A 2Y3AA 4W5CA 5BO4B 3I5JC 2K1FA 4MM3B 2D7EA 1KSFX 1XC8A 2DJGB 3DA1A 3AL0C 3ENEA 5IWAM 1HTQA 1HJPA 3GLHE 2F5NA 1L4DB 2DHYA 3TMPA 2GLSA 2RGFA 4BOPA 2KA6B 4LF6M 5GMVA 2RDHA 3NHEA 3HGIA 3RPFC 5BPVA 4FWDA 7PCKA 2N7JA 3SD5A 4A55A 3AEFB 1NB5A 3I01M 2JA2A 2HJ1A 1SE2A 2F5OA 1I4HA 3LCVB 2WDRB 3T15A 2PE9A 3QARA 4DDID 4YSXB 4K81A 2NBUA 1TLOA 1DV0A 3KKUA 3KW9A 3AE2B 5LNK1 1UKFA 1U5IA 4XUIA 3KVWA 3TEYA 4DV2M 1D5MC 1PIPA 2V3SA 2H5XA 1WF9A 1KLGD 2BYFA 4FBJB 2VQFM 4CHTB 3H89A 4MELA 1S4VA 3O13A 4W4UA 1I35A 5J94A 4D81A 3C0RB 3AM9A 1IBXA 3H4MA 1R6BX 3L28A 3AE6B 5J2RA 3GZNI 4II7A 3A1QB 4R7GA 2IJ0A 1IP9A 4YYVA 5CVNB 2WXMA 1L8QA 1XD3B 4AP4C 5K16A 3RNVA 2ZW1A 4J3OD 4C80A 1R7RA 1XO3A 2GQFA 1OTRA 5PADA 3FTCA 1XLOA 1TS4A 3Q2AC 3K2LA 2M4NA 2XU1A 2B1NA 2K8HA 4FHJA 4HK2A 3ZQ4A 1F2RI 2J7OA 5FSWA 3K9PA 1I94M 1GVNA 1GB4A 2LJ5A 3APFA 1L2BA 2XGNA 2INPE 1QOFA 1K50A 5LXIB 2E01A 1QQRA 1FNWA 2RGOA 1Q02A 3TIXA 5C3JB 4ZDVA 4AG5A 3DBHB 1JRUA 1IM2A 2R2QA 2LUMA 5H37D 2K8CA 1GJSA 1MEMA 5DYIA 2WX0A 3VH3B 2Z3XA 3APDA 2MLBA 3TL5A 3VRAB 1UH6A 3SYLA 2EKIA 5C18A 2QSDA 2B3TA 3TL4X 2W3SA 2E03A 3IOQA 1BVSA 4PT5A 4AS1A 1PPOA 2ZTDA 1Q1OA 2C9OA 1CVZA 2HXZA 4HLEA 4LFAM 2JQGR 3M6AA 1ET6A 1XCTL 1IN5A 1Q0WB 1J5EM 3NVWA 2RDBC 1AECA 3M0EA 5DPSA 1YNTE 2KZUA 2CUZA 4URKA 2UZJA 2DBYA 3NRZA 4BFRA 4Q2JA 3B21A 2UU7A 5FTKA 3GQ3A 4FWHA 1SE3A 3PZDA 1V9JA 2YR0A 1YX5B 1IXSA 4AKIA 4L1BA 2D7HA 1OEYJ 3VR8B 3GS2A 4C7YA 2FTDA 2X8XX 4NRVA 2HWKA 1E8XA 2DI0A 1C7YA 1LQBA 2Z8LA 1QUTA 2JUOA 3N4CA 1G71A 1MJGM 4GUAA 3R8BA 1KJTA 1V1OA 3WANA 2AQ3B 3VDUA 2XZUA 3I51A 2FYEA 3IHPA 2LWXA 4I07A 4EUTA 1PJTA 5LMUM 1GLOA 2R6FA 1FRDA 3B1LX 4DR7M 4GN1A 5EGWA 3VTUA 3GPYA 1WZ3A 4IM0A 3IECA 4B3MM 1E7VA 1C4PA 1HNXM 3CSFA 2MQJA 1QZEA 2JZZA 2FIFA 4IBDA 5IA7A 3THGA 4G3XB 1I4XA 4C00A 1XMQM 2IBIB 4ZOHC 4LNKA 3VH4B 4CQNA 5KPRA 3HM6X 6PADA 2CRUA 1TH2A 3VAWA 1T43A 2KXJA 4FIPA 1IY1A 1F2BA 1OQRA 2RDGA 3RNAC 1GL6A 1I42A 1WIAA 3P5XA 1L5PA 4M9ZA 1P3QQ 3E46A 1WR1A 4I4LA 4GDLA 4QHSA 2KNZA 2DAIA 2W55A 4BOUA 4WJPA 2QENA 3U61B 7CATA 3OVZA 1V92A 1WXQA 4MGIE 3EGRA 1JMLA 3QK0A 4B0EA 3DHHC 4MSXA 1MIRA 4DV7M 3SFZA 1NENB 2QILA 1PGAA 1BMLC 3M63B 5J17A 4TQ0A 2RR9A 3AEEB 1RLFA 2C7NB 3AEDB 3UIPB 4NAMA 4REZA 2VRRB 1UFZA 3K1JA 4GMQA 4FVMA 3EIHA 2YJ8A 2KHHA 4HJGE 3V61A 2CS4A 2GNOA 3ZQJA 2J4XA 4GH9A 3AOGA 4MGYE 4OZCA 2XEPA 4MB7A 2G3QA 1PVJA 2FRAA 4RGMA 4X6IA 4NZLB 4KGRA 1D0LA 4LZZA 2XSZD 4DR2M 4EE2A 3JSVA 5BR8M 1KLUD 1PADA 1DGJA 1SP4B 1QOGA 1Z5BA 2WSCF 3UMMA 3DVNU 5GKNA 2GMIC 3PRPB 1VR9A 1JALA 4RKUF 1Q5WB 2CJNA 5DCNA 4ANUA 4D8EA 1R2ZA 2LGXA 4B7GA 4LJ4A 3KS8A 3I3TA 5DPRA 1E8YA 2DZJA 4LFCM 3EECA 2FCNA 2N0SB 4LJPB 2F5SA 2IY1B 3BVMA 3ERVA 3FD9A 2Y0QA 3HHZA 1L0YB 1LO5D 3HVZA 4DR4M 4Y28F 1S1QB 5TSSA 1WJ4A 3KFUG 5E6PA 4TUWA 1HR0M 2MWSB 1ZMWA 5EXSA 2D07B 4BS6A 2DZYA 2QSFX 4LRTA 4QH6A 1GC7A 4ITKA 4QRXA 4K7SA 1D0KA 1RAXA 4DXFA 1ZAEA 3L13A 4IJEA 1SIFA 5G5HA 3TEWA 1N34M 1GG3A 4L8RC 2R45A 5FLXS 2QHOB 3O65B 2ON8A 1KFVA 2AWTA 2WXJA 1ZP0B 1FXAA 5JH5C 2H89B 4NJ6A 5FTLA 4WQOB 1N75A 2DZZA 1STFE 1YD8U 2QMTA 1ZKHA 4HDQA 1ME3A 3HU3A 1K82A 3SEBA 1WJ6A 1QT9A 4A3PA 3VQIA 2E02A 3FTFA 4ZYNA 3N9YC 1GUAB 1EF5A 1ATKA 2KTRA 3RUIB 3CF0A 4YYWA 3SDLC 4F2LA 4KZCA 3AU4A 4JI6M 1ZUD2 2NMQA 4WJQA 1WGLA 1Q39A 1Q6KA 1SGHA 3N30A 5IAAC 1YQ3B 4IBFA 5AUIA 3V6EA 2CFOA 4GDKA 2XFTA 2P0RA 4WP2A 4YYQA 3DBLB 2DC7A 4W9HA 3ALBA 2EMSA 1R5LA 2RPVA 2DWZB 4DV3M 4JXJA 2MJ5B 2WZJA 3VTVA 1QOLA 3SHFA 3AI8A 3N3KB 3TWMA 3LQQA 4JI0M 1YX6B 4HKQA 2NR2A 2YVCA 3NVVA 2VQEM 2FCMA 2CB5A 3P63A 4PS7A 2LVPC 2BNKA 2L2DA 1N5WA 5EXXA 2KEBA 4HWIB 2JY6B 4B7FA 5ITTA 4YSYB 3FAHA 1K53A 1V6EA 1OIZA 4KSKC 3AE7B 4LNIA 2L0FA 1V1PA 3VFDA 1HUCB 2K9XA 3T1YM 3MHSD 1D2NA 1WWTA 4LGMA 1F77A 2HCBA 3H4JA 4C4VA 5DPWA 1E7UA 4DXAB 2WXPA 4TQ1A 2BBCA 2BS2B 4RGNA 4A20A 3NJTA 3RULA 4KKJA 2CIOA 4DV5M 4HXDB 1DYQA 4N58A 4EFOA 3E21A 1OJLA 2YEPB 1NV8A 4WJOA 3U5ZA 4D80A 2GRIA 5EXTA 3SATA 2PE6B 2KX3A 2GI9A 1KXRA 1SXJC 3V6CA 3U4EG 1NB3A 5ITYA 4LG2A 3A9JB 3U6OA 3R7RA 2VHSA 2N35A 5JZEB 2VF8A 4M0WA 4NSRA 4DUYM 2BB5A 1BY8A 4HJKA 3GLFA 3PSEB 3KLSX 4KV2A 2OOBB 1NY6A 1AUAA 4GKKM 2AU1A 2LHEA 3PRMB 4KVGB 2P7UA 1ZOYB 2KTFA 3RZWC 1CJLA 2K47A 4DR3M 1V81A 2KDIA 1WYWB 2O6VB 4Q7JA 3HJ8A 5EP3A 3GLHA 2V6ZM 4UDUC 4GSWA 4NSOB 2QZ4A 3NZ3A 4PYZA 4PDGA 3ML8A 2E6XA 5T8IA 4IBBA 2DHZA 1WM2A 4XDCA 4HPLB 4WW0A 5G55A 5HFYA 3CTWB 1BP4A 3PT2A 3ZCBB 4JV5M 2R4EA 3OJ3A 4IOIE 1STEA 2V4LA 3W68A 3AFHA 1F1HA 4RM8A 1AU0A 1CPJA 2QC8A 4PS8A 1SXJD 3IEJA 1PBHA 2KZRA 5EZQA 3KSXA 1JROA 2L8JA 3J7AS 2C60A 4IBEA 2LH0A 4LJ8A 3DVGX 4AZFA 4NXNM 1EWYC 2V1UA 2G45B 1ZPSA 2NS5A 2DYMA 1WX8A 1AN8A 2LVQD 5CHWA 3BBAA 5DNYA 2HWJA 2EKEC 3V60A 4B3SM 2ACTA 3NVZA 2KMCA 2Y5BA 3MC9A 4HVBA 1T0QC 4BOZA 3L08A 4H2AA 1Z2MA 4IG7B 1L0XB 3WIMA 3I57A 3HZJA 2LVNC 4OX9M 4FJYA 3H7PB 2K3UA 2G4DB 2WXQA 4QOZC 1QZMA 3C3DA 3MFGA 3TEZA 4YV8A 4ANXA 2MBEA 3U2SC 1UELA 3C9EA 4B0MA 1OFHA 1E9SA 3L17A 2GFOA 3DOAA 3K24A 1VJVA 2M56B 1M94A 3JW0X 1AYWA 1XXHB 2KNVA 4K3BA 2R65A 4BKTA 1ITOA 3URYA 1XLQA 1N77A 2YQZA 4GHAA 3TBLD 2O5RA 1KRHA 2GOWA 3Q8BA 3GPPA 4US8A 3KH0A 3WA0A 2WS3B 4DDGD 4IUMA 1QDRA 4AI6A 1XLPA 4DBGB 4XYCA 4I6LB 4DV6M
chains in the Genus database with same CATH topology
2M60A 2KWDA 3BK1A 2OPFA 1ZDXA 4G4QA 5HG2A 3L25A 2L6OA 5KQ8A 2KRKA 2C96A 3D8LA 3SAVA 3SC3A 2BTWA 4USAA 1AW7A 2MJ3A 2HDEA 4DXGA 3BZDB 3AE5B 3MC0B 4FCWA 1EE8A 2R61A 3T38A 2G9HD 1PYWD 1E32A 3JAMS 4CISA 1HT1E 5EP4A 2R18A 4I81A 3DWMA 3FUVA 1ROEA 4DV4M 2C5RA 4I5SA 1E94E 3PZ8A 1XNRM 3AEAB 3W30A 4JI1M 2WNMA 2I7PA 2ICIA 3KXEC 1C9FA 2WXNA 4DV0M 1T3QA 3PVSA 3EA6A 1PGBA 3A45A 4JI3M 5EE3A 1C4CA 3VR9B 3ZJVA 2H88B 3WCQA 3E4RA 4LF4M 1KH0A 2VZKD 5EP2A 1QQWA 3ZJTA 4MGZE 2OHFA 1JWBD 4LGYA 4WURA 4TMAB 1QVRA 4GRIA 5FK9C 2LJIA 4NAWB 2QBYA 4B3RM 3P4PB 3V05A 2C98A 2YFQA 2KDMA 1ACCA 3IAM1 8CATA 3GLGB 2DWLA 3IAS1 1XNQM 1SE4A 1YZBA 4HKZE 4O1NA 3AKZA 1IBMM 1EWCA 1X37A 4DV1M 4TSSA 4GKJM 1XLNA 3GLIB 4LK0M 5MPOA 1XXGA 2AQ1B 1S3SA 3U6PA 1F2RC 1I4QA 1FJGM 2Y20A 3FTDA 4B3TM 1P7FA 4BOSA 3VDPA 3HRDD 3W31A 4RGTA 3P4SB 3T3NA 2IPKD 2WDQB 1ZXHA 2IGDA 3KQ4A 4ARCA 1J7KA 1XWIA 3P4RB 4AQYM 3DZDA 4LTUA 4IBGA 1IY0A 3GO8A 2L7HA 1KF6B 3AMZA 1D6EC 1K51A 1UWMA 4KLNA 2OEDA 3IT4B 5JI2E 4D2KA 3MTVA 1JCKB 4AKGA 5FR3A 4LJ7A 2D7GA 4FWGA 3GRYA 1DGHB 3HKPA 1VZ8A 1NNUC 2L52A 1Q10A 2PLPA 4DQOC 4KO8A 4P16A 4RH6A 1SF0A 3B9PA 1J7CA 3AEBB 1B9RA 2V0GA 3U6LA 2MEKA 3HJSA 3UZUA 5KPZA 3W0FA 2CE7A 1UNSA 2WDVB 2JXTA 3UK6A 3D8BA 3BK2A 1OFIA 2C9CA 3W5VB 3PHXA 3HJQA 1N5XA 3LYYA 4A9AA 4IJFA 3VKHA 1E6EB 4JWSC 1Z5CA 2LMCA 2G8LA 2Q2EB 3EUB2 3P1MA 1IGCA 5BMGA 1R2YA 1ZQ9A 2Z84A 2YNMD 1G4AE 1TKEA 2AHMA 4LF9M 1K52A 4BBAA 2PTLA 4GHLA 1JWAD 1NSFA 3TQSA 4RKXA 2HL7A 1L4ZB 4IBCA 4N6EB 1DO0A 1N36M 5ITXA 3A98B 2K22A 1PUTA 1SJED 3JR4A 2QJLA 3RFZB 1FMAD 2WXGA 2H1RA 4HROA 4JE3B 4LJ5A 1DOYA 5C1BA 4XWWA 3J7BA 3FKEA 1JR3D 2W82A 3U60A 2J52A 1JW9D 3A46A 4XWTA 2QPAA 4MI7A 3DFZA 2C99A 2EUCA 1HQYE 1OFFA 2KW0A 3L2AA 1P7EA 4HEA1 1QKZA 1L6UA 3FUXA 2PW9A 2QEJC 2N9KA 4ZRPA 3VKGA 1T5XD 3U52E 3FILA 4K0KM 3ZH9B 3FUUA 1VDDA 4NJCA 1FD6A 3UGJA 4IBJA 4FCTA 3BYYB 4LLGM 4JI4M 4G4RA 2MH7A 4RF0A 1NHGC 2V3NA 4R3DA 2DWNA 1MHXA 2R4JA 1IN6A 4S12A 5JXVA 4HL4A 2TSSA 3HU1A 3Q8FA 1GKIA 3WHKA 3BYTB 3AECB 2Z7JA 4MT5A 5EE1A 3KWVA 2WXIA 1IXSB 2PIAA 3KWLA 4LF8M 1AWDA 1TZOA 3SR6A 1MX0A 1QAQA 3ABVB 3QWLA 5IT9S 1K3XA 3CIRB 4KGSA 4GIPA 2HTME 5EE0A 3AV8A 3I4VA 4WQMA 2Y21A 3FTEA 1TH4A 2WP9B 1V8CA 2W54A 3U6MA 3NWLA 1NY5A 4Z6YA 3R9XB 1RFKA 1CJEA 2HKJA 1D4BA 1L1TA 4IBIA 5ITQA 1QOAA 2KQ4X 2WQYB 5C2TB 1L1ZA 4LF5M 2JU6X 3Q8EA 2WXRA 5IZ7D 4DR1M 2XF3A 2INNE 2NTSA 3TPZA 1FXIA 3DWGC 2UUBM 4YT0B 1K3WA 3AE1B 2WXHA 3ILKA 2UUAM 1HEZE 2FNAA 5KQDA 1N61A 1ZDVA 2CV2A 1UM8A 3KSJA 2KACA 3EIEA 4GC5A 2CV1A 1IN8A 3FUTA 4LZJA 1DGGA 3PRPA 5BMHA 3FC4A 4QOSA 1IN7A 1TY0A 3L27A 4AG6A 4A90A 1J7BA 2R62A 3GRUA 4LJAA 3AE4B 1MI0A 1SXJA 3PNYA 4G4NA 4GC9A 2SEBD 3CF6E 4OVZA 1T6BX 4LY6A 1GOZA 3LMMA 2PVOD 1MVKA 1N78A 4RCOA 1Z59A 4M9XA 2WLBA 4I8OA 2JSVX 5AUKA 3O65A 2UUCM 3HVDA 4IDIA 4NRWA 2Z4RA 1VJKA 3L26A 3HWSA 5EE9A 3P4QB 3SYKA 4D8BA 1TS3A 4LF7M 4OHJA 4NL4H 2L1AA 5ITRA 4ZPXA 2WXKA 3V3XA 1L6VA 4A6QA 1QAOA 4L4UA 2NTTA 3MHVC 3K8ZA 1IBXB 3C0RA 1GLNA 1HQCA 1YSYA 5FTMA 5I4DA 1L2DA 2K0PA 3VK8A 4US9A 1MHHE 1YN4A 1SBBB 2WXFA 5E26A 1NYRA 5IREB 2K5PA 2VIIA 1N32M 4KKIA 1Q3CA 1XF5L 3R2IA 2X49A 3HHXA 4QNRA 4MH8A 1PJIA 2JYTA 5EJCA 1FFVA 2CU3A 3Q8XA 1WRIA 2Y0TA 4A5UA 1C77A 1Q3BA 2FBWB 1OQQA 1IBLM 1NNJA 2BB6A 3IG5A 2DLBA 2LHDA 1PM5A 3RE8A 3HHYA 3BVZA 3KOWE 1ESFA 4FD2A 2CHQA 3GLFB 4DR5M 3AJIB 2BT6A 1IXRC 4BOQA 4YXDB 5G5GA 4RGOS 2CEAA 1XCQL 3AOEA 1C1KA 3GLHB 3J80S 4TQ0A 3OWEB 1DKIA 2QCUA 2Y5CA 3NS1A 4ZYSA 2J7QC 4BB9A 4NXMM 2VZKB 1HT2E 2F5QA 1EM7A 2V4IB 5BYSA 1LV7A 3KP0E 1M4VA 4M9SA 2BS3B 1NJFA 1A70A 4CGYB 2CHVA 3AN1A 3SMPA 2LGIA 3GQ4A 3LXFA 4A8XC 5EQTA 4JI8M 4ZHOA 3AOEC 1PFDA 4LJ6A 3JR5A 1ZE3D 2OQ4A 3U6CA 4XBOA 1W5TA 1ET9A 4MGKE 2Y5PA 2P5TA 3BVGA 3U6EA 2JWUA 2PMVA 3U6QA 3R8FA 5JI3E 4GDLB 3RFWA 3MP9A 1FM0D 2BS4B 4X62M 2JZPA 2CV0A 2UXCM 3U61A 1CZPA 1SSNA 1TS2A 4JN6A 3J9CA 3TRKA 2JYEA 1N33M 2ZBKB 3VRBB 2HHHM 4ITQA 2A5YB 3L4PA 2ACZB 1QF6A 2IGGA 5FTJA 1XHBA 4DR6M 1FEHA 1IXZA 1GPXA 1GB1A 5A2QS 4LJ9A 3R2TA 4W5WA 3IFUA 2ZM6M 1H6UA 4PD2A 4G4OA 2JRIA 1UGJA 1RM6C 3HHWA 4GITA 5ITUA 4A55A 3KOYE 4WH4A 1UWXA 2BTWB 1KTKA 2ZAMA 3FYDA 1IQPA 1W5SA 5EP1A 1NVID 3KDSE 3I4YA 3NVYA 2DZOB 5E6JA 2BJVA 2RGHA 1DOIA 4KGTA 3SFDB 5EZSA 4QNMA 2PKOA 4WAFA 4OZBA 1HZ6A 1NHWC 1JQJC 1TGUA 2Q5WD 2I7NA 3W2DA 3AV0A 4B7HA 1E9MA 3A42A 3IG8A 1FIQA 3UJNA 2J7NA 2DYOA 1DGBA 2LFIA 2JQRB 3I9V1 2FFJA 1JRPA 2V3PA 3AE9B 2EELA 3SHGB 4KHPM 4YWGG 1C78A 3HU2A 3ZYYX 4MACA 5BMIA 1SIJA 3RGPA 1CK1A 4C56C 1QAMA 3MHZA 3J81S 1TDHA 1YN3A 3KOZE 3MJ5A 2UXBM 3J2PB 3SARA 4L2YA 1N60A 1QANA 3E9SA 2M5ZA 2DVWB 4C7ZA 1Z5AA 1FRRA 3IT6B 4YHHM 5FKAC 1GAQB 3KP1E 1SXTA 4GDKB 2CJOA 2L09A 5HHDG 2QBYB 2BTEA 4IIWA 1N62A 2EO2A 1I4RA 2FUG1 1E9RA 2UU9M 1RWSA 1NYQA 3PHWA 2BU3A 1YN5A 4WIPA 4FW9A 2X4AA 2G5GX 4D8IA 1MPEA 1V1PB 2F5PA 1NJGA 4JI2M 1TYGB 3BWUD 2XNAC 2X8AA 3GLIA 1HNWM 3BIID 2UXDM 4YY3M 4RF1A 2DHRA 3AH7A 3ZJUA 4QHTA 3T1HM 1RYJA 3SASA 2ZW0A 5D7GA 4JI7M 2DZNB 2L7IA 2MJDA 3PHUA 4ZRQA 3U5ZB 3ETRA 3TSSA 2D5GA 2IDYA 3BOSA 3P42A 3TE6A 4DUZM 5JZEA 4L78A 1E7PB 1J09A 2N9LA 3PNVA 3PSEA 1I4GA 2BYTA 4LRSA 1IBKM 3PRMA 1FCLA 3MP2A 3FUWA 3VK7A 3AB5A 1ZXIA 1NEKB 3Q8CA 1EU3A 3KW6A 4M0DA 1YQ4B 4L16A 1TY2A 1JQ4A 3NBIA 4AKHA 4KX6B 1C4AA 1J7AA 2I2YA 4OU7A 1WSPA 4Z8XA 3HUIA 5LMNM 3TWKA 2LXEA 4BLCA 1MU5A 3LB8C 2V1CA 2LNHC 4ZHPA 1DGHA 1N63A 1AYFA 3CWIA 2L83A 1F0ZA 4YTPB 3VLFB 2QIEB 3B2FA 3GRRA 4X65M 2RKOA 1B1ZA 4XZXA 2FOIC 1WGKA 4OZAA 3T3OA 5F3WA 2WXOA 1XMOM 5EXPA 2KZSA 1HA5A 3PFIA 2AX5A 2M19A 2X38A 2DWQA 3W5UB 2J7QA 2ZAOA 5ITXE 1R7SA 4JYAM 4HLQA 4LFBM 2W3RA 1VLBA 3GRVA 1VZ6A 2DXIA 3LVVA 1TH3A 4L15A 4ARIA 4X66M 2ERCA 1XXHA 4GLSC 1G59A 4NOOB 1IGDA 2E5LM 2Z4SA 2G1EA 3OTOM 1DGFA 1VRAB 1NI3A 1FNNA 3U6SA 2MJEA 2I38A 2DOSA 1PDXA 1DO2A 2ZANA 3Q8AA 1PJJA 3C8YA 3GP1A 3H8HA 2XLJA 2JX5A 1HQRD 2KN4A 3W0LB 2AQ2B 5H8YE 4JPSA 2LEKA 2J53A 4KODA 1E10A 4YSZB 2GB1A 3E56A 3TWLA 4A3VB 1HNZM 1QLBB 3K92A 5FTNA 1IY2A 3SAWA 4IKGA 4PDIA 3U60B 2KXEA 1TS5A 4P6VF 4XDDA 1C76A 2KRUA 3SBJA 3MK6A 3BB7A 4YTMB 1G8PA 4EIWA 4X64M 1JR3A 3FYCA 2EA0A 2WU2B 3TUOA 4XE0A 1TKGA 1QYRA 4MGHA 3IXSA 1I4PA 3B9JA 1GL7A 4RFBA 5BYRA 3FILB 2QP9X 4IBKA 3W1SA 2M0AA 1QOBA 3L29A 3SMSA 1SEBD 1D5XC 1DOXA 3LVWA 1FFUA 4G6ZA 5HI1A 1IUEA 1V97A 1YJJA 1YE9A 1BXTA 4ZTBA 5KO3A 4RNAA 1SB3C 1VDVA 3WHLA 1YJIA 1XEEA 2IGHA 3GB1A 3M7GA 1IN4A 2DWMA 3J27B 4FCVA 1I4WA 1VZ7A 2XSZA 2KAJA 1JWUD 4JX1C 3GQ5A 4WWMA 3PXGA 2XZFA 2KMMA 3U6DA 3B2GA 5GXGB 3U7ZA 1NVMA 3GLGA 1WYGA 3AEGB 1Y56A 1C79A 1L0VB 3BY4A 1YMHE 1ENFA 4IP3A 2ONQA 1I7HA 4LCBA 3ZC7B 5KPTA 3GPUA 1E0ZA 4MH0E 3QAUA 1FNUA 3NUHB 3CF2A 2J42A 1TDZA 1L2CA 2WXLA 3AE3B 3LQRA 3OQCA 1KYIA 3SAUA 4XGIA 2XN9C 3TEXA 3RGSA 4PCZA 1FNVA 1YUBA 4JI5M 3PO0A 2CHGA 3W9CB 1UUPA 1JWSD 3GPXA 4AW4A 2BW2A 1PGXA 2AGAA 2B76B 1FCCC 3UI3A 2JTCA 2RMMA 2FE8A 3KOXE 4AQ7A 1CQVA 4YTNB 3GP7A 1KFYB 5D3IB 4OW0A 5H92C 1HZ5A 1SXJE 4HRSA 4B08A 1JWMD 2F4VM 2L32A 1D5ZC 2YEPF 3C58A 2WU5B 4L23A 5DYGA 3PZ7A 1SJHD 1G41A 1G3IA 3ZNHA 3ZGZA 4FXCA 1ORYB 1T3TA 2SAKA 4N59A 3SFEB 3AE8B 2XFSA 2NQ8C 1TKYA 1Z6TA 1QILA 2E3TA 4D82A 1EU4A 1SXJB 4JWUC 2BJWA 2XH9A 1TJEA 2PVGC 4OVZB 1BUIC 1FO4A 2R46A 3Q69A 5D3DA 5BYQA 1HXYD 3KS4A 2Y3AA 4MM3B 2D7EA 1KSFX 1XC8A 3DA1A 3AL0C 5IWAM 2F5NA 1L4DB 3TMPA 4BOPA 2KA6B 4LF6M 2RDHA 3HGIA 3RPFC 5BPVA 4FWDA 2N7JA 3AEFB 2JA2A 1SE2A 2F5OA 1I4HA 2WDRB 3T15A 4YSXB 3AE2B 5LNK1 1UKFA 3KVWA 3TEYA 4DV2M 1D5MC 1KLGD 2VQFM 4CHTB 3O13A 4D81A 3AM9A 1IBXA 3H4MA 1R6BX 3L28A 3AE6B 4II7A 4R7GA 2IJ0A 2WXMA 1L8QA 3RNVA 2ZW1A 4J3OD 4C80A 1R7RA 1XO3A 3FTCA 1XLOA 1TS4A 3K2LA 3ZQ4A 1F2RI 2J7OA 5FSWA 1I94M 1GVNA 1GB4A 1L2BA 2XGNA 2INPE 1QOFA 1K50A 1QQRA 1FNWA 2RGOA 5C3JB 4AG5A 1IM2A 2LUMA 5H37D 5DYIA 2Z3XA 3VRAB 3SYLA 2EKIA 5C18A 2QSDA 2W3SA 3TL4X 4PT5A 4AS1A 2C9OA 4LFAM 3M6AA 1ET6A 1XCTL 1IN5A 1J5EM 3NVWA 3M0EA 1YNTE 2KZUA 2CUZA 2UZJA 2DBYA 3NRZA 4Q2JA 3B21A 5FTKA 3GQ3A 4FWHA 1SE3A 2YR0A 4AKIA 4L1BA 2D7HA 3VR8B 3GS2A 4C7YA 4NRVA 2HWKA 2Z8LA 4GUAA 3R8BA 1V1OA 2AQ3B 3VDUA 2XZUA 3I51A 2LWXA 5LMUM 1FRDA 4DR7M 3GPYA 4B3MM 1C4PA 1HNXM 4IBDA 3THGA 1I4XA 1XMQM 4ZOHC 4CQNA 5KPRA 1TH2A 1IY1A 1OQRA 2RDGA 1GL6A 1L5PA 4M9ZA 4I4LA 4QHSA 2W55A 4BOUA 2QENA 3U61B 7CATA 1WXQA 4MGIE 3EGRA 1JMLA 4B0EA 4DV7M 3SFZA 1NENB 2QILA 1PGAA 1BMLC 3AEEB 3AEDB 4NAMA 4REZA 3K1JA 4GMQA 4FVMA 3EIHA 4HJGE 2J4XA 4GH9A 3AOGA 4MGYE 4OZCA 2XEPA 4MB7A 1PVJA 4RGMA 4NZLB 4KGRA 4LZZA 2XSZD 4DR2M 4EE2A 5BR8M 1KLUD 1DGJA 1QOGA 1Z5BA 3UMMA 5GKNA 1VR9A 1JALA 2CJNA 4D8EA 1R2ZA 4B7GA 4LJ4A 3KS8A 4LFCM 2N0SB 2F5SA 3BVMA 3FD9A 2Y0QA 3HHZA 1L0YB 1LO5D 3HVZA 4DR4M 5TSSA 3KFUG 4TUWA 1HR0M 5EXSA 4LRTA 4ITKA 4DXFA 1ZAEA 4IJEA 5G5HA 3TEWA 2R45A 1N34M 4L8RC 5FLXS 2ON8A 1KFVA 2WXJA 1ZP0B 1FXAA 2H89B 5FTLA 1N75A 2QMTA 3HU3A 1K82A 3SEBA 1QT9A 3VQIA 3FTFA 3N9YC 3CF0A 4JI6M 1ZUD2 2NMQA 1Q39A 4IBFA 1YQ3B 5AUIA 2CFOA 2XFTA 2RPVA 2DWZB 4DV3M 4JXJA 3SHFA 3TWMA 3LQQA 4JI0M 4HKQA 3NVVA 2VQEM 3P63A 1N5WA 2BNKA 5EXXA 2KEBA 4B7FA 5ITTA 4YSYB 3FAHA 1K53A 3AE7B 1V1PA 3VFDA 2K9XA 3T1YM 1D2NA 1WWTA 4LGMA 1F77A 2HCBA 2WXPA 4TQ1A 2BBCA 2BS2B 4RGNA 4KKJA 4DV5M 4HXDB 1DYQA 4N58A 1OJLA 2YEPB 3U5ZA 4D80A 2GRIA 5EXTA 3SATA 2GI9A 1SXJC 3U4EG 5ITYA 4LG2A 3U6OA 4M0WA 4NSRA 4DUYM 2BB5A 3GLFA 3KLSX 1NY6A 4GKKM 2LHEA 1ZOYB 2K47A 4DR3M 3HJ8A 5EP3A 3GLHA 2V6ZM 4UDUC 4NSOB 2QZ4A 3NZ3A 4PDGA 2E6XA 5T8IA 4IBBA 4XDCA 4WW0A 5HFYA 3CTWB 3PT2A 3ZCBB 4JV5M 2R4EA 4IOIE 1STEA 3AFHA 1SXJD 5EZQA 3KSXA 1JROA 3J7AS 4IBEA 2LH0A 4LJ8A 4AZFA 4NXNM 1EWYC 2V1UA 1ZPSA 2DYMA 1AN8A 3BBAA 5DNYA 4B3SM 3NVZA 4BOZA 4H2AA 1L0XB 3I57A 4OX9M 2K3UA 2WXQA 4QOZC 1QZMA 3MFGA 3TEZA 3U2SC 4B0MA 1OFHA 1E9SA 3DOAA 2M56B 1XXHB 2R65A 3URYA 1XLQA 1N77A 2YQZA 4GHAA 2O5RA 1KRHA 3Q8BA 3GPPA 4US8A 2WS3B 4IUMA 4AI6A 1XLPA 4DV6M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MM3 B;  4RF1 A;  4RF0 A;  4WUR A;  3MJ5 A;  4OVZ A;  4R3D A;  3E9S A;  5KO3 A;  5E6J A;  4P16 A;  4PT5 A;  4RNA A;  3MP2 A;  4OVZ B;  4M0W A;  4REZ A;  2FE8 A;  4OW0 A; 
#chains in the Genus database with same CATH topology
 2M60 A;  2KWD A;  3DBS A;  3BK1 A;  2FCQ A;  4FN2 A;  2OPF A;  1ICF A;  4HWY A;  3H6N A;  4KT0 F;  4RY2 A;  2JWS A;  1ZDX A;  4G4Q A;  5HG2 A;  3L25 A;  3KW5 B;  2L6O A;  1ZGU B;  5KQ8 A;  2KRK A;  2C96 A;  3D8L A;  3WXG A;  2LGD A;  2JRI B;  3SAV A;  4EZK A;  1F29 A;  1P98 A;  3SC3 A;  2BTW A;  2LRU A;  4USA A;  1GJZ A;  4M02 A;  2O01 F;  1AW7 A;  2MJ3 A;  2N9E B;  2HDE A;  3KUC B;  2DC6 A;  4UN2 B;  1R4N I;  2GBM A;  2MW5 A;  4DXG A;  3BZD B;  3AE5 B;  3MC0 B;  4DHZ E;  4FCW A;  1EE8 A;  2R61 A;  3T38 A;  4BBN C;  2VDB B;  2G9H D;  1PYW D;  1C1Y B;  3L10 B;  4IW0 A;  3GLG E;  5EDS A;  2GHU A;  4P6E A;  1E32 A;  3H7S A;  1QUS A;  3JAM S;  4CIS A;  2DCB A;  1HT1 E;  2N4F A;  5JHA A;  4I6P A;  5EP4 A;  2R18 A;  1ZW7 A;  4I81 A;  3DWM A;  1PQS A;  2EKF A;  3FUV A;  1ROE A;  2ZTC A;  3OLM D;  4DV4 M;  1GO5 A;  2C5R A;  4I5S A;  1E94 E;  3PZ8 A;  4AOF A;  5IN7 A;  1XNR M;  3AEA B;  3W30 A;  4JI1 M;  2WNM A;  3S2A A;  2I7P A;  2DAM A;  1P9D U;  2ICI A;  3KXE C;  4BKG A;  2WXN A;  1C9F A;  2OZ2 A;  4DV0 M;  1T3Q A;  3PVS A;  3EA6 A;  1PGB A;  3A45 A;  4JI3 M;  2LVQ A;  1Y8G A;  3M99 A;  5EE3 A;  1C4C A;  1WH3 A;  3VR9 B;  3ZJV A;  2H88 B;  3WCQ A;  2IYD B;  3E4R A;  2HHN A;  4DHZ B;  4LF4 M;  3HX3 A;  2D3C A;  1KH0 A;  2VZK D;  1VG5 A;  5EP2 A;  1OEY A;  1QQW A;  3ZJT A;  4MGZ E;  3OF9 A;  3R66 C;  4OEM A;  9PAP A;  2OHF A;  3B7Q A;  1JWB D;  2GBK A;  5EF4 A;  5AZF A;  1EF7 A;  5CVM A;  4LGY A;  4WUR A;  4TMA B;  1QVR A;  3WAO A;  4GRI A;  2OJW A;  4KSL C;  1T0R C;  5FK9 C;  3O1G A;  1V49 A;  1LGR A;  1ZMU A;  2LJI A;  3CH3 X;  2FNJ B;  4NAW B;  8PCH A;  3T8M A;  3W1S C;  1U9Q X;  2QBY A;  2N9P C;  4B3R M;  4LNO A;  3P4P B;  3KUD B;  3HD3 A;  3V05 A;  4GGQ A;  1OIP A;  2C98 A;  2YFQ A;  4FLH A;  1UBQ A;  3RNG C;  2KDM A;  3AUL A;  3VTW A;  4NPN A;  1ACC A;  3CBK A;  3IAM 1;  8CAT A;  3PHW B;  2CHZ A;  3GLG B;  3QSD A;  2DWL A;  3IAS 1;  3V76 A;  3B7Z A;  1XNQ M;  2WX1 A;  1SE4 A;  3B89 A;  1YZB A;  2ZJD A;  2NPT B;  4HKZ E;  3PVL A;  4JLC A;  3QT4 A;  4O1N A;  3AKZ A;  1IBM M;  4CDC B;  2JZ3 B;  1EWC A;  1X37 A;  3B0A A;  3NOB A;  4DV1 M;  2NQG A;  4TSS A;  4GKJ M;  2YJ2 A;  2KJH B;  1XLN A;  3ZIM A;  3GLI B;  1UZX B;  5AEK B;  4LK0 M;  5MPO A;  1WMH B;  1XXG A;  2LHG A;  2KJ6 A;  2YJ9 A;  3U8E A;  3ECI A;  2AQ1 B;  1S3S A;  3N1Z C;  3U6P A;  1AU3 A;  1F2R C;  1I4Q A;  1FJG M;  2DYB A;  2Y20 A;  3FTD A;  1ZV1 A;  3OAW A;  4B3T M;  1V34 A;  4EOY A;  1P7F A;  4BOS A;  4NQL B;  3VDP A;  3HRD D;  3W31 A;  4RGT A;  3P4S B;  3T3N A;  2IPK D;  1ZXH A;  2WDQ B;  2MBB B;  3TNX A;  2IGD A;  3KQ4 A;  4QAY A;  1UGM A;  1A6R A;  4ARC A;  2AYO A;  1WE6 A;  1GC6 A;  1J7K A;  1XWI A;  2BYE A;  3P4R B;  2AEH A;  4AQY M;  3DZD A;  3ZDT A;  3WAP A;  4LTU A;  2BGF A;  3QAQ A;  4IBG A;  1IY0 A;  1KM7 A;  2C0Y A;  2G8E A;  2KK8 A;  3GO8 A;  3A9K B;  4XK8 F;  2L7H A;  4W9J A;  1KF6 B;  3AMZ A;  1D6E C;  1K51 A;  1UWM A;  2HD5 B;  4KLN A;  2OED A;  1WGH A;  4JL9 A;  3IT4 B;  5JI2 E;  4D2K A;  2MA9 B;  3MTV A;  5F02 A;  1JCK B;  4AKG A;  2KHW B;  3AU5 A;  5FR3 A;  3ZUN A;  3KSE A;  4LJ7 A;  2D7G A;  4FWG A;  2R6N A;  2QNJ A;  3GRY A;  1DGH B;  1F52 A;  2CU1 A;  3HKP A;  4ZRI A;  3WAM A;  1VZ8 A;  1NNU C;  2BVC A;  2L52 A;  4WAA A;  1Q10 A;  2PLP A;  4DQO C;  4KO8 A;  4P16 A;  4RH6 A;  2M17 A;  3UF8 A;  2DZI A;  1SF0 A;  3B9P A;  1J7C A;  4M8M A;  3NZU A;  3AEB B;  2YJB A;  1NBF C;  2JZ0 A;  1B9R A;  2V0G A;  2KT7 A;  2I1K A;  3R3M A;  1OAI A;  3U6L A;  2MEK A;  3HJS A;  3UZU A;  5KPZ A;  3W0F A;  2CE7 A;  1UNS A;  1NQC A;  2WDV B;  1CSB B;  1WGN A;  2JXT A;  3UK6 A;  2BWE S;  2Z0E B;  3D8B A;  5HKH A;  2WSF F;  4K1R B;  2KDB A;  2JZ1 A;  2J7Q B;  3EC8 A;  3OG5 A;  3BK2 A;  4W9C A;  3ZNH B;  1C3T A;  5IOI A;  1H8C A;  1OFI A;  3K9O A;  4F1I A;  2C9C A;  1WRD B;  3W5V B;  2DEN B;  3HJQ A;  1SG9 A;  2BPS A;  2DCD A;  1N5X A;  3PHX A;  3KWZ A;  3LYY A;  4A9A A;  4IJF A;  3VKH A;  1E6E B;  2A4Z A;  1Z5C A;  2LMC A;  4JWS C;  2K0B X;  3V62 A;  1WJU A;  3Q6B A;  2G8L A;  2Q2E B;  3EUB 2;  3P1M A;  2JY7 A;  1P1A A;  1IGC A;  2CWB A;  5BMG A;  3U8Z A;  1R2Y A;  1ZQ9 A;  2Z84 A;  2C5L C;  4MJS B;  2YNM D;  1G4A E;  1TKE A;  2AHM A;  1K52 A;  4LF9 M;  1OAO C;  4ACF A;  1IYF A;  3H6S A;  2LBC A;  4BBA A;  2PTL A;  4GHL A;  1JWA D;  4CHK A;  2XK5 B;  3Q3O C;  4MM3 A;  1NSF A;  3TQS A;  5DPT A;  2DAG A;  4RKX A;  2HL7 A;  1L4Z B;  1WX7 A;  4IBC A;  4N6E B;  5CHV C;  1DO0 A;  1V86 A;  1N36 M;  5ITX A;  4XZ4 A;  1WGR A;  2KWU B;  3A98 B;  2K22 A;  1PUT A;  1O0E A;  1SJE D;  3JR4 A;  2QJL A;  3RFZ B;  1FMA D;  1TTN A;  1IWD A;  2HH5 A;  2KFK A;  1WHC A;  2WXG A;  3ZTD A;  2H1R A;  2XEW A;  4HRO A;  3C9P A;  4JE3 B;  4LJ5 A;  1DOY A;  3BOW A;  2KNA A;  4PP1 A;  5C1B A;  4BBN F;  4XWW A;  3J7B A;  3IG3 A;  2D3A A;  1TF0 B;  3FKE A;  1JR3 D;  4X6H A;  3RI7 C;  4FA6 A;  2W82 A;  3U60 A;  3SU8 X;  2R2O A;  4ANV A;  4W9F A;  1NI2 A;  4PI3 A;  2JVC A;  2J52 A;  1JW9 D;  1MG8 A;  1EO6 A;  1MG4 A;  2R0I A;  1ME4 A;  3A46 A;  1VEJ A;  2PBH A;  4XWT A;  2QPA A;  1KFX L;  1WZ0 A;  3EFU A;  4YL8 A;  3A1Q A;  2H7J A;  3DFZ A;  4MI7 A;  2JRH A;  4I04 A;  4X6J A;  1NO1 A;  5CHV A;  2C99 A;  2EUC A;  2HE7 A;  1HQY E;  1OFF A;  2KW0 A;  3L2A A;  1OTR B;  1P7E A;  2IO2 B;  3QHT A;  4HEA 1;  1QKZ A;  1L6U A;  2DNF A;  3FUX A;  2PW9 A;  2QEJ C;  1WFY A;  2N9K A;  1WY8 A;  1V5T A;  3QQ8 B;  4ZRP A;  3VKG A;  2N1W A;  4K7U A;  1T5X D;  1PE6 A;  3U52 E;  3K9P B;  3FIL A;  1WI0 A;  4K0K M;  1BQI A;  3Q3N C;  1ZIV A;  4FK5 A;  2RD0 A;  4KIK B;  4LNN A;  3NG0 A;  3ZH9 B;  4R71 A;  3FUU A;  1VDD A;  4NJC A;  1YK7 A;  2YJC A;  1FD6 A;  3UGJ A;  1WIV A;  4BQV A;  2LGS A;  3UQA A;  4LJO B;  2LI5 A;  5C1Z A;  4IBJ A;  4FCT A;  3ZRC A;  2FUD A;  3EFC A;  3OF8 A;  3BWK A;  3BYY B;  3NS8 A;  3I04 M;  4LLG M;  1POP A;  4LDT D;  4JI4 M;  2AL3 A;  2KVZ A;  3BCN A;  2V1Y A;  2K6B A;  1SE9 A;  4G4R A;  2MH7 A;  3WAL A;  2ZPN A;  2OUL A;  3RNE C;  4RF0 A;  1NHG C;  2V3N A;  1VEG A;  3LW5 F;  5JH3 A;  4R3D A;  4NNJ B;  2DWN A;  1MHX A;  3N20 C;  4XR7 A;  2R4J A;  1IN6 A;  4S12 A;  4GB9 A;  4ZRK A;  5JXV A;  4AXL A;  4HL4 A;  2TSS A;  2IO1 B;  4RMA A;  3ZXV A;  3HU1 A;  3RVX A;  4OVV A;  3Q8F A;  4EKU A;  2K8B A;  1GKI A;  3WHK A;  3BYT B;  3EHV A;  4ICV A;  3AEC B;  4HCP B;  2Z7J A;  2PJH A;  4MT5 A;  3ZTC A;  5EE1 A;  3KWV A;  2WXI A;  1IXS B;  2PIA A;  3KWL A;  4LF8 M;  2W9N A;  3W1Y A;  1AWD A;  1TZO A;  3SR6 A;  4IWO A;  1MX0 A;  3HHA A;  1QAQ A;  2PEA A;  3ABV B;  4ZRJ A;  1JR3 E;  1YJ1 A;  3QWL A;  3BY4 B;  5AZG A;  5IT9 S;  1K3X A;  3CIR B;  2D10 A;  3N3G A;  1CQD A;  4KGS A;  4EZJ A;  4GIP A;  2HTM E;  4GMV A;  3VHT C;  1AAR A;  5EE0 A;  2P86 A;  1WXM A;  4BKS D;  1MFW A;  5IKC M;  3AV8 A;  4EEW A;  4G50 A;  5J18 A;  1K3B B;  3I4V A;  4GXB A;  4WQM A;  1V5O A;  2OJR A;  2QCZ A;  4S17 A;  2MBO A;  3FRI A;  2Y21 A;  1VCB A;  3FTE A;  1Y4H A;  3F5V A;  3DHI C;  1TH4 A;  2WP9 B;  1V8C A;  1TIF A;  2W54 A;  1NV9 A;  2MHJ A;  4DMY A;  3U6M A;  2KDL A;  1OKS A;  3NWL A;  2B3A A;  1QXP A;  1K8R B;  3H7D A;  3QCA A;  2BWE A;  2UYZ B;  1NY5 A;  2N9X A;  4QRG A;  2BQQ A;  4Z6Y A;  3R9X B;  1RFK A;  2LD9 A;  4HPP A;  1CJE A;  2HKJ A;  1D4B A;  3AXC A;  2KWV B;  3PRZ A;  3DCG A;  1L1T A;  4IBI A;  4ZUX U;  3E1Z B;  3VXW A;  1WR1 B;  1WJN A;  2D3B A;  3DDC B;  5ITQ A;  2O2V B;  1QOA A;  5CVO B;  2KQ4 X;  2WQY B;  5C2T B;  1L1Z A;  1TZ1 A;  4W9I A;  3B79 A;  2RSU A;  4LF5 M;  1AIM A;  3H8B A;  4QRV A;  2LVO C;  2JU6 X;  4II2 B;  1F9J A;  4WA6 A;  3B7N A;  1GCB A;  3MTN A;  3Q8E A;  2FS1 A;  4DHJ D;  2WXR A;  4AXM A;  5IZ7 D;  4DR1 M;  3ML9 A;  2XF3 A;  2INN E;  3M95 A;  4DMX A;  3DPD A;  1YLA A;  2Y6E A;  4K3C A;  2NTS A;  1F2C A;  3KYD D;  1D0M A;  3TPZ A;  3T6P A;  1FXI A;  4E71 A;  3DWG C;  3I63 C;  2WGS A;  2UUB M;  2MP2 A;  2NCN A;  4YT0 B;  1K3W A;  2KMA A;  3LDZ E;  3AE1 B;  2JNH A;  2WXH A;  3ILK A;  3P2B A;  4TUU A;  3I06 A;  2UUA M;  2WDT B;  1HEZ E;  2FNA A;  5KQD A;  1N61 A;  2R9O A;  2G3Q B;  1AU2 A;  1EWL A;  1ZDV A;  2CV2 A;  1UM8 A;  3KSJ A;  2KAC A;  3EIE A;  4GC5 A;  5A24 A;  2CV1 A;  1U9X A;  2K25 A;  1CTE A;  1IN8 A;  2G7Y A;  3FUT A;  4LZJ A;  4BS5 A;  2ARY A;  2AYN A;  1DGG A;  3PRP A;  1WGG A;  1EUV B;  5BMH A;  5TR5 A;  1RU3 A;  3FC4 A;  1MDW A;  4QOS A;  2KD0 A;  4NY0 A;  3BC3 A;  3LXS A;  1RRB A;  1IN7 A;  2RRU A;  3I3T B;  1TY0 A;  3L27 A;  2DZM A;  4F7Z A;  4AG6 A;  4A90 A;  1J7B A;  2R62 A;  4PS3 A;  3GRU A;  4LJA A;  3AE4 B;  1MI0 A;  3P5U A;  2BDZ A;  1SXJ A;  3PNY A;  4G4N A;  1SNK A;  3K8U A;  4MZS A;  4CDF B;  1ISN A;  4GC9 A;  2SEB D;  3VVW B;  3CF6 E;  4OVZ A;  4HEO A;  3QA8 A;  1T6B X;  4LY6 A;  3HY5 A;  1GOZ A;  5FR6 A;  3LMM A;  3JVZ X;  2PVO D;  1MVK A;  1N78 A;  2L0T A;  1Z59 A;  4RCO A;  4M9X A;  2WLB A;  3LCU A;  4I8O A;  2JSV X;  5AUK A;  3RNF C;  1Y08 A;  3O65 A;  2UUC M;  3HVD A;  4IDI A;  1DF0 A;  4BSQ A;  4NRW A;  1U9W A;  2Z4R A;  2KDE B;  1VJK A;  3L26 A;  4W9E A;  3MOR A;  3TMP B;  3HWS A;  1FPY A;  5EE9 A;  3A4S C;  3UGB B;  1HTO A;  3P4Q B;  3WXF A;  4XC2 A;  3NHE B;  2WSE F;  3GCB A;  3SYK A;  4D8B A;  3Q14 C;  1TS3 A;  1KHQ A;  3OVX A;  4LF7 M;  4P6G A;  3ZO5 B;  4OHJ A;  3A4R A;  2DCA A;  5FPW A;  4NL4 H;  3PW3 A;  2K39 A;  2L1A A;  2O25 A;  5ITR A;  1WE7 A;  4ZPX A;  2C7M B;  2WXK A;  2KTR B;  3V3X A;  1L6V A;  3C19 A;  5CHF A;  4CO7 A;  3CGW A;  4A6Q A;  3KWB X;  4N9F 4;  1QAO A;  3L0W B;  1LFD A;  1IPG A;  1PPN A;  4L4U A;  4NQK E;  4X57 B;  1TT5 B;  2NTT A;  3MHV C;  3V6E B;  4GIV A;  3K8Z A;  1IBX B;  3C0R A;  1GLN A;  1HQC A;  3UQB A;  4CZW A;  1YSY A;  1YT7 A;  1RFA A;  5FTM A;  5I4D A;  4E74 A;  1L2D A;  2K0P A;  3VK8 A;  2ZCC A;  4US9 A;  1MHH E;  1YN4 A;  1SBB B;  2KJR A;  2WXF A;  1JB0 F;  1G6J A;  1AIP C;  5E26 A;  3RYT A;  3U30 A;  1NYR A;  1YVB A;  5IRE B;  5L95 C;  2K5P A;  3P5V A;  5KHQ A;  2JXX A;  2VII A;  1N32 M;  4KKI A;  3D32 A;  2OO9 A;  1Q3C A;  1XF5 L;  3R2I A;  1TBE A;  2X49 A;  2JY6 A;  3HHX A;  1J0G A;  4QNR A;  2KKC A;  4MH8 A;  1PJI A;  1YK8 A;  2JXN A;  2JYT A;  3DBH I;  5EJC A;  2XU3 A;  3Q3J A;  1FFV A;  4W5B A;  2CU3 A;  2VHF A;  4CDD B;  5L8R F;  2KLC A;  1H4R A;  3RMK C;  4C4V B;  3KFQ A;  3KUZ A;  1PPP A;  3ZNG C;  3Q8X A;  1WRI A;  4ASW C;  2CR5 A;  2Y0T A;  4A5U A;  1C77 A;  4N8W A;  4HXD A;  2INC C;  1Q3B A;  2FBW B;  1UD7 A;  1EF1 A;  1OQQ A;  2FUH B;  1IBL M;  1NNJ A;  2BB6 A;  3IG5 A;  2DLB A;  2LHD A;  4K7W A;  2JUJ A;  2KVR A;  2PAD A;  2R9N A;  1PM5 A;  3RE8 A;  3GZN B;  3PRE A;  4BPV A;  3HHY A;  3CMM B;  2ZPY A;  3BVZ A;  3HM3 A;  2DAK A;  3KOW E;  4M0W B;  1ESF A;  4FD2 A;  2ZZP B;  2CHQ A;  3RVV A;  3GLF B;  3IMA A;  4DR5 M;  4FUL A;  3AJI B;  2MX2 A;  2LAS A;  2BT6 A;  1IXR C;  4BOQ A;  3OIS A;  2KLG A;  3RD2 A;  4YXD B;  2XBB C;  5G5G A;  3H9D A;  2FRQ A;  2LXC A;  4ANR A;  2CEA A;  4RGO S;  1XCQ L;  3AOE A;  1C1K A;  3GLH B;  3J80 S;  2J0M A;  2N7E A;  2ZNV B;  3OWE B;  4WWN A;  1CB5 A;  1CS8 A;  3ZXR A;  3N1X C;  4HPM B;  2MGW A;  1EWP A;  3APC A;  2L4F A;  1DKI A;  2O6X A;  1TR8 A;  2QCU A;  2Y5C A;  2FT2 A;  3NS1 A;  4ZYS A;  1VSN A;  3VFK A;  3IVF A;  3PT2 B;  3MJW A;  2J7Q C;  4W9G A;  1T6O A;  2FO5 A;  3RZF A;  1XQQ A;  1PXV A;  4BB9 A;  4NXM M;  3DBL I;  1L2N A;  2JF5 A;  2VZK B;  3VUY A;  1PCI A;  2JPH A;  2GBR A;  3DVN V;  1EM7 A;  1HT2 E;  2F5Q A;  5CHT A;  1TGZ B;  2V4I B;  2G4S A;  1LV7 A;  2ZNV C;  3KP0 E;  3PGE A;  5BYS A;  2KQS A;  1M4V A;  2DC8 A;  5LLI A;  4M9S A;  2BS3 B;  1NJF A;  1A70 A;  4CGY B;  1KOT A;  2CHV A;  2XU5 A;  3AN1 A;  1QMY A;  3SMP A;  2EMT A;  4IWQ A;  2LGI A;  3GQ4 A;  3LXF A;  3RNC C;  4A8X C;  3H1U A;  4B6W A;  5EQT A;  4JI8 M;  2WYQ A;  4ZHO A;  5JHB A;  3AOE C;  2DCC A;  1PFD A;  2AL6 A;  2IBI A;  4LJ6 A;  3JR5 A;  1ZE3 D;  2OQ4 A;  3U6C A;  3IBE A;  4IM3 A;  3UIO B;  4XBO A;  1W5T A;  1ET9 A;  4MGK E;  2Y5P A;  2P5T A;  3BVG A;  1YQB A;  3PV1 A;  3VUW A;  1XXH E;  3U6E A;  3R7Q A;  2D11 A;  2JWU A;  2PMV A;  3U6Q A;  3R8F A;  2K6D B;  3H7P A;  3M3J A;  5JI3 E;  4GDL B;  1M6D A;  3RFW A;  3MP9 A;  1FM0 D;  2JT4 B;  2BS4 B;  3QJZ A;  4X62 M;  5IO9 A;  2JZP A;  2CV0 A;  2UXC M;  3U61 A;  2IZV B;  2IO0 B;  2V9H A;  1BGO A;  2E00 A;  1CZP A;  1SSN A;  1TS2 A;  3HWN A;  4JN6 A;  3J9C A;  4KDI C;  3TRK A;  2JYE A;  3H8C A;  1N33 M;  2ZBK B;  1S3S G;  2M8S A;  3VRB B;  2HHH M;  2Z59 B;  4ITQ A;  2A5Y B;  3L4P A;  2ACZ B;  1QF6 A;  1E90 A;  2IGG A;  3KX1 A;  5FTJ A;  1XB2 B;  1XHB A;  4DR6 M;  4YYS A;  1FEH A;  4DBG A;  1Z5S B;  1JQP A;  1IXZ A;  1GPX A;  2FID A;  3ZRF A;  4CIZ A;  2MSE D;  4ICU A;  1GB1 A;  2HAK A;  5A2Q S;  4G0N B;  4LJ9 A;  3R2T A;  2OOA A;  4W5W A;  3IFU A;  3DVG Y;  2LUE A;  2ZM6 M;  1H6U A;  4PD2 A;  4G4O A;  2JRI A;  1WGY A;  1EWM A;  1UGJ A;  1RM6 C;  3HHW A;  4GIT A;  5ITU A;  4MEM A;  3ZVV A;  3KOY E;  3Q8G A;  1J19 A;  5KHO A;  2RPQ A;  4A3O A;  4WH4 A;  1UWX A;  4M8N A;  3MHS A;  3RNB C;  1V80 A;  2BTW B;  1KTK A;  3TCA A;  2MRP A;  2WHI A;  2ZAM A;  3RN9 C;  3FYD A;  3JSV B;  3MMP A;  1IQP A;  2BKF A;  3BIN A;  4MZO A;  4S0R A;  1W5S A;  5EP1 A;  1NVI D;  3KDS E;  4AUQ C;  3I4Y A;  3NVY A;  4BAX A;  3PLV A;  2DZO B;  5E6J A;  2BJV A;  2RGH A;  3PS6 A;  2DAF A;  4K7C A;  1DOI A;  3TJP A;  4KGT A;  2AUZ A;  3SFD B;  3S3R A;  5EZS A;  4QNM A;  2PKO A;  4WAF A;  4OZB A;  1DEU A;  2IO3 B;  1WXV A;  4AJY B;  1HZ6 A;  2K9D A;  2KO3 A;  1NHW C;  1JQJ C;  1TGU A;  1IFY A;  2Q5W D;  4GU2 A;  2I7N A;  4BOS C;  3W2D A;  3GLF E;  3AV0 A;  1BT0 A;  4B7H A;  2FH0 A;  1E9M A;  2NVU I;  3A42 A;  3IG8 A;  1THE A;  1FIQ A;  3BBZ A;  3UJN A;  2J7N A;  2DYO A;  1DGB A;  1NPZ A;  3RCZ A;  2LFI A;  2FAZ A;  4DWF A;  1GJT A;  2JQR B;  3I9V 1;  2FFJ A;  1EWO A;  2QHO A;  1JRP A;  2V3P A;  2I1J A;  2L7R A;  3AE9 B;  2EEL A;  2WWZ A;  3SHG B;  2DNA A;  2D3G A;  3NZS A;  4KHP M;  4YWG G;  3RT3 B;  4YYU A;  1C78 A;  3HU2 A;  4GOC A;  4IWP A;  3HHI A;  3ZYY X;  4FJC A;  4MAC A;  3QC8 B;  4TKN A;  3GLI E;  2KOX A;  5BMI A;  1F4I A;  1SIJ A;  3RGP A;  1CK1 A;  1TL9 A;  3PPA A;  4C56 C;  1QAM A;  3MHZ A;  3J81 S;  1TDH A;  2BF8 B;  2IY0 B;  1YN3 A;  3KOZ E;  3MJ5 A;  4AJW A;  2NBW B;  4L6V 6;  2UXB M;  1Y8R C;  3J2P B;  4P1B C;  3SAR A;  5E6O A;  4L2Y A;  3DF0 A;  2ATO A;  1N60 A;  1QAN A;  3U7D A;  4B95 A;  3T9L A;  2ZVN A;  3E9S A;  2QQ8 A;  1MHW A;  2L05 A;  2M5Z A;  2DVW B;  4C7Z A;  2LVP A;  1Z5A A;  3QYE A;  1FRR A;  3IT6 B;  3SHQ A;  4YHH M;  4LCD E;  4I6N B;  5FKA C;  2BDL A;  1PJS A;  4NC6 A;  1GAQ B;  3KP1 E;  1SXT A;  4GDK B;  4II3 B;  1CV8 A;  5AZH A;  4NAW A;  4IM2 A;  2CJO A;  3L16 A;  2L09 A;  3GE3 C;  3JYU A;  5HHD G;  3CH2 X;  2R44 A;  2QBY B;  2CKH B;  4EZL A;  2BTE A;  4IIW A;  2LXA A;  4PP2 E;  2JWZ A;  3BPM A;  1N62 A;  2EO2 A;  1WXS A;  1I4R A;  4G54 A;  3N3K A;  2FUG 1;  1E9R A;  2UU9 M;  2N7D A;  1RWS A;  2AVW A;  3L54 A;  1UF0 A;  1NYQ A;  3PHW A;  2BU3 A;  2J0J A;  3WXE A;  1YN5 A;  4WIP A;  1YOV B;  1U9V A;  4FW9 A;  2X4A A;  4MSM B;  2DZL A;  2G5G X;  1VD2 A;  2BYV E;  4D8I A;  3B74 A;  1MPE A;  1KHP A;  1V1P B;  1CUK A;  2LZ6 A;  2Z0D B;  2F5P A;  1NJG A;  3ZW3 A;  4JI2 M;  1TYG B;  2MBH A;  2XNA C;  3BWU D;  2X8A A;  3GLI A;  1HNW M;  3BII D;  3QX1 A;  2UXD M;  4YY3 M;  4RF1 A;  2DHR A;  2J5Y A;  1WMH A;  2L76 A;  2KX0 A;  1YAL A;  2PRE A;  3IV2 A;  3AH7 A;  1PJQ A;  3ZJU A;  4QHT A;  3T1H M;  1RYJ A;  3VUX A;  3SAS A;  2AIM A;  3GE8 C;  2ZW0 A;  3ONS A;  5D7G A;  4JI7 M;  2DZN B;  2L7I A;  2MJD A;  1GNU A;  5CTR C;  4ZRQ A;  3PHU A;  3U5Z B;  3LFY A;  2A5U A;  3ETR A;  3TSS A;  1P3Q U;  2D5G A;  3V6C B;  4RM9 A;  3A33 B;  2IDY A;  3BOS A;  1AYU A;  4FHK A;  3A9J A;  2WBF X;  5DFL A;  3P42 A;  3TE6 A;  4DUZ M;  5JZE A;  4L78 A;  1E7P B;  2KYW A;  1J09 A;  2AYO B;  2N9L A;  4G11 A;  3PNV A;  3PSE A;  1I4G A;  2BYT A;  4LRS A;  2OOB A;  1IBK M;  1CMX B;  3ZNZ B;  3PRM A;  1FCL A;  3MP2 A;  3F75 A;  3FUW A;  3VK7 A;  2M1M A;  3AB5 A;  4GEW A;  1NEK B;  1ZXI A;  2O6V A;  3Q8C A;  1EU3 A;  2ZCB A;  3A9K A;  3KW6 A;  1E5W A;  3QYB A;  4M0D A;  1YQ4 B;  4L16 A;  1TY2 A;  1JQ4 A;  3NBI A;  1A5T A;  4AKH A;  3N32 A;  4DHJ B;  4KX6 B;  1C4A A;  3ZNI D;  4PK1 A;  2HD5 A;  1EFU B;  1LXD A;  1J7A A;  4FJV B;  2I2Y A;  4OU7 A;  4XGA B;  1WSP A;  4Z8X A;  4OVU A;  3HUI A;  3S3Q A;  4M00 A;  5LMN M;  3TWK A;  2LXE A;  4BLC A;  1MU5 A;  3M62 B;  3VDZ A;  3LB8 C;  2V1C A;  4XX5 A;  2LNH C;  4P7I A;  4ZHP A;  2VF7 A;  1DGH A;  1N63 A;  3BXW A;  2F7D A;  1AYF A;  4DK5 A;  3CWI A;  2L83 A;  4AWJ A;  3HK0 A;  4YTP B;  3VLF B;  1F0Z A;  2HTH A;  4B9K A;  2QIE B;  2KFJ A;  3B2F A;  3GRR A;  1TU6 A;  3UIN B;  2G8J A;  4X65 M;  5G2N A;  4MDK E;  2RKO A;  1KLV A;  3DBR B;  1B1Z A;  4P17 A;  2ASQ A;  1FH0 A;  4XZX A;  2FOI C;  1WGK A;  4OZA A;  1WGD A;  3T3O A;  5F3W A;  2WXO A;  4KDL B;  2DJF B;  1XMO M;  5EXP A;  4CJ6 A;  2KZS A;  1HA5 A;  2F1G A;  2Y5B B;  3PFI A;  1LTM A;  2AX5 A;  4BOZ B;  2M19 A;  2X38 A;  2DWQ A;  3W5U B;  2J7Q A;  2ZAO A;  1HE8 A;  5ITX E;  1R7S A;  3ZDM C;  2CHW A;  2GBN A;  2ZEQ A;  4JYA M;  4LDT B;  1PGY A;  2APL A;  3PHX B;  2C7H A;  4HLQ A;  4IC7 B;  2D2Q A;  4LFB M;  2NQA A;  2L4E A;  2W3R A;  1VLB A;  3GRV A;  1VZ6 A;  2L3Z A;  4YVA A;  2KN5 A;  2DXI A;  3LVV A;  1TH3 A;  2EKK A;  3GOE A;  2PNS A;  3PBH A;  4L15 A;  4ARI A;  4X66 M;  4HCN B;  4BZA A;  2ERC A;  2KC2 A;  1OQY A;  1XXH A;  2G6D A;  4TV3 A;  2B1M A;  4GLS C;  3IUT A;  1G59 A;  4NOO B;  1IGD A;  2E5L M;  2KNB A;  2Z4S A;  2IPP B;  2G1E A;  4MJS A;  3OTO M;  1WR6 E;  4N4Z A;  3C3E A;  1DGF A;  2LRW A;  4IUM B;  3Q3M C;  1VRA B;  1NI3 A;  4F1S A;  1FNN A;  3U6S A;  3FE3 A;  2MJE A;  2I38 A;  2DOS A;  1PDX A;  2L00 B;  1AU4 A;  2NQD B;  1DO2 A;  2ZAN A;  3Q8A A;  1PJJ A;  3C8Y A;  3GP1 A;  1A5R A;  4PAD A;  3H8H A;  4Q8G A;  1V33 A;  2XLJ A;  3RVW A;  2JX5 A;  1GMY A;  3Q3F A;  1HQR D;  2KN4 A;  3W0L B;  1R4G A;  4WWP A;  2AQ2 B;  5H8Y E;  3FKY A;  2BWB A;  1GEC E;  2FQ9 A;  4JPS A;  1MEG A;  5JA7 A;  4OEL A;  2KFK B;  2LEK A;  3MC8 A;  4KLB A;  2J53 A;  1QDT A;  2LWP A;  4BKS A;  4KOD A;  4WWO A;  1U4A A;  2MCN B;  4YSZ B;  1E10 A;  2GB1 A;  3E56 A;  3TWL A;  4A3V B;  3IFW B;  4JQW C;  1HNZ M;  3CBJ A;  1QLB B;  3K92 A;  5FTN A;  1PRB A;  4W9L A;  1IY2 A;  3FRH A;  3SAW A;  4IKG A;  4PDI A;  3U60 B;  2KXE A;  1TS5 A;  4P6V F;  1E8W A;  4XDD A;  3PNR A;  1MS6 A;  1C76 A;  2KRU A;  3SBJ A;  3LJ3 A;  3MK6 A;  4NJ7 A;  2JP7 A;  4G3O A;  2QDF A;  2REX A;  4E3C A;  3X23 A;  1R4N B;  4YTM B;  3BB7 A;  1G8P A;  4EIW A;  4X64 M;  1R4M I;  1JR3 A;  3FYC A;  2EA0 A;  5LXH A;  2WU2 B;  1VQ1 A;  3DBR I;  1KFU L;  1WX9 A;  3MHH A;  1X9Y A;  5IP4 D;  3TUO A;  4XE0 A;  2BWF A;  1J8C A;  1TKG A;  1QYR A;  2MRO B;  4MGH A;  1WXA A;  2O6V D;  1I4P A;  3B9J A;  3IXS A;  3OJ4 B;  1TTE A;  1GL7 A;  1VEK A;  4F8C B;  3DQV A;  4RFB A;  1NL6 A;  5BYR A;  3FIL B;  2QP9 X;  4IBK A;  3W67 A;  3W1S A;  2M0A A;  4KIK A;  1QOB A;  3L29 A;  3SMS A;  5L83 A;  3ZKJ C;  1SEB D;  1PPD A;  3D6S A;  1D5X C;  1DOX A;  3LVW A;  1V2Y A;  2MH8 A;  1VDL A;  1EIJ A;  1FFU A;  1XKG A;  4G6Z A;  5HI1 A;  1IUE A;  4WJN A;  1V97 A;  1YJJ A;  1YE9 A;  1BXT A;  4ZTB A;  5C23 A;  4PYU A;  5KO3 A;  4MSQ B;  5D6J B;  4RNA A;  4HDO A;  1SB3 C;  2HJ8 A;  1R4M B;  4W9D A;  2CP8 A;  2PPH A;  4JIO U;  2CHX A;  4LNF A;  1VDV A;  4M01 A;  3HHM A;  2XU4 A;  3WHL A;  3F92 A;  1YJI A;  1AYV A;  2LVA A;  1XEE A;  2IGH A;  3GB1 A;  1ZMV A;  1WJ7 A;  3M7G A;  3AI5 A;  1IN4 A;  2DWM A;  3J27 B;  3NBX X;  4FCV A;  1I4W A;  3DHG C;  3KYC D;  2ZVO A;  5CX3 A;  1VZ7 A;  2XSZ A;  2KAJ A;  1JWU D;  2R9C A;  2C9W B;  4JX1 C;  3PDF A;  3GQ5 A;  4WWM A;  3PXG A;  2KDF B;  2XZF A;  2KMM A;  2MR9 A;  3U6D A;  3B2G A;  3B08 A;  5GXG B;  3QIJ A;  3U7Z A;  1NVM A;  3GLG A;  1WYG A;  2MBQ A;  3AEG B;  2GBJ A;  1Y56 A;  1C79 A;  1L0V B;  1D3Z A;  2NPT A;  3N1Y C;  3BY4 A;  1YMH E;  1ENF A;  4IP3 A;  2ONQ A;  1I7H A;  4LCB A;  2Z8Y M;  3ZC7 B;  5KPT A;  4W9K A;  1N6Z A;  3GPU A;  1E0Z A;  4MH0 E;  2K6Q A;  3QAU A;  1FNU A;  3NUH B;  5D94 A;  3CF2 A;  1OGW A;  4FJZ A;  2KWC A;  1WM3 A;  2J42 A;  2EJS A;  2JY8 A;  2OP3 A;  4I05 A;  3O0U A;  1TDZ A;  1L2C A;  2WXL A;  3AE3 B;  3LQR A;  2DAE A;  3OQC A;  1KYI A;  2DX5 B;  1LM8 B;  3SAU A;  4XGI A;  2XN9 C;  3TEX A;  1XT9 B;  3RGS A;  4PCZ A;  3ZUA A;  1FNV A;  1L7Y A;  1YUB A;  2KC1 A;  4JI5 M;  3IHP C;  1FXT B;  1MN3 A;  3PO0 A;  2CHG A;  2DC9 A;  3W9C B;  2JQF R;  1UUP A;  2NQI A;  4ANW A;  4J6I A;  3NY5 A;  3QJ3 A;  2J0K A;  2NBV B;  2KQ7 A;  1JWS D;  4JGH B;  2O2V A;  2M0X A;  3GPX A;  4BVU C;  1QDQ A;  2AUX A;  5E6N A;  4Q8H A;  4AW4 A;  2BW2 A;  1PGX A;  2AGA A;  1T0S C;  2B76 B;  1FCC C;  3UI3 A;  2JTC A;  2UWQ A;  3X0W A;  2RMM A;  2FE8 A;  3CST A;  2FCS A;  5D2M B;  4P1C C;  3KOX E;  3MTN B;  4AQ7 A;  2IND C;  1CQV A;  2KAN A;  4YTN B;  3ZLZ A;  3GP7 A;  4FAD A;  1KFY B;  2LGY A;  5D3I B;  4OW0 A;  2DZK A;  5H92 C;  1HZ5 A;  3KVF B;  1SXJ E;  2MP2 B;  4HRS A;  2VH2 A;  2R9M A;  2R9F A;  4B08 A;  3BPF A;  1JWM D;  2F4V M;  2L32 A;  1NDD A;  1D5Z C;  2LVO A;  2YEP F;  2LHC A;  3C58 A;  3QWZ B;  1E8Z A;  2WU5 B;  1UBI A;  4L23 A;  1YIW A;  3USV A;  4YYR A;  5DYG A;  3PZ7 A;  1SJH D;  1G41 A;  1G3I A;  2DAJ A;  3ZNH A;  3ZGZ A;  2N1V A;  1P0R A;  3K9O B;  4FXC A;  2DEN A;  1GAB A;  1ORY B;  4CDE B;  1T3T A;  2SAK A;  1T0Y A;  1F2A A;  4N59 A;  1X1M A;  3SFE B;  3AE8 B;  3P5W A;  2DKL A;  3PTF C;  2VH1 A;  2XFS A;  3K9M A;  2NQ8 C;  1TKY A;  1Z6T A;  1QIL A;  2E3T A;  3HIZ A;  3PLU A;  4KZ0 A;  4D82 A;  1ZCM A;  1EU4 A;  1SXJ B;  2JY5 A;  4JWU C;  2BJW A;  2XH9 A;  2AS8 A;  4N79 A;  1TJE A;  4QBB A;  2YLM A;  2PVG C;  2BKR B;  4OVZ B;  2LTU A;  1BUI C;  4CYE A;  1FO4 A;  2R46 A;  1MJD A;  3Q69 A;  3DOW A;  5D3D A;  5BYQ A;  1NLJ A;  2XK5 A;  1HXY D;  3KS4 A;  2Y3A A;  4W5C A;  5BO4 B;  3I5J C;  2K1F A;  4MM3 B;  2D7E A;  1KSF X;  1XC8 A;  2DJG B;  3DA1 A;  3AL0 C;  3ENE A;  5IWA M;  1HTQ A;  1HJP A;  3GLH E;  2F5N A;  1L4D B;  2DHY A;  3TMP A;  2GLS A;  2RGF A;  4BOP A;  2KA6 B;  4LF6 M;  5GMV A;  2RDH A;  3NHE A;  3HGI A;  3RPF C;  5BPV A;  4FWD A;  7PCK A;  2N7J A;  3SD5 A;  4A55 A;  3AEF B;  1NB5 A;  3I01 M;  2JA2 A;  2HJ1 A;  1SE2 A;  2F5O A;  1I4H A;  3LCV B;  2WDR B;  3T15 A;  2PE9 A;  3QAR A;  4DDI D;  4YSX B;  4K81 A;  2NBU A;  1TLO A;  1DV0 A;  3KKU A;  3KW9 A;  3AE2 B;  5LNK 1;  1UKF A;  1U5I A;  4XUI A;  3KVW A;  3TEY A;  4DV2 M;  1D5M C;  1PIP A;  2V3S A;  2H5X A;  1WF9 A;  1KLG D;  2BYF A;  4FBJ B;  2VQF M;  4CHT B;  3H89 A;  4MEL A;  1S4V A;  3O13 A;  4W4U A;  1I35 A;  5J94 A;  4D81 A;  3C0R B;  3AM9 A;  1IBX A;  3H4M A;  1R6B X;  3L28 A;  3AE6 B;  5J2R A;  3GZN I;  4II7 A;  3A1Q B;  4R7G A;  2IJ0 A;  1IP9 A;  4YYV A;  5CVN B;  2WXM A;  1L8Q A;  1XD3 B;  4AP4 C;  5K16 A;  3RNV A;  2ZW1 A;  4J3O D;  4C80 A;  1R7R A;  1XO3 A;  2GQF A;  1OTR A;  5PAD A;  3FTC A;  1XLO A;  1TS4 A;  3Q2A C;  3K2L A;  2M4N A;  2XU1 A;  2B1N A;  2K8H A;  4FHJ A;  4HK2 A;  3ZQ4 A;  1F2R I;  2J7O A;  5FSW A;  3K9P A;  1I94 M;  1GVN A;  1GB4 A;  2LJ5 A;  3APF A;  1L2B A;  2XGN A;  2INP E;  1QOF A;  1K50 A;  5LXI B;  2E01 A;  1QQR A;  1FNW A;  2RGO A;  1Q02 A;  3TIX A;  5C3J B;  4ZDV A;  4AG5 A;  3DBH B;  1JRU A;  1IM2 A;  2R2Q A;  2LUM A;  5H37 D;  2K8C A;  1GJS A;  1MEM A;  5DYI A;  2WX0 A;  3VH3 B;  2Z3X A;  3APD A;  2MLB A;  3TL5 A;  3VRA B;  1UH6 A;  3SYL A;  2EKI A;  5C18 A;  2QSD A;  2B3T A;  3TL4 X;  2W3S A;  2E03 A;  3IOQ A;  1BVS A;  4PT5 A;  4AS1 A;  1PPO A;  2ZTD A;  1Q1O A;  2C9O A;  1CVZ A;  2HXZ A;  4HLE A;  4LFA M;  2JQG R;  3M6A A;  1ET6 A;  1XCT L;  1IN5 A;  1Q0W B;  1J5E M;  3NVW A;  2RDB C;  1AEC A;  3M0E A;  5DPS A;  1YNT E;  2KZU A;  2CUZ A;  4URK A;  2UZJ A;  2DBY A;  3NRZ A;  4BFR A;  4Q2J A;  3B21 A;  2UU7 A;  5FTK A;  3GQ3 A;  4FWH A;  1SE3 A;  3PZD A;  1V9J A;  2YR0 A;  1YX5 B;  1IXS A;  4AKI A;  4L1B A;  2D7H A;  1OEY J;  3VR8 B;  3GS2 A;  4C7Y A;  2FTD A;  2X8X X;  4NRV A;  2HWK A;  1E8X A;  2DI0 A;  1C7Y A;  1LQB A;  2Z8L A;  1QUT A;  2JUO A;  3N4C A;  1G71 A;  1MJG M;  4GUA A;  3R8B A;  1KJT A;  1V1O A;  3WAN A;  2AQ3 B;  3VDU A;  2XZU A;  3I51 A;  2FYE A;  3IHP A;  2LWX A;  4I07 A;  4EUT A;  1PJT A;  5LMU M;  1GLO A;  2R6F A;  1FRD A;  3B1L X;  4DR7 M;  4GN1 A;  5EGW A;  3VTU A;  3GPY A;  1WZ3 A;  4IM0 A;  3IEC A;  4B3M M;  1E7V A;  1C4P A;  1HNX M;  3CSF A;  2MQJ A;  1QZE A;  2JZZ A;  2FIF A;  4IBD A;  5IA7 A;  3THG A;  4G3X B;  1I4X A;  4C00 A;  1XMQ M;  2IBI B;  4ZOH C;  4LNK A;  3VH4 B;  4CQN A;  5KPR A;  3HM6 X;  6PAD A;  2CRU A;  1TH2 A;  3VAW A;  1T43 A;  2KXJ A;  4FIP A;  1IY1 A;  1F2B A;  1OQR A;  2RDG A;  3RNA C;  1GL6 A;  1I42 A;  1WIA A;  3P5X A;  1L5P A;  4M9Z A;  1P3Q Q;  3E46 A;  1WR1 A;  4I4L A;  4GDL A;  4QHS A;  2KNZ A;  2DAI A;  2W55 A;  4BOU A;  4WJP A;  2QEN A;  3U61 B;  7CAT A;  3OVZ A;  1V92 A;  1WXQ A;  4MGI E;  3EGR A;  1JML A;  3QK0 A;  4B0E A;  3DHH C;  4MSX A;  1MIR A;  4DV7 M;  3SFZ A;  1NEN B;  2QIL A;  1PGA A;  1BML C;  3M63 B;  5J17 A;  4TQ0 A;  2RR9 A;  3AEE B;  1RLF A;  2C7N B;  3AED B;  3UIP B;  4NAM A;  4REZ A;  2VRR B;  1UFZ A;  3K1J A;  4GMQ A;  4FVM A;  3EIH A;  2YJ8 A;  2KHH A;  4HJG E;  3V61 A;  2CS4 A;  2GNO A;  3ZQJ A;  2J4X A;  4GH9 A;  3AOG A;  4MGY E;  4OZC A;  2XEP A;  4MB7 A;  2G3Q A;  1PVJ A;  2FRA A;  4RGM A;  4X6I A;  4NZL B;  4KGR A;  1D0L A;  4LZZ A;  2XSZ D;  4DR2 M;  4EE2 A;  3JSV A;  5BR8 M;  1KLU D;  1PAD A;  1DGJ A;  1SP4 B;  1QOG A;  1Z5B A;  2WSC F;  3UMM A;  3DVN U;  5GKN A;  2GMI C;  3PRP B;  1VR9 A;  1JAL A;  4RKU F;  1Q5W B;  2CJN A;  5DCN A;  4ANU A;  4D8E A;  1R2Z A;  2LGX A;  4B7G A;  4LJ4 A;  3KS8 A;  3I3T A;  5DPR A;  1E8Y A;  2DZJ A;  4LFC M;  3EEC A;  2FCN A;  2N0S B;  4LJP B;  2F5S A;  2IY1 B;  3BVM A;  3ERV A;  3FD9 A;  2Y0Q A;  3HHZ A;  1L0Y B;  1LO5 D;  3HVZ A;  4DR4 M;  4Y28 F;  1S1Q B;  5TSS A;  1WJ4 A;  3KFU G;  5E6P A;  4TUW A;  1HR0 M;  2MWS B;  1ZMW A;  5EXS A;  2D07 B;  4BS6 A;  2DZY A;  2QSF X;  4LRT A;  4QH6 A;  1GC7 A;  4ITK A;  4QRX A;  4K7S A;  1D0K A;  1RAX A;  4DXF A;  1ZAE A;  3L13 A;  4IJE A;  1SIF A;  5G5H A;  3TEW A;  1N34 M;  1GG3 A;  4L8R C;  2R45 A;  5FLX S;  2QHO B;  3O65 B;  2ON8 A;  1KFV A;  2AWT A;  2WXJ A;  1ZP0 B;  1FXA A;  5JH5 C;  2H89 B;  4NJ6 A;  5FTL A;  4WQO B;  1N75 A;  2DZZ A;  1STF E;  1YD8 U;  2QMT A;  1ZKH A;  4HDQ A;  1ME3 A;  3HU3 A;  1K82 A;  3SEB A;  1WJ6 A;  1QT9 A;  4A3P A;  3VQI A;  2E02 A;  3FTF A;  4ZYN A;  3N9Y C;  1GUA B;  1EF5 A;  1ATK A;  2KTR A;  3RUI B;  3CF0 A;  4YYW A;  3SDL C;  4F2L A;  4KZC A;  3AU4 A;  4JI6 M;  1ZUD 2;  2NMQ A;  4WJQ A;  1WGL A;  1Q39 A;  1Q6K A;  1SGH A;  3N30 A;  5IAA C;  1YQ3 B;  4IBF A;  5AUI A;  3V6E A;  2CFO A;  4GDK A;  2XFT A;  2P0R A;  4WP2 A;  4YYQ A;  3DBL B;  2DC7 A;  4W9H A;  3ALB A;  2EMS A;  1R5L A;  2RPV A;  2DWZ B;  4DV3 M;  4JXJ A;  2MJ5 B;  2WZJ A;  3VTV A;  1QOL A;  3SHF A;  3AI8 A;  3N3K B;  3TWM A;  3LQQ A;  4JI0 M;  1YX6 B;  4HKQ A;  2NR2 A;  2YVC A;  3NVV A;  2VQE M;  2FCM A;  2CB5 A;  3P63 A;  4PS7 A;  2LVP C;  2BNK A;  2L2D A;  1N5W A;  5EXX A;  2KEB A;  4HWI B;  2JY6 B;  4B7F A;  5ITT A;  4YSY B;  3FAH A;  1K53 A;  1V6E A;  1OIZ A;  4KSK C;  3AE7 B;  4LNI A;  2L0F A;  1V1P A;  3VFD A;  1HUC B;  2K9X A;  3T1Y M;  3MHS D;  1D2N A;  1WWT A;  4LGM A;  1F77 A;  2HCB A;  3H4J A;  4C4V A;  5DPW A;  1E7U A;  4DXA B;  2WXP A;  4TQ1 A;  2BBC A;  2BS2 B;  4RGN A;  4A20 A;  3NJT A;  3RUL A;  4KKJ A;  2CIO A;  4DV5 M;  4HXD B;  1DYQ A;  4N58 A;  4EFO A;  3E21 A;  1OJL A;  2YEP B;  1NV8 A;  4WJO A;  3U5Z A;  4D80 A;  2GRI A;  5EXT A;  3SAT A;  2PE6 B;  2KX3 A;  2GI9 A;  1KXR A;  1SXJ C;  3V6C A;  3U4E G;  1NB3 A;  5ITY A;  4LG2 A;  3A9J B;  3U6O A;  3R7R A;  2VHS A;  2N35 A;  5JZE B;  2VF8 A;  4M0W A;  4NSR A;  4DUY M;  2BB5 A;  1BY8 A;  4HJK A;  3GLF A;  3PSE B;  3KLS X;  4KV2 A;  2OOB B;  1NY6 A;  1AUA A;  4GKK M;  2AU1 A;  2LHE A;  3PRM B;  4KVG B;  2P7U A;  1ZOY B;  2KTF A;  3RZW C;  1CJL A;  2K47 A;  4DR3 M;  1V81 A;  2KDI A;  1WYW B;  2O6V B;  4Q7J A;  3HJ8 A;  5EP3 A;  3GLH A;  2V6Z M;  4UDU C;  4GSW A;  4NSO B;  2QZ4 A;  3NZ3 A;  4PYZ A;  4PDG A;  3ML8 A;  2E6X A;  5T8I A;  4IBB A;  2DHZ A;  1WM2 A;  4XDC A;  4HPL B;  4WW0 A;  5G55 A;  5HFY A;  3CTW B;  1BP4 A;  3PT2 A;  3ZCB B;  4JV5 M;  2R4E A;  3OJ3 A;  4IOI E;  1STE A;  2V4L A;  3W68 A;  3AFH A;  1F1H A;  4RM8 A;  1AU0 A;  1CPJ A;  2QC8 A;  4PS8 A;  1SXJ D;  3IEJ A;  1PBH A;  2KZR A;  5EZQ A;  3KSX A;  1JRO A;  2L8J A;  3J7A S;  2C60 A;  4IBE A;  2LH0 A;  4LJ8 A;  3DVG X;  4AZF A;  4NXN M;  1EWY C;  2V1U A;  2G45 B;  1ZPS A;  2NS5 A;  2DYM A;  1WX8 A;  1AN8 A;  2LVQ D;  5CHW A;  3BBA A;  5DNY A;  2HWJ A;  2EKE C;  3V60 A;  4B3S M;  2ACT A;  3NVZ A;  2KMC A;  2Y5B A;  3MC9 A;  4HVB A;  1T0Q C;  4BOZ A;  3L08 A;  4H2A A;  1Z2M A;  4IG7 B;  1L0X B;  3WIM A;  3I57 A;  3HZJ A;  2LVN C;  4OX9 M;  4FJY A;  3H7P B;  2K3U A;  2G4D B;  2WXQ A;  4QOZ C;  1QZM A;  3C3D A;  3MFG A;  3TEZ A;  4YV8 A;  4ANX A;  2MBE A;  3U2S C;  1UEL A;  3C9E A;  4B0M A;  1OFH A;  1E9S A;  3L17 A;  2GFO A;  3DOA A;  3K24 A;  1VJV A;  2M56 B;  1M94 A;  3JW0 X;  1AYW A;  1XXH B;  2KNV A;  4K3B A;  2R65 A;  4BKT A;  1ITO A;  3URY A;  1XLQ A;  1N77 A;  2YQZ A;  4GHA A;  3TBL D;  2O5R A;  1KRH A;  2GOW A;  3Q8B A;  3GPP A;  4US8 A;  3KH0 A;  3WA0 A;  2WS3 B;  4DDG D;  4IUM A;  1QDR A;  4AI6 A;  1XLP A;  4DBG B;  4XYC A;  4I6L B;  4DV6 M; 
#chains in the Genus database with same CATH homology
 2M60 A;  2KWD A;  3BK1 A;  2OPF A;  1ZDX A;  4G4Q A;  5HG2 A;  3L25 A;  2L6O A;  5KQ8 A;  2KRK A;  2C96 A;  3D8L A;  3SAV A;  3SC3 A;  2BTW A;  4USA A;  1AW7 A;  2MJ3 A;  2HDE A;  4DXG A;  3BZD B;  3AE5 B;  3MC0 B;  4FCW A;  1EE8 A;  2R61 A;  3T38 A;  2G9H D;  1PYW D;  1E32 A;  3JAM S;  4CIS A;  1HT1 E;  5EP4 A;  2R18 A;  4I81 A;  3DWM A;  3FUV A;  1ROE A;  4DV4 M;  2C5R A;  4I5S A;  1E94 E;  3PZ8 A;  1XNR M;  3AEA B;  3W30 A;  4JI1 M;  2WNM A;  2I7P A;  2ICI A;  3KXE C;  1C9F A;  2WXN A;  4DV0 M;  1T3Q A;  3PVS A;  3EA6 A;  1PGB A;  3A45 A;  4JI3 M;  5EE3 A;  1C4C A;  3VR9 B;  3ZJV A;  2H88 B;  3WCQ A;  3E4R A;  4LF4 M;  1KH0 A;  2VZK D;  5EP2 A;  1QQW A;  3ZJT A;  4MGZ E;  2OHF A;  1JWB D;  4LGY A;  4WUR A;  4TMA B;  1QVR A;  4GRI A;  5FK9 C;  2LJI A;  4NAW B;  2QBY A;  4B3R M;  3P4P B;  3V05 A;  2C98 A;  2YFQ A;  2KDM A;  1ACC A;  3IAM 1;  8CAT A;  3GLG B;  2DWL A;  3IAS 1;  1XNQ M;  1SE4 A;  1YZB A;  4HKZ E;  4O1N A;  3AKZ A;  1IBM M;  1EWC A;  1X37 A;  4DV1 M;  4TSS A;  4GKJ M;  1XLN A;  3GLI B;  4LK0 M;  5MPO A;  1XXG A;  2AQ1 B;  1S3S A;  3U6P A;  1F2R C;  1I4Q A;  1FJG M;  2Y20 A;  3FTD A;  4B3T M;  1P7F A;  4BOS A;  3VDP A;  3HRD D;  3W31 A;  4RGT A;  3P4S B;  3T3N A;  2IPK D;  2WDQ B;  1ZXH A;  2IGD A;  3KQ4 A;  4ARC A;  1J7K A;  1XWI A;  3P4R B;  4AQY M;  3DZD A;  4LTU A;  4IBG A;  1IY0 A;  3GO8 A;  2L7H A;  1KF6 B;  3AMZ A;  1D6E C;  1K51 A;  1UWM A;  4KLN A;  2OED A;  3IT4 B;  5JI2 E;  4D2K A;  3MTV A;  1JCK B;  4AKG A;  5FR3 A;  4LJ7 A;  2D7G A;  4FWG A;  3GRY A;  1DGH B;  3HKP A;  1VZ8 A;  1NNU C;  2L52 A;  1Q10 A;  2PLP A;  4DQO C;  4KO8 A;  4P16 A;  4RH6 A;  1SF0 A;  3B9P A;  1J7C A;  3AEB B;  1B9R A;  2V0G A;  3U6L A;  2MEK A;  3HJS A;  3UZU A;  5KPZ A;  3W0F A;  2CE7 A;  1UNS A;  2WDV B;  2JXT A;  3UK6 A;  3D8B A;  3BK2 A;  1OFI A;  2C9C A;  3W5V B;  3PHX A;  3HJQ A;  1N5X A;  3LYY A;  4A9A A;  4IJF A;  3VKH A;  1E6E B;  4JWS C;  1Z5C A;  2LMC A;  2G8L A;  2Q2E B;  3EUB 2;  3P1M A;  1IGC A;  5BMG A;  1R2Y A;  1ZQ9 A;  2Z84 A;  2YNM D;  1G4A E;  1TKE A;  2AHM A;  4LF9 M;  1K52 A;  4BBA A;  2PTL A;  4GHL A;  1JWA D;  1NSF A;  3TQS A;  4RKX A;  2HL7 A;  1L4Z B;  4IBC A;  4N6E B;  1DO0 A;  1N36 M;  5ITX A;  3A98 B;  2K22 A;  1PUT A;  1SJE D;  3JR4 A;  2QJL A;  3RFZ B;  1FMA D;  2WXG A;  2H1R A;  4HRO A;  4JE3 B;  4LJ5 A;  1DOY A;  5C1B A;  4XWW A;  3J7B A;  3FKE A;  1JR3 D;  2W82 A;  3U60 A;  2J52 A;  1JW9 D;  3A46 A;  4XWT A;  2QPA A;  4MI7 A;  3DFZ A;  2C99 A;  2EUC A;  1HQY E;  1OFF A;  2KW0 A;  3L2A A;  1P7E A;  4HEA 1;  1QKZ A;  1L6U A;  3FUX A;  2PW9 A;  2QEJ C;  2N9K A;  4ZRP A;  3VKG A;  1T5X D;  3U52 E;  3FIL A;  4K0K M;  3ZH9 B;  3FUU A;  1VDD A;  4NJC A;  1FD6 A;  3UGJ A;  4IBJ A;  4FCT A;  3BYY B;  4LLG M;  4JI4 M;  4G4R A;  2MH7 A;  4RF0 A;  1NHG C;  2V3N A;  4R3D A;  2DWN A;  1MHX A;  2R4J A;  1IN6 A;  4S12 A;  5JXV A;  4HL4 A;  2TSS A;  3HU1 A;  3Q8F A;  1GKI A;  3WHK A;  3BYT B;  3AEC B;  2Z7J A;  4MT5 A;  5EE1 A;  3KWV A;  2WXI A;  1IXS B;  2PIA A;  3KWL A;  4LF8 M;  1AWD A;  1TZO A;  3SR6 A;  1MX0 A;  1QAQ A;  3ABV B;  3QWL A;  5IT9 S;  1K3X A;  3CIR B;  4KGS A;  4GIP A;  2HTM E;  5EE0 A;  3AV8 A;  3I4V A;  4WQM A;  2Y21 A;  3FTE A;  1TH4 A;  2WP9 B;  1V8C A;  2W54 A;  3U6M A;  3NWL A;  1NY5 A;  4Z6Y A;  3R9X B;  1RFK A;  1CJE A;  2HKJ A;  1D4B A;  1L1T A;  4IBI A;  5ITQ A;  1QOA A;  2KQ4 X;  2WQY B;  5C2T B;  1L1Z A;  4LF5 M;  2JU6 X;  3Q8E A;  2WXR A;  5IZ7 D;  4DR1 M;  2XF3 A;  2INN E;  2NTS A;  3TPZ A;  1FXI A;  3DWG C;  2UUB M;  4YT0 B;  1K3W A;  3AE1 B;  2WXH A;  3ILK A;  2UUA M;  1HEZ E;  2FNA A;  5KQD A;  1N61 A;  1ZDV A;  2CV2 A;  1UM8 A;  3KSJ A;  2KAC A;  3EIE A;  4GC5 A;  2CV1 A;  1IN8 A;  3FUT A;  4LZJ A;  1DGG A;  3PRP A;  5BMH A;  3FC4 A;  4QOS A;  1IN7 A;  1TY0 A;  3L27 A;  4AG6 A;  4A90 A;  1J7B A;  2R62 A;  3GRU A;  4LJA A;  3AE4 B;  1MI0 A;  1SXJ A;  3PNY A;  4G4N A;  4GC9 A;  2SEB D;  3CF6 E;  4OVZ A;  1T6B X;  4LY6 A;  1GOZ A;  3LMM A;  2PVO D;  1MVK A;  1N78 A;  4RCO A;  1Z59 A;  4M9X A;  2WLB A;  4I8O A;  2JSV X;  5AUK A;  3O65 A;  2UUC M;  3HVD A;  4IDI A;  4NRW A;  2Z4R A;  1VJK A;  3L26 A;  3HWS A;  5EE9 A;  3P4Q B;  3SYK A;  4D8B A;  1TS3 A;  4LF7 M;  4OHJ A;  4NL4 H;  2L1A A;  5ITR A;  4ZPX A;  2WXK A;  3V3X A;  1L6V A;  4A6Q A;  1QAO A;  4L4U A;  2NTT A;  3MHV C;  3K8Z A;  1IBX B;  3C0R A;  1GLN A;  1HQC A;  1YSY A;  5FTM A;  5I4D A;  1L2D A;  2K0P A;  3VK8 A;  4US9 A;  1MHH E;  1YN4 A;  1SBB B;  2WXF A;  5E26 A;  1NYR A;  5IRE B;  2K5P A;  2VII A;  1N32 M;  4KKI A;  1Q3C A;  1XF5 L;  3R2I A;  2X49 A;  3HHX A;  4QNR A;  4MH8 A;  1PJI A;  2JYT A;  5EJC A;  1FFV A;  2CU3 A;  3Q8X A;  1WRI A;  2Y0T A;  4A5U A;  1C77 A;  1Q3B A;  2FBW B;  1OQQ A;  1IBL M;  1NNJ A;  2BB6 A;  3IG5 A;  2DLB A;  2LHD A;  1PM5 A;  3RE8 A;  3HHY A;  3BVZ A;  3KOW E;  1ESF A;  4FD2 A;  2CHQ A;  3GLF B;  4DR5 M;  3AJI B;  2BT6 A;  1IXR C;  4BOQ A;  4YXD B;  5G5G A;  4RGO S;  2CEA A;  1XCQ L;  3AOE A;  1C1K A;  3GLH B;  3J80 S;  4TQ0 A;  3OWE B;  1DKI A;  2QCU A;  2Y5C A;  3NS1 A;  4ZYS A;  2J7Q C;  4BB9 A;  4NXM M;  2VZK B;  1HT2 E;  2F5Q A;  1EM7 A;  2V4I B;  5BYS A;  1LV7 A;  3KP0 E;  1M4V A;  4M9S A;  2BS3 B;  1NJF A;  1A70 A;  4CGY B;  2CHV A;  3AN1 A;  3SMP A;  2LGI A;  3GQ4 A;  3LXF A;  4A8X C;  5EQT A;  4JI8 M;  4ZHO A;  3AOE C;  1PFD A;  4LJ6 A;  3JR5 A;  1ZE3 D;  2OQ4 A;  3U6C A;  4XBO A;  1W5T A;  1ET9 A;  4MGK E;  2Y5P A;  2P5T A;  3BVG A;  3U6E A;  2JWU A;  2PMV A;  3U6Q A;  3R8F A;  5JI3 E;  4GDL B;  3RFW A;  3MP9 A;  1FM0 D;  2BS4 B;  4X62 M;  2JZP A;  2CV0 A;  2UXC M;  3U61 A;  1CZP A;  1SSN A;  1TS2 A;  4JN6 A;  3J9C A;  3TRK A;  2JYE A;  1N33 M;  2ZBK B;  3VRB B;  2HHH M;  4ITQ A;  2A5Y B;  3L4P A;  2ACZ B;  1QF6 A;  2IGG A;  5FTJ A;  1XHB A;  4DR6 M;  1FEH A;  1IXZ A;  1GPX A;  1GB1 A;  5A2Q S;  4LJ9 A;  3R2T A;  4W5W A;  3IFU A;  2ZM6 M;  1H6U A;  4PD2 A;  4G4O A;  2JRI A;  1UGJ A;  1RM6 C;  3HHW A;  4GIT A;  5ITU A;  4A55 A;  3KOY E;  4WH4 A;  1UWX A;  2BTW B;  1KTK A;  2ZAM A;  3FYD A;  1IQP A;  1W5S A;  5EP1 A;  1NVI D;  3KDS E;  3I4Y A;  3NVY A;  2DZO B;  5E6J A;  2BJV A;  2RGH A;  1DOI A;  4KGT A;  3SFD B;  5EZS A;  4QNM A;  2PKO A;  4WAF A;  4OZB A;  1HZ6 A;  1NHW C;  1JQJ C;  1TGU A;  2Q5W D;  2I7N A;  3W2D A;  3AV0 A;  4B7H A;  1E9M A;  3A42 A;  3IG8 A;  1FIQ A;  3UJN A;  2J7N A;  2DYO A;  1DGB A;  2LFI A;  2JQR B;  3I9V 1;  2FFJ A;  1JRP A;  2V3P A;  3AE9 B;  2EEL A;  3SHG B;  4KHP M;  4YWG G;  1C78 A;  3HU2 A;  3ZYY X;  4MAC A;  5BMI A;  1SIJ A;  3RGP A;  1CK1 A;  4C56 C;  1QAM A;  3MHZ A;  3J81 S;  1TDH A;  1YN3 A;  3KOZ E;  3MJ5 A;  2UXB M;  3J2P B;  3SAR A;  4L2Y A;  1N60 A;  1QAN A;  3E9S A;  2M5Z A;  2DVW B;  4C7Z A;  1Z5A A;  1FRR A;  3IT6 B;  4YHH M;  5FKA C;  1GAQ B;  3KP1 E;  1SXT A;  4GDK B;  2CJO A;  2L09 A;  5HHD G;  2QBY B;  2BTE A;  4IIW A;  1N62 A;  2EO2 A;  1I4R A;  2FUG 1;  1E9R A;  2UU9 M;  1RWS A;  1NYQ A;  3PHW A;  2BU3 A;  1YN5 A;  4WIP A;  4FW9 A;  2X4A A;  2G5G X;  4D8I A;  1MPE A;  1V1P B;  2F5P A;  1NJG A;  4JI2 M;  1TYG B;  3BWU D;  2XNA C;  2X8A A;  3GLI A;  1HNW M;  3BII D;  2UXD M;  4YY3 M;  4RF1 A;  2DHR A;  3AH7 A;  3ZJU A;  4QHT A;  3T1H M;  1RYJ A;  3SAS A;  2ZW0 A;  5D7G A;  4JI7 M;  2DZN B;  2L7I A;  2MJD A;  3PHU A;  4ZRQ A;  3U5Z B;  3ETR A;  3TSS A;  2D5G A;  2IDY A;  3BOS A;  3P42 A;  3TE6 A;  4DUZ M;  5JZE A;  4L78 A;  1E7P B;  1J09 A;  2N9L A;  3PNV A;  3PSE A;  1I4G A;  2BYT A;  4LRS A;  1IBK M;  3PRM A;  1FCL A;  3MP2 A;  3FUW A;  3VK7 A;  3AB5 A;  1ZXI A;  1NEK B;  3Q8C A;  1EU3 A;  3KW6 A;  4M0D A;  1YQ4 B;  4L16 A;  1TY2 A;  1JQ4 A;  3NBI A;  4AKH A;  4KX6 B;  1C4A A;  1J7A A;  2I2Y A;  4OU7 A;  1WSP A;  4Z8X A;  3HUI A;  5LMN M;  3TWK A;  2LXE A;  4BLC A;  1MU5 A;  3LB8 C;  2V1C A;  2LNH C;  4ZHP A;  1DGH A;  1N63 A;  1AYF A;  3CWI A;  2L83 A;  1F0Z A;  4YTP B;  3VLF B;  2QIE B;  3B2F A;  3GRR A;  4X65 M;  2RKO A;  1B1Z A;  4XZX A;  2FOI C;  1WGK A;  4OZA A;  3T3O A;  5F3W A;  2WXO A;  1XMO M;  5EXP A;  2KZS A;  1HA5 A;  3PFI A;  2AX5 A;  2M19 A;  2X38 A;  2DWQ A;  3W5U B;  2J7Q A;  2ZAO A;  5ITX E;  1R7S A;  4JYA M;  4HLQ A;  4LFB M;  2W3R A;  1VLB A;  3GRV A;  1VZ6 A;  2DXI A;  3LVV A;  1TH3 A;  4L15 A;  4ARI A;  4X66 M;  2ERC A;  1XXH A;  4GLS C;  1G59 A;  4NOO B;  1IGD A;  2E5L M;  2Z4S A;  2G1E A;  3OTO M;  1DGF A;  1VRA B;  1NI3 A;  1FNN A;  3U6S A;  2MJE A;  2I38 A;  2DOS A;  1PDX A;  1DO2 A;  2ZAN A;  3Q8A A;  1PJJ A;  3C8Y A;  3GP1 A;  3H8H A;  2XLJ A;  2JX5 A;  1HQR D;  2KN4 A;  3W0L B;  2AQ2 B;  5H8Y E;  4JPS A;  2LEK A;  2J53 A;  4KOD A;  1E10 A;  4YSZ B;  2GB1 A;  3E56 A;  3TWL A;  4A3V B;  1HNZ M;  1QLB B;  3K92 A;  5FTN A;  1IY2 A;  3SAW A;  4IKG A;  4PDI A;  3U60 B;  2KXE A;  1TS5 A;  4P6V F;  4XDD A;  1C76 A;  2KRU A;  3SBJ A;  3MK6 A;  3BB7 A;  4YTM B;  1G8P A;  4EIW A;  4X64 M;  1JR3 A;  3FYC A;  2EA0 A;  2WU2 B;  3TUO A;  4XE0 A;  1TKG A;  1QYR A;  4MGH A;  3IXS A;  1I4P A;  3B9J A;  1GL7 A;  4RFB A;  5BYR A;  3FIL B;  2QP9 X;  4IBK A;  3W1S A;  2M0A A;  1QOB A;  3L29 A;  3SMS A;  1SEB D;  1D5X C;  1DOX A;  3LVW A;  1FFU A;  4G6Z A;  5HI1 A;  1IUE A;  1V97 A;  1YJJ A;  1YE9 A;  1BXT A;  4ZTB A;  5KO3 A;  4RNA A;  1SB3 C;  1VDV A;  3WHL A;  1YJI A;  1XEE A;  2IGH A;  3GB1 A;  3M7G A;  1IN4 A;  2DWM A;  3J27 B;  4FCV A;  1I4W A;  1VZ7 A;  2XSZ A;  2KAJ A;  1JWU D;  4JX1 C;  3GQ5 A;  4WWM A;  3PXG A;  2XZF A;  2KMM A;  3U6D A;  3B2G A;  5GXG B;  3U7Z A;  1NVM A;  3GLG A;  1WYG A;  3AEG B;  1Y56 A;  1C79 A;  1L0V B;  3BY4 A;  1YMH E;  1ENF A;  4IP3 A;  2ONQ A;  1I7H A;  4LCB A;  3ZC7 B;  5KPT A;  3GPU A;  1E0Z A;  4MH0 E;  3QAU A;  1FNU A;  3NUH B;  3CF2 A;  2J42 A;  1TDZ A;  1L2C A;  2WXL A;  3AE3 B;  3LQR A;  3OQC A;  1KYI A;  3SAU A;  4XGI A;  2XN9 C;  3TEX A;  3RGS A;  4PCZ A;  1FNV A;  1YUB A;  4JI5 M;  3PO0 A;  2CHG A;  3W9C B;  1UUP A;  1JWS D;  3GPX A;  4AW4 A;  2BW2 A;  1PGX A;  2AGA A;  2B76 B;  1FCC C;  3UI3 A;  2JTC A;  2RMM A;  2FE8 A;  3KOX E;  4AQ7 A;  1CQV A;  4YTN B;  3GP7 A;  1KFY B;  5D3I B;  4OW0 A;  5H92 C;  1HZ5 A;  1SXJ E;  4HRS A;  4B08 A;  1JWM D;  2F4V M;  2L32 A;  1D5Z C;  2YEP F;  3C58 A;  2WU5 B;  4L23 A;  5DYG A;  3PZ7 A;  1SJH D;  1G41 A;  1G3I A;  3ZNH A;  3ZGZ A;  4FXC A;  1ORY B;  1T3T A;  2SAK A;  4N59 A;  3SFE B;  3AE8 B;  2XFS A;  2NQ8 C;  1TKY A;  1Z6T A;  1QIL A;  2E3T A;  4D82 A;  1EU4 A;  1SXJ B;  4JWU C;  2BJW A;  2XH9 A;  1TJE A;  2PVG C;  4OVZ B;  1BUI C;  1FO4 A;  2R46 A;  3Q69 A;  5D3D A;  5BYQ A;  1HXY D;  3KS4 A;  2Y3A A;  4MM3 B;  2D7E A;  1KSF X;  1XC8 A;  3DA1 A;  3AL0 C;  5IWA M;  2F5N A;  1L4D B;  3TMP A;  4BOP A;  2KA6 B;  4LF6 M;  2RDH A;  3HGI A;  3RPF C;  5BPV A;  4FWD A;  2N7J A;  3AEF B;  2JA2 A;  1SE2 A;  2F5O A;  1I4H A;  2WDR B;  3T15 A;  4YSX B;  3AE2 B;  5LNK 1;  1UKF A;  3KVW A;  3TEY A;  4DV2 M;  1D5M C;  1KLG D;  2VQF M;  4CHT B;  3O13 A;  4D81 A;  3AM9 A;  1IBX A;  3H4M A;  1R6B X;  3L28 A;  3AE6 B;  4II7 A;  4R7G A;  2IJ0 A;  2WXM A;  1L8Q A;  3RNV A;  2ZW1 A;  4J3O D;  4C80 A;  1R7R A;  1XO3 A;  3FTC A;  1XLO A;  1TS4 A;  3K2L A;  3ZQ4 A;  1F2R I;  2J7O A;  5FSW A;  1I94 M;  1GVN A;  1GB4 A;  1L2B A;  2XGN A;  2INP E;  1QOF A;  1K50 A;  1QQR A;  1FNW A;  2RGO A;  5C3J B;  4AG5 A;  1IM2 A;  2LUM A;  5H37 D;  5DYI A;  2Z3X A;  3VRA B;  3SYL A;  2EKI A;  5C18 A;  2QSD A;  2W3S A;  3TL4 X;  4PT5 A;  4AS1 A;  2C9O A;  4LFA M;  3M6A A;  1ET6 A;  1XCT L;  1IN5 A;  1J5E M;  3NVW A;  3M0E A;  1YNT E;  2KZU A;  2CUZ A;  2UZJ A;  2DBY A;  3NRZ A;  4Q2J A;  3B21 A;  5FTK A;  3GQ3 A;  4FWH A;  1SE3 A;  2YR0 A;  4AKI A;  4L1B A;  2D7H A;  3VR8 B;  3GS2 A;  4C7Y A;  4NRV A;  2HWK A;  2Z8L A;  4GUA A;  3R8B A;  1V1O A;  2AQ3 B;  3VDU A;  2XZU A;  3I51 A;  2LWX A;  5LMU M;  1FRD A;  4DR7 M;  3GPY A;  4B3M M;  1C4P A;  1HNX M;  4IBD A;  3THG A;  1I4X A;  1XMQ M;  4ZOH C;  4CQN A;  5KPR A;  1TH2 A;  1IY1 A;  1OQR A;  2RDG A;  1GL6 A;  1L5P A;  4M9Z A;  4I4L A;  4QHS A;  2W55 A;  4BOU A;  2QEN A;  3U61 B;  7CAT A;  1WXQ A;  4MGI E;  3EGR A;  1JML A;  4B0E A;  4DV7 M;  3SFZ A;  1NEN B;  2QIL A;  1PGA A;  1BML C;  3AEE B;  3AED B;  4NAM A;  4REZ A;  3K1J A;  4GMQ A;  4FVM A;  3EIH A;  4HJG E;  2J4X A;  4GH9 A;  3AOG A;  4MGY E;  4OZC A;  2XEP A;  4MB7 A;  1PVJ A;  4RGM A;  4NZL B;  4KGR A;  4LZZ A;  2XSZ D;  4DR2 M;  4EE2 A;  5BR8 M;  1KLU D;  1DGJ A;  1QOG A;  1Z5B A;  3UMM A;  5GKN A;  1VR9 A;  1JAL A;  2CJN A;  4D8E A;  1R2Z A;  4B7G A;  4LJ4 A;  3KS8 A;  4LFC M;  2N0S B;  2F5S A;  3BVM A;  3FD9 A;  2Y0Q A;  3HHZ A;  1L0Y B;  1LO5 D;  3HVZ A;  4DR4 M;  5TSS A;  3KFU G;  4TUW A;  1HR0 M;  5EXS A;  4LRT A;  4ITK A;  4DXF A;  1ZAE A;  4IJE A;  5G5H A;  3TEW A;  2R45 A;  1N34 M;  4L8R C;  5FLX S;  2ON8 A;  1KFV A;  2WXJ A;  1ZP0 B;  1FXA A;  2H89 B;  5FTL A;  1N75 A;  2QMT A;  3HU3 A;  1K82 A;  3SEB A;  1QT9 A;  3VQI A;  3FTF A;  3N9Y C;  3CF0 A;  4JI6 M;  1ZUD 2;  2NMQ A;  1Q39 A;  4IBF A;  1YQ3 B;  5AUI A;  2CFO A;  2XFT A;  2RPV A;  2DWZ B;  4DV3 M;  4JXJ A;  3SHF A;  3TWM A;  3LQQ A;  4JI0 M;  4HKQ A;  3NVV A;  2VQE M;  3P63 A;  1N5W A;  2BNK A;  5EXX A;  2KEB A;  4B7F A;  5ITT A;  4YSY B;  3FAH A;  1K53 A;  3AE7 B;  1V1P A;  3VFD A;  2K9X A;  3T1Y M;  1D2N A;  1WWT A;  4LGM A;  1F77 A;  2HCB A;  2WXP A;  4TQ1 A;  2BBC A;  2BS2 B;  4RGN A;  4KKJ A;  4DV5 M;  4HXD B;  1DYQ A;  4N58 A;  1OJL A;  2YEP B;  3U5Z A;  4D80 A;  2GRI A;  5EXT A;  3SAT A;  2GI9 A;  1SXJ C;  3U4E G;  5ITY A;  4LG2 A;  3U6O A;  4M0W A;  4NSR A;  4DUY M;  2BB5 A;  3GLF A;  3KLS X;  1NY6 A;  4GKK M;  2LHE A;  1ZOY B;  2K47 A;  4DR3 M;  3HJ8 A;  5EP3 A;  3GLH A;  2V6Z M;  4UDU C;  4NSO B;  2QZ4 A;  3NZ3 A;  4PDG A;  2E6X A;  5T8I A;  4IBB A;  4XDC A;  4WW0 A;  5HFY A;  3CTW B;  3PT2 A;  3ZCB B;  4JV5 M;  2R4E A;  4IOI E;  1STE A;  3AFH A;  1SXJ D;  5EZQ A;  3KSX A;  1JRO A;  3J7A S;  4IBE A;  2LH0 A;  4LJ8 A;  4AZF A;  4NXN M;  1EWY C;  2V1U A;  1ZPS A;  2DYM A;  1AN8 A;  3BBA A;  5DNY A;  4B3S M;  3NVZ A;  4BOZ A;  4H2A A;  1L0X B;  3I57 A;  4OX9 M;  2K3U A;  2WXQ A;  4QOZ C;  1QZM A;  3MFG A;  3TEZ A;  3U2S C;  4B0M A;  1OFH A;  1E9S A;  3DOA A;  2M56 B;  1XXH B;  2R65 A;  3URY A;  1XLQ A;  1N77 A;  2YQZ A;  4GHA A;  2O5R A;  1KRH A;  3Q8B A;  3GPP A;  4US8 A;  2WS3 B;  4IUM A;  4AI6 A;  1XLP A;  4DV6 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...