4P16A

Crystal structure of the papain-like protease of middle-east respiratory syndrome coronavirus
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
319
structure length
314
Chain Sequence
QLTIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF1a
publication title Crystal structure of the papain-like protease of MERS coronavirus reveals unusual, potentially druggable active-site features.
pubmed doi rcsb
source organism Human betacoronavirus 2c emc/2012
molecule tags Hydrolase
total genus 84
structure length 314
sequence length 319
ec nomenclature
pdb deposition date 2014-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4p16A02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4p16A01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4p16A03
3MP2A 4M0WA 4WURA 3E9SA 4OVZA 4REZA 4OVZB 2FE8A 4PT5A 4RF1A 5KO3A 4P16A 4RNAA 4R3DA 4MM3B 4RF0A 4OW0A 3MJ5A 5E6JA
chains in the Genus database with same CATH superfamily
5CHVC 3APDA 3GPPA 1TS3A 5EP4A 2B76B 4RCOA 3PO0A 5EP1A 3VKHA 4XC2A 1R4NI 3QYBA 5EXPA 2KZSA 2CJOA 2L1AA 3I5JC 2AX5A 2KMMA 2FNAA 3GLHB 4CQNA 1R4MB 1MJGM 1HTQA 3UK6A 5C2TB 2KZUA 4GHLA 2DAJA 4ICVA 1YALA 4QRGA 4QOSA 1YVBA 4KLBA 2VZKD 3VUYA 4NRVA 3RUIB 4PD2A 2UUAM 1IPGA 3P4QB 3QQ8B 4W9EA 3SFEB 3WXFA 4PP2E 3J7AS 1T43A 2KFKA 1ZIVA 3HVZA 1ZP0B 2MJ3A 3AEEB 1C9FA 2DC9A 1ZMWA 1ITOA 4LNOA 1A5TA 3SHGB 4IWPA 3H7DA 4YYVA 2LUEA 2INDC 5IO9A 1IBMM 3AFHA 3GOEA 3EIEA 2Y6EA 1HA5A 1E7VA 4W5CA 2MROB 1Z6TA 3M0EA 4NNJB 4Q7JA 2C7HA 1K8RB 1HT2E 3MORA 3PHWB 4KV2A 2EUCA 3U60B 2WXJA 1X37A 3P4RB 2LMCA 3A33B 2M0AA 1NYQA 5C3JB 3RGPA 2HCBA 2O6VB 2BW2A 1BVSA 1TH4A 3H7PB 2FFJA 1TY0A 4JI6M 4B3SM 3KXEC 1UNSA 4D80A 4K7WA 4W9LA 5AZFA 3KFUG 1KYIA 1JWSD 2L76A 5BYRA 2IYDB 3Q3NC 4HROA 2KX3A 3TWMA 1C76A 4TQ0A 2DAKA 5J2RA 4WJNA 1TS5A 3AE7B 4W9CA 2DBYA 3J80S 3W67A 3A1QA 2X8AA 3LW5F 1WI0A 1QOFA 2Y5CA 4W9IA 1GJZA 3ZXRA 1IBLM 2UUCM 4M8NA 3W0LB 3T38A 3VK8A 4FHJA 3U30A 2KQ7A 2V4IB 2ZM6M 5KQDA 4BKSA 2RGHA 5EZSA 2R0IA 4YSYB 1YQ4B 3VDPA 1STEA 4CJ6A 2DAEA 4JI5M 2W3SA 3MJWA 2WU5B 2BKFA 2R65A 2MR9A 2MJEA 1SGHA 3P2BA 2NS5A 1M94A 1VZ6A 4AQ7A 3BBZA 4YT0B 4P6EA 5AEKB 4BS6A 2F5QA 4BOQA 2LVAA 3A98B 2J0KA 2AU1A 4LG2A 2AL6A 2LVQD 1YN3A 4BOSC 1KHPA 3DBHI 4IIWA 3NWLA 1C1YB 3K8UA 2KQSA 3TPZA 2WBFX 1F77A 3SR6A 1J5EM 1MN3A 1WMHA 3W0FA 1Z5BA 2J7QB 1WGRA 1OTRB 2DHZA 3PLUA 4ZRKA 3KP1E 3OWEB 5G2NA 1QF6A 2WXNA 2DZYA 4K1RB 3EA6A 2GBJA 4MEMA 5BR8M 2N4FA 4DR4M 2RMMA 1YJIA 5G5GA 1GLNA 1CJEA 4AUQC 3V62A 2QBYB 1LQBA 3CF6E 1ORYB 5FTJA 2F5NA 2LTUA 2NCNA 4W9GA 1HNWM 2MBHA 4BZAA 1WXAA 5EE0A 2L4FA 4MH0E 1TL9A 2XK5A 1WXSA 3K1JA 2ZCBA 2LGXA 1FPYA 4P1CC 3IAS1 2G4DB 2X8XX 2NTSA 2DWQA 4BOUA 5IAAC 3VVWB 1NEKB 1SBBB 1S1QB 1SP4B 4JL9A 4NAWA 2E5LM 3FTDA 4ZHOA 1TF0B 3KOYE 2C7NB 4IJFA 2QZ4A 2KRKA 3TUOA 2IPKD 3USVA 3GRRA 3VAWA 1PPPA 2A4ZA 1PYWD 1SE4A 3CF0A 3V61A 2G8EA 1N62A 2QSDA 2KWVB 2N1VA 4NQKE 2EKEC 1JQPA 2QDFA 1EF1A 1PCIA 2LWXA 5DNYA 4OW0A 3ECIA 2WHIA 3QAUA 1I35A 2BT6A 3RVWA 1JWAD 3ZNHB 2XH9A 4LNFA 2KNAA 1KLUD 3ERVA 4WURA 2HH5A 1TT5B 1NSFA 2KTRA 1RM6C 4EFOA 4G50A 3LYYA 2OOAA 1KRHA 1L4DB 2OOBB 3GP7A 3Q69A 4OX9M 1EIJA 4ICUA 4JI8M 2XGNA 4M8MA 4YWGG 2PLPA 4MM3B 2O6XA 4A6QA 3ZVVA 4NQLB 4UN2B 4L23A 2BYTA 2LVQA 1KFYB 2OJWA 3AE9B 2R44A 4GH9A 3AEDB 1PJJA 1DGBA 2JQGR 3GP1A 1E8XA 1PBHA 2BDZA 1IXRC 4CDDB 4MGKE 3Q8FA 4MACA 3BY4B 3VRBB 2R45A 2DZLA 1UELA 2RGFA 2R18A 1T0QC 1GC6A 4RKUF 1S4VA 3PXGA 3U60A 2WP9B 4X57B 3WA0A 2VHSA 3BOWA 2YFQA 2P0RA 1ZW7A 1UF0A 1TTNA 8CATA 4RM8A 1C7YA 3LXSA 3KW5B 4GB9A 3QHTA 4AQYM 2Y5PA 5FSWA 2LHGA 1DOXA 4ZPXA 1JRUA 3EIHA 3GE3C 4GGQA 3THGA 4HKQA 1QYRA 2G4SA 4JI3M 2O01F 2HHHM 3N3GA 2R9FA 3Q8EA 2PEAA 1VRAB 4GOCA 3U4EG 4DV2M 2ZBKB 4WW0A 1P7FA 4WQOB 2BWBA 5LLIA 2J5YA 4CO7A 3NZSA 4E74A 2FCQA 4GSWA 2LFIA 1MI0A 4HLQA 1PXVA 3LDZE 1N6ZA 5IREB 1YN5A 4USAA 1ZKHA 2C0YA 4WJOA 2L6OA 4MGIE 2JZPA 3TQSA 1POPA 1PGXA 1XT9B 1YQ3B 5EXSA 3N20C 4JE3B 5D3IB 4K81A 3JAMS 1QUSA 1IWDA 1NBFC 1VR9A 4N8WA 5EQTA 1K53A 3MC8A 3AJIB 2KMCA 2AIMA 4PADA 1PADA 4OEMA 4G4RA 5DPTA 3VHTC 1VCBA 2VQFM 3RE8A 1VJKA 1VDVA 1BUIC 3DDCB 4ZHPA 1WJ6A 4JI4M 4IW0A 4JX1C 1JW9D 2GBRA 3UIPB 3N1YC 5C1BA 4DDID 3OG5A 3PNYA 1IN8A 3ALBA 1Q02A 1LO5D 5BO4B 1IGCA 4C80A 1MFWA 2XU4A 1HNXM 1WGLA 1KF6B 2KA6B 1P9DU 3PSEA 2QBYA 1L7YA 2NQDB 5JZEA 4WIPA 1JMLA 1XXHB 1NHWC 2KYWA 4M0DA 2KZRA 4HJGE 1WGYA 4EEWA 2DNAA 3B1LX 5H92C 1D0LA 1AU0A 3NHEB 3HHXA 4IBEA 2E03A 5HKHA 2LGIA 3WAMA 2ZPYA 4CDEB 3R66C 5HI1A 2KHWB 1SB3C 1DGFA 1TH3A 1TJEA 4M9XA 1DYQA 3L26A 1GAQB 2XNAC 2XU5A 3RULA 1TGZB 2NQAA 3BYTB 2GRIA 4AS1A 3W30A 4IBBA 2KDMA 1AYUA 3S3QA 2CU3A 1TR8A 1NY5A 3GE8C 4KIKB 2DJFB 4KKIA 3RNBC 2DJGB 3PZ7A 2LHEA 4DR5M 2L0FA 1K3BB 3HU2A 1E7PB 2ZVNA 1EWCA 2M56B 2DKLA 5DYIA 4JI7M 1L0YB 3M95A 5KPZA 3DHHC 3RN9C 2BDLA 4LDTD 1QDTA 3B79A 3U6OA 5G55A 2L8JA 1PJSA 3RVVA 4TUUA 2L2DA 1LXDA 3WAOA 3SMSA 1EF5A 3RZWC 1D5ZC 2L09A 1IBXA 2VH1A 1YX6B 4ANXA 1OKSA 3PRZA 3B2FA 1E9RA 1TY2A 2DZIA 2K9XA 2CUZA 3VFKA 2XN9C 5BYSA 3LXFA 3EECA 1E0ZA 4FD2A 1Q1OA 1N34M 1SSNA 3UMMA 4ZOHC 2DNFA 3Q3FA 4GXBA 1G71A 2JRIA 1YUBA 4KGRA 3GO8A 1Y08A 1MU5A 3SARA 4S0RA 2UZJA 1KHQA 1YJJA 3BPMA 2I7NA 3K8ZA 1MX0A 4CHTB 3U6QA 1PFDA 3TEWA 1AUAA 2L7HA 4LRTA 1L5PA 2LRWA 4K3BA 1YD8U 4HK2A 2FCMA 3U2SC 3B74A 5EDSA 3ZRFA 4LCBA 4IP3A 1KFXL 3PFIA 3NS8A 5KO3A 3OTOM 1KTKA 4RFBA 5C23A 5KPRA 4FA6A 3U5ZB 3ZNID 2QCUA 1L4ZB 3H8HA 3PNVA 4QNRA 3W1YA 1EWLA 3IXSA 1TDHA 3DFZA 4W9KA 1PUTA 1GO5A 4WWOA 3LQQA 3RNEC 4US8A 3TE6A 4MB7A 3ZW3A 2I1JA 4B7HA 1L6VA 4W9HA 1CB5A 2GFOA 2D3CA 2DCAA 2HL7A 2KXJA 1S3SG 2MQJA 1ZGUB 3MHHA 4HDQA 5AUKA 3AM9A 3GPYA 3OJ4B 4PT5A 4LJPB 1DF0A 1JALA 4EZLA 4I5SA 2HJ8A 4FWHA 2N9XA 3ZQ4A 2Z8YM 3L27A 4LNIA 2K8CA 1F29A 2DLBA 2DYOA 4PS7A 3NBIA 1TH2A 1YMHE 4TKNA 1A6RA 3PT2B 3GLIE 1CUKA 3F92A 3HVDA 3HX3A 2O5RA 3AE5B 3KUZA 2YVCA 2RR9A 4W9DA 5GXGB 2Z0EB 3DBLB 3VR9B 4N6EB 1FJGM 2YJ2A 2NQ8C 1RYJA 1CMXB 1PPNA 2UWQA 4D8BA 2D7HA 3UJNA 1P98A 4G0NB 2C99A 3CTWB 2LJ5A 4YYWA 2DWLA 3FYCA 2LGDA 5DCNA 3MTNA 1QOGA 9PAPA 5CHWA 3B21A 5ITTA 1G3IA 4YTNB 3U6CA 2LZ6A 1I4RA 3BWUD 1IXSB 1PRBA 3QJZA 2N7JA 3DBRB 3ZTDA 2P86A 1V81A 4RGOS 3NHEA 4CISA 3RI7C 1I94M 3N30A 1MEGA 4BSQA 3KSJA 2DZNB 4DV7M 4FADA 4YYRA 4NL4H 3IECA 4M9SA 3HU1A 3IEJA 1VQ1A 5E6JA 2AS8A 1EO6A 4RM9A 3FAHA 1AIMA 2AUXA 4BOPA 3QJ3A 3WALA 2G9HD 2O2VA 1YK8A 1CJLA 2IBIA 2JZ3B 4PCZA 3S3RA 4GUAA 4LFAM 1KLVA 2WDVB 5LNK1 3P4SB 4ZTBA 1Y56A 2KW0A 1UBIA 4DR3M 2WXGA 5T8IA 4J6IA 5J17A 3U61A 4PS8A 4FJYA 3SHQA 4DUZM 3PREA 3D8LA 3GZNB 3JSVB 2AYOB 2Z7JA 2WXOA 4JXJA 2QP9X 1OQQA 3R7RA 3TRKA 4FULA 2ZTCA 1T6BX 4ZRIA 2B1MA 4W5BA 4L8RC 3GS2A 2D2QA 2FIFA 2KN5A 4BVUC 2BQQA 4X66M 3BIID 5BMGA 2NQIA 2ASQA 4LGYA 1GVNA 1SIJA 4L15A 2EMTA 4F7ZA 5IP4D 5JHAA 2ZVOA 3I04M 3L13A 4YTPB 2PE6B 4OZAA 4FXCA 1TU6A 4LJ4A 2BTWB 4XGIA 1V1OA 2J7OA 4IBIA 2XEWA 4HRSA 2KDLA 2R6FA 1UBQA 2APLA 4EIWA 2K8HA 2R9NA 1XEEA 3K24A 2V1YA 4YV8A 3AOEA 3AOEC 3SAVA 2D7EA 3K92A 3GLIA 3T15A 3P5UA 4QBBA 3D8BA 4QAYA 3PV1A 2LI5A 2NVUI 3BPFA 2GBMA 3PZDA 4BPVA 3OVXA 4AZFA 2LHCA 3U5ZA 1NV9A 4WA6A 4NPNA 4LFBM 1XKGA 2SAKA 1SE3A 2ONQA 3P63A 3ZXVA 3D32A 4BKGA 2XBBC 1FFVA 5AZGA 2I2YA 2OP3A 1Q0WB 4XBOA 4RMAA 4GC9A 4B95A 1PGBA 4M9ZA 1QANA 2KWCA 2TSSA 4XE0A 1WM3A 3TL4X 1KOTA 4GDLA 3GCBA 5FK9C 1IN6A 2YLMA 3MC9A 4MDKE 1C78A 4IBJA 1WX8A 3V3XA 5LMUM 2KVZA 1WYWB 2PIAA 1SIFA 2JQRB 2FUG1 3AL0C 3NOBA 3E46A 3KVFB 1OIZA 4L4UA 2N9KA 4S12A 4QH6A 4B08A 2L83A 4AP4C 1XF5L 2R4EA 4G6ZA 1VSNA 3PRMB 3WAPA 2LASA 1UD7A 2KMAA 3HHWA 3KWVA 4I6NB 1MPEA 5D7GA 4PYUA 4GU2A 3PT2A 2CHWA 2LEKA 1AIPC 1QQWA 3RGSA 5ITYA 4CGYB 3T1HM 2DZKA 4MT5A 4LF4M 4P6VF 2GHUA 3K9OB 1P0RA 1NLJA 1V2YA 3V6CA 2VIIA 2BJVA 3IT4B 2K6QA 3BOSA 3Q3OC 1QDQA 1K51A 2ZCCA 1WYGA 5TSSA 1M4VA 1FNVA 2BPSA 2PVGC 2YEPB 3VDZA 2DX5B 1FO4A 3UGBB 4WWNA 1YIWA 4KSLC 3Q8AA 2DWNA 3AE3B 2JPHA 3CBKA 1K52A 2B3TA 2HDEA 3CSTA 4AJYB 2BB6A 1YT7A 2HWJA 2VF8A 2NPTA 2AWTA 4F8CB 4YXDB 3QX1A 1P7EA 2ZJDA 4N4ZA 1PIPA 2EKKA 3L4PA 2L4EA 1PPOA 2UXCM 4Q8GA 3KKUA 2LWPA 1GKIA 3UQBA 3R3MA 1ZCMA 4DR7M 1AYFA 2LD9A 3TBLD 2CV2A 2WXIA 2KO3A 5D94A 2WXKA 4MGZE 2B3AA 2DCCA 2JF5A 4QOZC 2KWDA 3LMMA 4YYQA 3P5XA 2HD5B 3AU5A 4LK0M 4NZLB 2DZMA 3CBJA 4FBJB 4A8XC 3MK6A 1NI3A 1NV8A 2D11A 3ILKA 2JUJA 3KSXA 3C19A 3RFZB 3T3NA 1N5XA 3U6PA 2DYBA 2LVOA 4DBGB 1FNWA 3O65B 1LGRA 2G45B 2MLBA 1RFKA 3FKEA 3GLHE 5ITQA 4I4LA 1E9MA 3UINB 3O0UA 1KXRA 2FIDA 2C96A 2G5GX 1WXVA 3V6EA 4IC7B 2IGHA 2RGOA 2XFTA 4FHKA 1ZOYB 3U8ZA 1DEUA 1XNQM 3RNVA 1FEHA 4D8IA 3AB5A 4BLCA 2ZNVC 2FRAA 2KDIA 3TWKA 2GBKA 2LHDA 4DDGD 3DA1A 2AYOA 4ZDVA 3WXGA 1IY2A 4DUYM 2N7EA 2KK8A 1OEYA 2YR0A 4MELA 4QRVA 4GIVA 2E02A 2INNE 3ZRCA 1PDXA 4DHJB 3PHXA 4X6IA 1HZ6A 4ACFA 4C7YA 2EKIA 4K3CA 3VH4B 4DQOC 3RNGC 2WDQB 3VTWA 2DZOB 1EM7A 4B7GA 3Q8CA 1QT9A 4KZ0A 1FXAA 2OHFA 4DR6M 1J0GA 1HQCA 2KJRA 3O13A 3R8FA 2BTWA 1C1KA 3LB8C 1QDRA 4DR2M 4CYEA 3B7ZA 3AEAB 5KHOA 1NO1A 5CVOB 4HXDB 3PZ8A 3H4MA 4YSZB 4GIPA 1OFIA 3KUDB 2KRUA 2HXZA 1TKYA 4B0MA 2W9NA 3QCAA 3SYKA 1GNUA 1SJHD 1C4PA 2O6VD 3VTVA 1EWYC 2MEKA 3H8CA 3W5UB 3C0RB 5EE3A 2R9OA 4YL8A 2Z4RA 4XDDA 2FOIC 3JW0X 4NSRA 1WGHA 2MX2A 3C3DA 3R9XB 4A5UA 3FTEA 4Z6YA 4RGNA 2WXLA 3X0WA 3GPXA 3M63B 3A9JB 3FUXA 3F75A 5EF4A 3H7SA 4RKXA 4DV4M 4P7IA 1XCQL 3BXWA 1R4NB 4NSOB 3DQVA 3R7QA 1N5WA 1I4GA 3HM3A 3M6AA 2N1WA 1MHWA 1AWDA 4G3OA 2F5SA 3C9PA 4B3TM 2WXMA 4K7SA 4FIPA 3WANA 1EU3A 4B0EA 2Y5BB 1WHCA 3CSFA 2JVCA 1NNUC 1IQPA 3Q8BA 3HY5A 4RH6A 4ZRPA 2UXBM 3HRDD 4C7ZA 1B1ZA 3N1ZC 4IDIA 4N79A 4JI2M 1FNUA 3TEZA 2KNZA 4GKKM 3ONSA 3J81S 4I05A 2KJHB 4XK8F 2KVRA 2X38A 3HK0A 2HTHA 3GLHA 4JWUC 4L16A 2K0PA 2WZJA 3HWNA 1SE2A 2N9LA 4FN2A 3KWLA 1NI2A 3CWIA 5BYQA 1VZ7A 3U52E 1E32A 2WXFA 1UM8A 2DAGA 4EUTA 1KH0A 4HPMB 3K9PB 1NENB 1V6EA 4KSKC 1V80A 1XB2B 3BVZA 1N36M 2AGAA 3HHYA 1SJED 3N1XC 4ANRA 1CVZA 4IM3A 3DZDA 2AQ2B 3I4YA 1L2DA 1HXYD 2UU9M 4ZRQA 2K8BA 1I4PA 1ISNA 1JB0F 4DMYA 3FC4A 1GJTA 4EZKA 1NDDA 2DXIA 4TUWA 2RDHA 2RD0A 3ZTCA 1L2NA 3KWBX 4S17A 2H89B 3TL5A 2FNJB 3PHWA 3KW9A 3B9JA 1L6UA 4MSMB 1MIRA 2O6VA 3H7PA 1WJNA 4DBGA 3KDSE 7CATA 2F5PA 3I4VA 3O65A 1OGWA 4G11A 4MJSB 1AARA 1CSBB 4W9JA 3AULA 3QK0A 4FVMA 2DAFA 4BKTA 1Y8RC 3B7NA 1BXTA 3HD3A 5IKCM 4IBFA 4HCNB 2IO2B 2PPHA 3KOWE 3B0AA 2CFOA 2ZANA 1YX5B 1YNTE 2M17A 3F5VA 4RNAA 3I01M 5C18A 2K3UA 4P17A 3DF0A 4FCTA 2WDRB 3DBHB 1N63A 4KO8A 3BBAA 1V5OA 4TSSA 3UIOB 3WIMA 1C77A 1CTEA 2JWUA 2IJ0A 1D0MA 3SYLA 2WX0A 2Z8LA 2Q5WD 2D3AA 3UI3A 2LBCA 2WSCF 1R7RA 3MHSD 1HQYE 2V3PA 2WGSA 3OLMD 3DWGC 2KN4A 4W5WA 5L83A 1BQIA 2L7RA 4JGHB 1PM5A 5CHFA 4BBAA 3ZGZA 1TKGA 5IWAM 3M99A 4H2AA 1E90A 3AU4A 2MRPA 1HEZE 2HKJA 1PE6A 3BC3A 3FILB 3W31A 2UUBM 2MH7A 4HDOA 1YJ1A 2EO2A 1P3QU 1Z5SB 3BINA 4AOFA 2J7QA 1GC7A 2J7QC 1OTRA 3GRYA 1UZXB 3QSDA 3PW3A 3A45A 5E6PA 4HPLB 2OULA 1PGAA 3ZDMC 1W5SA 4F1IA 4KKJA 1ET6A 5E6NA 1V8CA 4DWFA 1F2BA 3FKYA 2XU1A 3OISA 1SG9A 3GQ5A 4YSXB 4BQVA 3C0RA 2JXNA 2M0XA 2LUMA 1VEKA 5H8YE 1WM2A 2LVPA 4LJAA 3I3TB 2LVPC 1U9XA 3OVZA 4GC5A 4HCPB 3BYYB 1F2AA 4A9AA 2CV0A 1YE9A 5CVNB 4KZCA 1KSFX 4WQMA 2G3QB 3AI8A 3VUXA 3A9JA 3FUTA 2ACZB 4I07A 4A90A 2HTME 2XF3A 3A4RA 2J53A 1WRIA 2RSUA 3MHVC 1IP9A 1OQYA 2K1FA 2IDYA 1N61A 4EKUA 3ABVB 3RFWA 3VLFB 4CDFB 3RVXA 2ZAMA 2Y5BA 2E6XA 3T3OA 3PVLA 4LF5M 1IXZA 1EUVB 1E8ZA 3IG3A 3AE1B 1NHGC 3ZNHA 2Q2EB 3U7DA 4II7A 1YN4A 1NJGA 1XXHE 1R2ZA 1DGJA 1C4CA 2PW9A 1R5LA 1LFDA 4IBDA 4JQWC 1WX9A 4D81A 2IO0B 2WNMA 2DAIA 1VEGA 3OAWA 5FTNA 2OOBA 1R7SA 1V49A 4IUMB 2J52A 1CK1A 1K3XA 2KWUB 3ZDTA 3P42A 2JP7A 2FH0A 4MM3A 1JQ4A 3MHSA 4ARIA 1QLBB 3ZJVA 1XLPA 4HLEA 2KHHA 2INPE 3ZLZA 1I42A 1AW7A 2VF7A 1H8CA 4GN1A 1L2CA 1FCCC 3DVNU 1MEMA 2FCSA 4QHSA 3ZQJA 3M62B 1JROA 3ZC7B 1XHBA 4HKZE 4LRSA 2DYMA 2I1KA 5EE9A 2IGDA 1Z59A 2UYZB 2IZVB 1XXGA 2KAJA 4LTUA 3IHPA 3HIZA 4XWTA 3VKGA 1SEBD 2FE8A 1K3WA 1WE7A 1M6DA 3R2IA 3BY4A 1FCLA 4C4VB 1UH6A 4GKJM 4HJKA 4DXGA 1J7KA 1K82A 1Z2MA 1JRPA 1GL7A 2QIEB 4ZYNA 2AQ3B 4LNKA 1ME3A 4II3B 1MG4A 4W9FA 1OIPA 4YVAA 1T0SC 1T5XD 1PGYA 4P6GA 1ENFA 4B9KA 4NAMA 3HJSA 1U4AA 2INCC 4OZCA 2W55A 5FR6A 2ZEQA 2AVWA 2OZ2A 4MZOA 2NMQA 2HAKA 2V9HA 2D07B 2HHNA 2QC8A 3VRAB 3T6PA 5JXVA 4L78A 4EZJA 2L7IA 1D0KA 1T3QA 3B2GA 2DC8A 3BCNA 2KT7A 3AECB 3IOQA 2AL3A 1WH3A 1EWMA 4WAAA 3Q8GA 3RT3B 4ZYSA 2E3TA 1FH0A 4IKGA 2DC7A 2JY6B 2N7DA 4XDCA 1IUEA 3WHLA 1WF9A 2HJ1A 1D4BA 3GB1A 2RPVA 2KNVA 4DV1M 2BWES 2KKCA 2CRUA 3BK2A 4FCWA 5ITXE 2PE9A 4LZJA 4PI3A 3PRPB 3N9YC 1WJUA 2G6DA 1FRDA 5HHDG 3IV2A 1L0VB 3L16A 1D6EC 1P3QQ 3C3EA 4YYUA 4MGHA 3H8BA 4YYSA 4B7FA 2ERCA 2K9DA 3APFA 4XZXA 1NY6A 3RYTA 3FILA 4RY2A 1SXJB 2D7GA 1RLFA 2JZ0A 3SEBA 4G54A 2MBOA 1T0YA 3KWZA 2M5ZA 3QC8B 2KJ6A 3A9KB 1NNJA 4DHZB 4MGYE 1ZPSA 3MP2A 4A3PA 4TV3A 1WX7A 2DHYA 2JX5A 1VDLA 2RDBC 3AV8A 3KYDD 1ME4A 2FQ9A 2R4JA 2FRQA 3H89A 4ZUXU 4GITA 1FIQA 1I4HA 4FWGA 3SFZA 1V9JA 3B7QA 3TEXA 1CPJA 1SF0A 1XXHA 2JA2A 3HU3A 3NY5A 4PDGA 2QHOB 4BBNC 4AKGA 2Z3XA 1V1PB 3NUHB 1J8CA 4NC6A 2N0SB 3SDLC 3P5VA 2W54A 4LJ8A 4A3VB 3RD2A 3I3TA 3U8EA 3NRZA 3WXEA 2X49A 2G3QA 2Y0QA 2KFKB 2FO5A 3AKZA 3SD5A 2C98A 1G4AE 4N9F4 3BB7A 4KIKA 3U6EA 2VRRB 3IG5A 2BYVE 3FTCA 2ARYA 1R4MI 3EFCA 4G4QA 5JA7A 4B6WA 3L28A 5J94A 1MHXA 1WXMA 1P1AA 2GB1A 3QA8A 3KP0E 1ZE3D 2KDBA 3KSEA 3AV0A 5TR5A 3ZO5B 1NYRA 3H6NA 1R4GA 3M3JA 3FRHA 4FJVB 2DZJA 2YJBA 4NOOB 1LM8B 2D5GA 4YHHM 4D2KA 3ML8A 3MC0B 3VQIA 4ZRJA 3W5VB 1U5IA 2K39A 4JIOU 4XX5A 4DMXA 2MH8A 3CMMB 5D6JB 2JTCA 3H1UA 2JNHA 2GLSA 1GMYA 1RWSA 2RPQA 2KEBA 2D10A 4LF8M 3M7GA 5F02A 5HFYA 2CS4A 3GLFB 3RCZA 4NJ6A 1MHHE 3LVWA 1I4QA 4II2B 3U7ZA 2W82A 3C8YA 2FS1A 3AEFB 4PYZA 3ZIMA 1U9QX 1QZMA 2WXRA 4ARCA 2F4VM 1WXQA 3O1GA 4PP1A 3C9EA 4LF9M 4KHPM 4OVVA 1U9WA 4JLCA 4I04A 3IFWB 1QQRA 1WZ0A 4ASWC 5ITXA 1NL6A 2HWKA 1Q39A 2L3ZA 3AEGB 1R6BX 2XFSA 2K6DB 4ITKA 4ANUA 3VK7A 1AYVA 1J7CA 3W2DA 4GRIA 1HR0M 4KX6B 2FAZA 4IM2A 3NVZA 2L0TA 4IG7B 4R7GA 1A5RA 2KFJA 1NVID 4K7UA 2IY0B 1MVKA 4NXMM 1STFE 1ZQ9A 2G7YA 1TBEA 4Q8HA 4AI6A 1WWTA 2ZPNA 1L2BA 1SE9A 1BGOA 4AXMA 3V05A 1ZAEA 4JPSA 3SU8X 3K9MA 2CIOA 3KW6A 1NB5A 4PS3A 1T3TA 3DBSA 1DGHB 3GLFE 5E6OA 3HM6X 2JWZA 4C00A 3LCUA 2JRHA 3OQCA 2R46A 5JH5C 4OVZB 2WWZA 2CE7A 3H6SA 2MWSB 1IN7A 2FYEA 4HVBA 3TIXA 5PADA 4DV3M 3KX1A 1QOLA 2G8LA 2KDFB 3W1SA 5LMNM 5DYGA 2IO1B 4PDIA 2J42A 1UGMA 3K2LA 2KX0A 2QMTA 4IWOA 1HE8A 3DPDA 2C9WB 2LRUA 3J7BA 3KUCB 4M0WB 3PRPA 3S2AA 5LXHA 1QMYA 5A2QS 3SAUA 2MP2B 4J3OD 3U6LA 2XU3A 3BZDB 4US9A 2ICIA 2PADA 2JZZA 1N75A 1ZXIA 2C9OA 3NZ3A 5FTKA 4GDKB 1U9VA 2R2OA 2OPFA 5JHBA 3L25A 3HHZA 1WGNA 4WJPA 2LNHC 1ZXHA 3PTFC 3KVWA 2BYFA 4L6V6 5ITUA 3HUIA 3KQ4A 4FJCA 3GQ3A 1ZMUA 1D2NA 2WXPA 3QT4A 2Y21A 3DHIC 1E10A 1YSYA 3L08A 5CHVA 1V92A 5F3WA 4CIZA 2MBBB 1IN4A 1XMOM 3BWKA 2E01A 2KACA 3E21A 1V97A 3DOWA 4R71A 4F1SA 1KLGD 2JY8A 1IY1A 2KTRB 3BVMA 1VG5A 1IXSA 3Q8XA 3Q2AC 1OEYJ 2QHOA 2CHVA 3SC3A 2MSED 3N4CA 3JR5A 2DVWB 4FJZA 3I06A 1F1HA 2H7JA 4QHTA 1V1PA 1XC8A 3IG8A 1LTMA 3KH0A 3IUTA 5IT9S 2KXEA 4IM0A 2JYTA 5DPRA 5AZHA 2C5RA 2FBWB 4PK1A 4P1BC 5FPWA 2KLCA 3UF8A 3SFDB 5EXTA 4AKHA 2BVCA 1UWXA 2UXDM 1E6EB 1GLOA 3SASA 4DR1M 1XQQA 2DC6A 2VQEM 3L54A 1SXTA 3LCVB 2V1CA 3QYEA 3MFGA 1PJQA 4OVUA 1XO3A 2Z4SA 2LVOC 1AYWA 1XLQA 1AU2A 4WWMA 1WR1B 1NPZA 2QSFX 1EF7A 4RF1A 2DOSA 2R9MA 3PVSA 2WYQA 2P7UA 2BF8B 2PMVA 4OELA 1R2YA 1H6UA 1OAOC 2IO3B 2V3SA 3L2AA 3JSVA 2KANA 5KQ8A 3NJTA 1OFFA 4G3XB 4EE2A 4JI1M 3U6MA 2C60A 4WWPA 1EU4A 3PPAA 3Q6BA 2DI0A 4LZZA 3B08A 2CR5A 3DWMA 3GLFA 2VDBB 4G4NA 4GMQA 1TKEA 2MW5A 4TQ1A 3X23A 2BB5A 5A24A 2J0JA 3R8BA 1S3SA 3GQ4A 4LJ7A 2JT4B 1F2CA 4X6JA 1T0RC 4RGTA 2FUDA 5E26A 3T9LA 1WFYA 2Y0TA 4AKIA 4NRWA 2FUHB 1KFUL 4GHAA 2CWBA 4HL4A 5BMHA 1PQSA 1BY8A 1I7HA 4GMVA 4URKA 3TNXA 2W3RA 3CF2A 1PJIA 2D3BA 3ZJUA 4WAFA 5IN7A 1HUCB 2N9EB 3CIRB 3LJ3A 1Q10A 3Q14C 1THEA 3W9CB 1WJ4A 2OJRA 4BOSA 3GRVA 3I51A 2KDEB 2JUOA 5EP3A 2VHFA 1XWIA 4CHKA 4XYCA 3GPUA 3VUWA 1XD3B 2V6ZM 5JI3E 2M8SA 3ZNGC 1WSPA 3SBJA 1G6JA 4AXLA 4DV5M 1DGHA 1JWBD 3DVGX 4LNNA 4LJ5A 2KOXA 3HHMA 2A5UA 3PSEB 2N9PC 3RPFC 1IYFA 1HTOA 4UDUC 1G59A 2LXCA 3IBEA 4OVZA 5JZEB 1K50A 4REZA 2C9CA 4G4OA 1F2RC 2WX1A 4AJWA 3IT6B 3DVGY 4KDIC 2G8JA 3H9DA 3HZJA 1GB1A 3R2TA 1HNZM 2KQ4X 1TLOA 4OZBA 1TZOA 2BJWA 5FTLA 2BS2B 2KLGA 4RGMA 4DHJD 2ON8A 4CDCB 1G8PA 2B1NA 2PREA 4IBKA 1AECA 3PRMA 2QEJC 3P1MA 4M0WA 1IY0A 1IN5A 1O0EA 3HWSA 2R9CA 1WIVA 1WR6E 5FLXS 1NQCA 2JWSA 1RRBA 2EMSA 2MP2A 1JQJC 3K9OA 1UGJA 4QNMA 4IOIE 4GDKA 3ZKJC 4TMAB 3L10B 2EKFA 2Y20A 1EWPA 4GLSC 4DXAB 1F0ZA 1D5XC 2DAMA 3Q3JA 1JWMD 2V4LA 2GBNA 2AQ1B 1TDZA 3CGWA 1XNRM 2GMIC 2XZUA 1TS4A 1DOYA 2PKOA 6PADA 4ANVA 4I6LB 2EELA 4BBNF 1X9YA 4IBCA 3W68A 1J7BA 4AG5A 2KC2A 3QARA 1WJ7A 1IBXB 2I7PA 2GOWA 3N3KB 4MZSA 2OQ4A 3FTFA 2LGSA 2L00B 2JYEA 2WXQA 3QWLA 1GB4A 4NXNM 1MG8A 2FT2A 2QPAA 2G1EA 4Q2JA 1TIFA 3RNFC 2MHJA 2PNSA 2JY5A 2JRIB 4I81A 1T6OA 3APCA 1OAIA 1F9JA 2HD5A 2BYEA 2JXTA 2UU7A 1EWOA 2M60A 3ZUAA 2NBUA 1E8WA 1AN8A 4M01A 2NQGA 3KLSX 1GPXA 1RAXA 5DFLA 3U6SA 2LXEA 2K6BA 1X1MA 3J2PB 4Z8XA 1E7UA 3AXCA 1WR1A 4MH8A 8PCHA 3NVYA 1RU3A 3ETRA 3EC8A 4KLNA 4N58A 2H88B 2MA9B 3GRUA 1ZDVA 1YQBA 3FUUA 3LVVA 3I63C 2IPPB 2Z59B 1N60A 3PNRA 1QZEA 4M02A 1XLNA 3AOGA 5EZQA 2ZW1A 1V86A 3L17A 3EUB2 4N59A 4FW9A 2H5XA 3SHFA 2REXA 1TZ1A 1DGGA 1FXIA 1QAOA 1UKFA 1EE8A 2J7NA 1E94E 2BS3B 3AE8B 4IJEA 3HJQA 1QKZA 4DK5A 3HJ8A 1CV8A 4A55A 5EJCA 4X6HA 1GJSA 1QVRA 4LLGM 3A4SC 4BOZB 2J0MA 1GL6A 1PVJA 1Y4HA 2EJSA 2ZZPB 1JWUD 3C58A 1A70A 2NTTA 2A5YB 3AI5A 1MDWA 2N35A 1OQRA 3UZUA 4HWYA 2LGYA 4LDTB 4M00A 3MMPA 2JU6X 4HXDA 4BFRA 1FM0D 3AE2B 2K47A 1L8QA 5LXIB 3U6DA 3B89A 3E9SA 2MBEA 3PS6A 5EP2A 2L32A 5I4DA 2ZW0A 1FMAD 1F4IA 2DENB 5CTRC 2EA0A 2MCNB 1KM7A 3AN1A 3J9CA 4LF7M 1IM2A 1MS6A 1UFZA 3N32A 3EGRA 2JZ1A 4LGMA 3OF9A 5CX3A 4RF0A 1JR3E 3J27B 1J7AA 3MTNB 2Z0DB 2KTFA 3V60A 4L1BA 1Z5CA 4BAXA 4K7CA 3B9PA 5ITRA 3DVNV 3QIJA 2WSFF 1LV7A 5EGWA 1WGKA 3ZYYX 4XR7A 3DBLI 3FD9A 4KGSA 1HJPA 2AUZA 1CZPA 1ZMVA 3VFDA 3SMPA 3ZNZB 1WE6A 1FD6A 1JR3D 2Y3AA 4WP2A 4DV6M 3IFUA 3VDUA 3E1ZB 5JH3A 2WSEF 4ITQA 2BTEA 1VEJA 2CHGA 3NS1A 1AU3A 5GMVA 2R2QA 1JCKB 3T8MA 1DO0A 1OJLA 4KT0F 4DXFA 2YJ9A 1QAMA 3L29A 1TTEA 2MBQA 3QWZB 3HHAA 4NJCA 4HEA1 3TMPB 1NB3A 1N77A 1VZ8A 1QUTA 3DBRI 1PPDA 4I8OA 2O2VB 1ZV1A 1IFYA 2IBIB 1QXPA 2R62A 4ANWA 1DOIA 5J18A 5H37D 2DCBA 1WY8A 2QCZA 1XCTL 5IZ7D 1F52A 1I4XA 4HPPA 2BWEA 2LXAA 3U61B 3TWLA 2DWMA 2SEBD 2OEDA 1UUPA 1KFVA 3K9PA 1XMQM 1TYGB 3DCGA 1B9RA 5GKNA 2ACTA 2DCDA 4LF6M 3D6SA 3N3KA 1NVMA 2I38A 1RFAA 3IHPC 2CHZA 1GECE 4JYAM 3HHIA 3IVFA 3ZUNA 7PCKA 1Y8GA 1HQRD 3JYUA 2R61A 2CHXA 5FKAC 1J19A 1QAQA 3GZNI 4NJ7A 3GLGB 1QOAA 1UWMA 4W4UA 1CS8A 2KC1A 4C56C 5BMIA 4XZ4A 1ICFA 1C4AA 5D2MB 3NZUA 1L1TA 2LJIA 1ESFA 3KOZE 2M19A 4KGTA 1V34A 4MJSA 2DZZA 1H4RA 3GLIB 4AW4A 2VH2A 3KS4A 2K5PA 2ZAOA 4E71A 3CH2X 4BS5A 2GQFA 3PHUA 3TJPA 3ZJTA 1G41A 4R3DA 2PJHA 3NG0A 3NVVA 1Q3CA 3IAM1 2CJNA 1TS2A 4WH4A 1C3TA 2JQFR 2J4XA 4MSQB 1ATKA 1JR3A 1YOVB 1V33A 2WXHA 3BVGA 4JI0M 3OF8A 5IA7A 5D3DA 1I4WA 1CQDA 4FK5A 3FYDA 2K22A 3ZH9B 1ROEA 2D3GA 3PLVA 4GDLB 2XSZD 3ZCBB 3VTUA 1GOZA 5MPOA 4BOZA 1VLBA 3PDFA 3JR4A 4YTMB 3GLGE 1ZDXA 2ZTDA 2YJ8A 3NVWA 1FFUA 1XLOA 1SNKA 2WS3B 4DV0M 2WU2B 1TGUA 2C7MB 2CHQA 4FWDA 3AEBB 3RNAC 2BBCA 4FLHA 4A3OA 3E56A 3FUWA 2WQYB 2QNJA 1WGDA 3EFUA 1E8YA 4KODA 2QENA 2JSVX 1WRDB 2QQ8A 1F2RI 4A20A 1IGDA 2DENA 1FXTB 3V6CB 1Q3BA 3P5WA 3JVZX 1D5MC 3ML9A 3LFYA 3MTVA 2YQZA 3I57A 1ET9A 2CKHB 2AEHA 3ENEA 2C5LC 1GABA 2R6NA 2K0BX 2XLJA 3PBHA 2Z84A 4CZWA 2MJ5B 4LJ6A 1QOBA 4MI7A 2MJDA 3MHZA 1BT0A 2V1UA 2NBWB 4LY6A 3RMKC 3VH3B 5DPWA 1FRRA 2FCNA 3SATA 2NPTB 2AHMA 2BU3A 1GUAB 2PVOD 2H1RA 4XUIA 1YLAA 2LVNC 5CVMA 1MJDA 3AE4B 3H4JA 2LH0A 4K0KM 3L0WB 5CHTA 2F7DA 2RDGA 2BWFA 4F2LA 4HWIB 2OO9A 1SXJE 2IY1B 2ATOA 5KHQA 3IMAA 1DV0A 4KDLB 4O1NA 4WJQA 2WDTB 3TSSA 4DHZE 3Q3MC 3WCQA 4Y28F 3PGEA 2L05A 3SAWA 1W5TA 1CQVA 1HT1E 3T1YM 3TMPA 1C79A 1SXJD 2BNKA 4X64M 2YEPF 3KYCD 2L52A 4L2YA 5AUIA 4LCDE 2V0GA 3A42A 3V6EB 4KVGB 1BMLC 4IUMA 1VJVA 4P16A 2ZNVB 3OJ3A 4EOYA 3A1QB 2DHRA 5K16A 2O25A 2XZFA 1D3ZA 2XSZA 3LQRA 3A46A 4OHJA 2CU1A 1YK7A 1BP4A 1QILA 3WHKA 3UQAA 2MGWA 2X4AA 4X65M 4E3CA 4JWSC 4FCVA 3V76A 4LFCM 2BGFA 4GEWA 2GI9A 2PTLA 3RNCC 2RRUA 3PHXB 4JV5M 3CH3X 1WGGA 3EHVA 3QAQA 3RZFA 1VDDA 5G5HA 4XWWA 2E00A 2BKRB 4C4VA 2YJCA 2KD0A 3GLGA 3BK1A 2QJLA 2RKOA 3MP9A 4JN6A 1OFHA 2CV1A 1N32M 5IOIA 5FR3A 5L8RF 3VXWA 1PJTA 3HGIA 2JY7A 4D8EA 1AU4A 3E4RA 3HKPA 1WMHB 1Z5AA 3DHGC 1Q6KA 3UGJA 2CB5A 5BPVA 3I9V1 2GNOA 1NJFA 2VZKB 2NBVB 3TCAA 4LJ9A 1E5WA 4XGAB 4AWJA 4I6PA 5EE1A 1E9SA 3VR8B 4IWQA 4B3MM 1WIAA 5DPSA 2K25A 1L1ZA 5EXXA 4X62M 4YY3M 2V3NA 2XK5B 2FTDA 2YNMD 1WZ3A 5JI2E 4MSXA 4B3RM 3W1SC 1V5TA 1J09A 2JY6A 3TEYA 3MJ5A 4NAWB 2QILA 3P4PB 1KJTA 3DOAA 4AG6A 3FUVA 2F5OA 1N78A 2CP8A 1ACCA 4LJOB 2BS4B 2CEAA 2IGGA 2DWZB 3FE3A 3FRIA 2F1GA 4D82A 1HZ5A 1ZUD2 2KNBA 4OU7A 4HEOA 4IBGA 1GCBA 2P5TA 2JXXA 5FTMA 2XEPA 1N33M 3URYA 3KS8A 1GG3A 5HG2A 2NR2A 3AE6B 4BKSD 3KFQA 3KOXE 3AMZA 4QRXA 1Q5WB 1L0XB 1DKIA 2M4NA 5C1ZA 1SXJA 4BB9A 2AYNA 3NBXX 1SXJC 1IBKM 1FNNA 5KPTA 4NY0A 2HE7A 2PBHA 1DO2A 1VD2A 3AH7A 1EFUB 5L95C 2M1MA 2WLBA 1YZBA 3A9KA
chains in the Genus database with same CATH topology
3GPPA 1TS3A 5EP4A 2B76B 4RCOA 3PO0A 5EP1A 3VKHA 5EXPA 2KZSA 2CJOA 2L1AA 2AX5A 2KMMA 2FNAA 3GLHB 4CQNA 3UK6A 5C2TB 2KZUA 4GHLA 4QOSA 2VZKD 4NRVA 4PD2A 2UUAM 3P4QB 3SFEB 3J7AS 3HVZA 1ZP0B 2MJ3A 3AEEB 1C9FA 3SHGB 1IBMM 3AFHA 3EIEA 1HA5A 1Z6TA 3M0EA 1HT2E 2EUCA 3U60B 2WXJA 1X37A 3P4RB 2LMCA 2M0AA 1NYQA 5C3JB 3RGPA 2HCBA 2BW2A 1TH4A 2FFJA 1TY0A 4JI6M 4B3SM 3KXEC 1UNSA 4D80A 3KFUG 1KYIA 1JWSD 5BYRA 4HROA 3TWMA 1C76A 4TQ0A 1TS5A 3AE7B 2DBYA 3J80S 2X8AA 2Y5CA 1QOFA 1IBLM 2UUCM 3W0LB 3T38A 3VK8A 2V4IB 2ZM6M 5KQDA 2RGHA 5EZSA 4YSYB 1YQ4B 3VDPA 1STEA 4JI5M 2W3SA 2WU5B 2R65A 2MJEA 1VZ6A 4AQ7A 4YT0B 2F5QA 4BOQA 3A98B 4LG2A 1YN3A 4IIWA 3NWLA 3TPZA 1F77A 3SR6A 1J5EM 3W0FA 1Z5BA 1QF6A 3KP1E 3OWEB 2WXNA 3EA6A 5BR8M 4DR4M 2RMMA 1YJIA 5G5GA 1GLNA 1CJEA 2QBYB 3CF6E 1ORYB 5FTJA 2F5NA 1HNWM 5EE0A 4MH0E 3K1JA 3IAS1 2NTSA 2DWQA 4BOUA 1NEKB 1SBBB 2E5LM 3FTDA 4ZHOA 3KOYE 4IJFA 2QZ4A 2KRKA 3TUOA 2IPKD 3GRRA 1PYWD 1SE4A 3CF0A 1N62A 2QSDA 2LWXA 5DNYA 4OW0A 3QAUA 2BT6A 1JWAD 2XH9A 1KLUD 4WURA 1NSFA 1RM6C 3LYYA 1KRHA 1L4DB 3GP7A 3Q69A 4OX9M 4JI8M 2XGNA 4YWGG 2PLPA 4MM3B 4A6QA 4L23A 2BYTA 1KFYB 3AE9B 4GH9A 3AEDB 1PJJA 1DGBA 3GP1A 1IXRC 4MGKE 3Q8FA 4MACA 3VRBB 2R45A 2R18A 3PXGA 3U60A 2WP9B 2YFQA 8CATA 4AQYM 2Y5PA 5FSWA 1DOXA 4ZPXA 3EIHA 3THGA 4HKQA 1QYRA 4JI3M 2HHHM 3Q8EA 1VRAB 3U4EG 4DV2M 2ZBKB 4WW0A 1P7FA 2LFIA 1MI0A 4HLQA 5IREB 1YN5A 4USAA 2L6OA 4MGIE 2JZPA 3TQSA 1PGXA 1YQ3B 5EXSA 4JE3B 5D3IB 3JAMS 1VR9A 5EQTA 1K53A 3AJIB 4G4RA 2VQFM 3RE8A 1VJKA 1VDVA 1BUIC 4ZHPA 4JI4M 4JX1C 1JW9D 5C1BA 3PNYA 1IN8A 1LO5D 4C80A 1IGCA 1HNXM 1KF6B 2KA6B 3PSEA 2QBYA 5JZEA 4WIPA 1JMLA 1XXHB 1NHWC 4HJGE 4M0DA 5H92C 3HHXA 4IBEA 2LGIA 5HI1A 1SB3C 1DGFA 1TH3A 1TJEA 4M9XA 1DYQA 3L26A 1GAQB 2XNAC 3BYTB 2GRIA 4AS1A 3W30A 4IBBA 2KDMA 2CU3A 1NY5A 4KKIA 3PZ7A 2LHEA 4DR5M 3HU2A 1E7PB 1EWCA 2M56B 5DYIA 4JI7M 1L0YB 5KPZA 3U6OA 3SMSA 1D5ZC 2L09A 1IBXA 3B2FA 1E9RA 1TY2A 2K9XA 2CUZA 2XN9C 5BYSA 3LXFA 1E0ZA 4FD2A 1SSNA 1N34M 3UMMA 4ZOHC 2JRIA 1YUBA 4KGRA 3GO8A 1MU5A 3SARA 2UZJA 1YJJA 2I7NA 3K8ZA 1MX0A 4CHTB 3U6QA 1PFDA 3TEWA 2L7HA 4LRTA 1L5PA 3U2SC 4LCBA 4IP3A 3PFIA 4RFBA 5KO3A 3OTOM 1KTKA 5KPRA 3U5ZB 2QCUA 1L4ZB 3H8HA 3PNVA 4QNRA 3IXSA 1TDHA 3DFZA 1PUTA 3LQQA 4US8A 3TE6A 4MB7A 4B7HA 1L6VA 2HL7A 5AUKA 3AM9A 3GPYA 4PT5A 1JALA 4I5SA 4FWHA 3ZQ4A 3L27A 2DLBA 2DYOA 3NBIA 1TH2A 1YMHE 3HVDA 2O5RA 3AE5B 5GXGB 3VR9B 4N6EB 1FJGM 2NQ8C 1RYJA 4D8BA 2D7HA 3UJNA 2C99A 3CTWB 2DWLA 3FYCA 1QOGA 3B21A 5ITTA 1G3IA 4YTNB 3U6CA 1I4RA 3BWUD 1IXSB 2N7JA 4RGOS 4CISA 1I94M 3KSJA 2DZNB 4DV7M 4NL4H 4M9SA 3HU1A 5E6JA 3FAHA 4BOPA 2G9HD 4PCZA 4GUAA 4LFAM 2WDVB 5LNK1 3P4SB 4ZTBA 1Y56A 2KW0A 4DR3M 2WXGA 5T8IA 3U61A 4DUZM 3D8LA 2Z7JA 2WXOA 4JXJA 2QP9X 1OQQA 3TRKA 1T6BX 4L8RC 3GS2A 4X66M 3BIID 5BMGA 1SIJA 1GVNA 4LGYA 4L15A 4YTPB 4OZAA 4FXCA 2BTWB 4LJ4A 4XGIA 1V1OA 2J7OA 4IBIA 4HRSA 4EIWA 1XEEA 3AOEA 3AOEC 3SAVA 2D7EA 3K92A 3GLIA 3T15A 3D8BA 4AZFA 3U5ZA 4LFBM 2SAKA 1SE3A 2ONQA 3P63A 1FFVA 2I2YA 4XBOA 4GC9A 1PGBA 4M9ZA 1QANA 2TSSA 4XE0A 3TL4X 5FK9C 1IN6A 4IBJA 1C78A 3V3XA 5LMUM 2PIAA 2JQRB 2FUG1 3AL0C 4L4UA 2N9KA 4S12A 4B08A 2L83A 1XF5L 2R4EA 4G6ZA 3HHWA 3KWVA 3PT2A 1MPEA 5D7GA 2LEKA 4CGYB 1QQWA 3RGSA 5ITYA 3T1HM 4MT5A 4P6VF 4LF4M 2VIIA 2BJVA 3IT4B 3BOSA 1K51A 1WYGA 5TSSA 1M4VA 1FNVA 2PVGC 2YEPB 1FO4A 3Q8AA 2DWNA 3AE3B 1K52A 2HDEA 2BB6A 4YXDB 1P7EA 3L4PA 2UXCM 1GKIA 4DR7M 1AYFA 2CV2A 2WXIA 2WXKA 4MGZE 4QOZC 2KWDA 3LMMA 4LK0M 4NZLB 4A8XC 3MK6A 1NI3A 3ILKA 3KSXA 3RFZB 3T3NA 1N5XA 3U6PA 1FNWA 1RFKA 3FKEA 5ITQA 4I4LA 1E9MA 2C96A 2G5GX 2IGHA 2RGOA 2XFTA 1ZOYB 1XNQM 3RNVA 1FEHA 4D8IA 3AB5A 4BLCA 3TWKA 2LHDA 3DA1A 1IY2A 4DUYM 2YR0A 2INNE 1PDXA 3PHXA 1HZ6A 4C7YA 2EKIA 4DQOC 2WDQB 2DZOB 1EM7A 4B7GA 3Q8CA 1QT9A 1FXAA 2OHFA 4DR6M 1HQCA 3O13A 3R8FA 2BTWA 1C1KA 3LB8C 4DR2M 3AEAB 4HXDB 3PZ8A 3H4MA 4YSZB 4GIPA 1OFIA 2KRUA 1TKYA 4B0MA 3SYKA 1SJHD 1C4PA 1EWYC 2MEKA 3W5UB 5EE3A 2Z4RA 4XDDA 2FOIC 4NSRA 3R9XB 4A5UA 3FTEA 4Z6YA 4RGNA 2WXLA 3GPXA 3FUXA 4RKXA 4DV4M 1XCQL 4NSOB 1N5WA 1I4GA 3M6AA 1AWDA 2F5SA 4B3TM 2WXMA 1EU3A 4B0EA 1NNUC 1IQPA 3Q8BA 4RH6A 4ZRPA 2UXBM 3HRDD 4C7ZA 1B1ZA 4IDIA 4JI2M 1FNUA 3TEZA 4GKKM 3J81S 2X38A 4JWUC 3GLHA 4L16A 2K0PA 1SE2A 2N9LA 3KWLA 3CWIA 5BYQA 1VZ7A 3U52E 1E32A 2WXFA 1UM8A 1KH0A 1NENB 3BVZA 1N36M 2AGAA 3HHYA 1SJED 3DZDA 2AQ2B 3I4YA 1L2DA 1HXYD 2UU9M 4ZRQA 1I4PA 3FC4A 2DXIA 4TUWA 2RDHA 2H89B 3PHWA 3B9JA 1L6UA 3KDSE 7CATA 2F5PA 3I4VA 3O65A 4FVMA 1BXTA 4IBFA 3KOWE 2CFOA 2ZANA 1YNTE 4RNAA 5C18A 2K3UA 4FCTA 2WDRB 1N63A 4KO8A 3BBAA 4TSSA 1C77A 2JWUA 2IJ0A 3SYLA 2Z8LA 2Q5WD 3UI3A 1R7RA 1HQYE 2V3PA 3DWGC 2KN4A 4W5WA 1PM5A 4BBAA 3ZGZA 1TKGA 5IWAM 4H2AA 1HEZE 2HKJA 3FILB 3W31A 2UUBM 2MH7A 2EO2A 2J7QA 2J7QC 3GRYA 3A45A 1PGAA 1W5SA 4KKJA 1ET6A 1V8CA 3GQ5A 4YSXB 3C0RA 2LUMA 5H8YE 4LJAA 4GC5A 3BYYB 4A9AA 2CV0A 1YE9A 1KSFX 4WQMA 3FUTA 2ACZB 4A90A 2HTME 2XF3A 2J53A 1WRIA 3MHVC 2IDYA 1N61A 3ABVB 3RFWA 3VLFB 2ZAMA 2E6XA 3T3OA 4LF5M 1IXZA 3AE1B 1NHGC 3ZNHA 2Q2EB 4II7A 1YN4A 1NJGA 1R2ZA 1DGJA 1C4CA 2PW9A 4IBDA 4D81A 2WNMA 5FTNA 1R7SA 2J52A 1CK1A 1K3XA 3P42A 1JQ4A 4ARIA 1QLBB 3ZJVA 1XLPA 2INPE 1AW7A 1L2CA 1FCCC 4QHSA 1JROA 3ZC7B 1XHBA 4HKZE 4LRSA 2DYMA 5EE9A 2IGDA 1Z59A 1XXGA 2KAJA 4LTUA 4XWTA 3VKGA 1SEBD 2FE8A 1K3WA 3BY4A 3R2IA 1FCLA 4GKJM 4DXGA 1J7KA 1K82A 2QIEB 1JRPA 1GL7A 2AQ3B 1T5XD 1ENFA 4NAMA 3HJSA 4OZCA 2W55A 2NMQA 3VRAB 5JXVA 4L78A 2L7IA 1T3QA 3B2GA 3AECB 4ZYSA 2E3TA 4IKGA 4XDCA 1IUEA 3WHLA 1D4BA 3GB1A 2RPVA 4DV1M 3BK2A 4FCWA 5ITXE 4LZJA 3N9YC 1FRDA 5HHDG 1L0VB 1D6EC 4MGHA 4B7FA 2ERCA 4XZXA 1NY6A 3FILA 1SXJB 2D7GA 3SEBA 2M5ZA 1NNJA 4MGYE 1ZPSA 3MP2A 2JX5A 3AV8A 2R4JA 4GITA 1FIQA 1I4HA 4FWGA 3SFZA 3TEXA 1SF0A 1XXHA 2JA2A 3HU3A 4PDGA 4AKGA 2Z3XA 1V1PB 3NUHB 2N0SB 2W54A 4LJ8A 4A3VB 3NRZA 2X49A 2Y0QA 3AKZA 2C98A 1G4AE 3BB7A 3U6EA 3IG5A 3FTCA 4G4QA 3L28A 1MHXA 2GB1A 3KP0E 1ZE3D 3AV0A 1NYRA 4NOOB 2D5GA 4YHHM 4D2KA 3MC0B 3VQIA 3W5VB 2JTCA 1RWSA 2KEBA 4LF8M 3M7GA 5HFYA 3GLFB 1MHHE 3LVWA 1I4QA 3U7ZA 2W82A 3C8YA 3AEFB 1QZMA 2WXRA 4ARCA 2F4VM 1WXQA 4LF9M 4KHPM 1QQRA 5ITXA 2HWKA 1Q39A 3AEGB 4ITKA 1R6BX 2XFSA 3VK7A 1J7CA 3W2DA 4GRIA 1HR0M 4KX6B 3NVZA 4R7GA 1NVID 1MVKA 4NXMM 1ZQ9A 4AI6A 1WWTA 1L2BA 3V05A 1ZAEA 4JPSA 3KW6A 1T3TA 1DGHB 3OQCA 2R46A 4OVZB 2CE7A 1IN7A 4DV3M 2G8LA 3W1SA 5LMNM 5DYGA 4PDIA 2J42A 3K2LA 2QMTA 3J7BA 3PRPA 5A2QS 3SAUA 4J3OD 3U6LA 3BZDB 4US9A 2ICIA 1N75A 1ZXIA 2C9OA 3NZ3A 5FTKA 4GDKB 2OPFA 3L25A 3HHZA 2LNHC 1ZXHA 3KVWA 3HUIA 5ITUA 3KQ4A 3GQ3A 2WXPA 1D2NA 2Y21A 1E10A 1YSYA 5F3WA 1IN4A 1XMOM 2KACA 1V97A 1KLGD 1IY1A 3BVMA 3Q8XA 2CHVA 3SC3A 3JR5A 2DVWB 4QHTA 1V1PA 1XC8A 3IG8A 5IT9S 2KXEA 2JYTA 2C5RA 2FBWB 3SFDB 5EXTA 4AKHA 1UWXA 2UXDM 1E6EB 3SASA 4DR1M 2VQEM 1SXTA 2V1CA 3MFGA 1XO3A 2Z4SA 1XLQA 4WWMA 4RF1A 2DOSA 3PVSA 2PMVA 1R2YA 1H6UA 3L2AA 5KQ8A 1OFFA 4EE2A 4JI1M 3U6MA 1EU4A 4LZZA 3DWMA 3GLFA 1TKEA 4G4NA 4GMQA 4TQ1A 2BB5A 3R8BA 1S3SA 3GQ4A 4LJ7A 4RGTA 5E26A 2Y0TA 4AKIA 4NRWA 4GHAA 4HL4A 5BMHA 1I7HA 2W3RA 3CF2A 1PJIA 3ZJUA 4WAFA 3CIRB 1Q10A 3W9CB 4BOSA 3GRVA 3I51A 5EP3A 1XWIA 3GPUA 2V6ZM 5JI3E 1WSPA 3SBJA 4DV5M 1DGHA 1JWBD 4LJ5A 3RPFC 4UDUC 1G59A 4OVZA 1K50A 4REZA 2C9CA 4G4OA 1F2RC 3IT6B 1GB1A 3R2TA 1HNZM 2KQ4X 4OZBA 1TZOA 2BJWA 5FTLA 2BS2B 4RGMA 2ON8A 1G8PA 4IBKA 3PRMA 2QEJC 3P1MA 4M0WA 1IY0A 1IN5A 3HWSA 5FLXS 1JQJC 1UGJA 4QNMA 4IOIE 4TMAB 2Y20A 4GLSC 1F0ZA 1D5XC 1JWMD 2AQ1B 1TDZA 1XNRM 2XZUA 1TS4A 1DOYA 2PKOA 2EELA 4IBCA 1J7BA 4AG5A 1IBXB 2I7PA 2OQ4A 3FTFA 2WXQA 2JYEA 1GB4A 3QWLA 4NXNM 2QPAA 2G1EA 4Q2JA 4I81A 2JXTA 2M60A 1AN8A 3KLSX 1GPXA 3U6SA 2LXEA 3J2PB 4Z8XA 4MH8A 3NVYA 3ETRA 4KLNA 4N58A 2H88B 3GRUA 1ZDVA 3FUUA 3LVVA 1N60A 1XLNA 3AOGA 5EZQA 2ZW1A 3EUB2 4N59A 4FW9A 3SHFA 1DGGA 1FXIA 1QAOA 1UKFA 1EE8A 2J7NA 1E94E 2BS3B 3AE8B 4IJEA 3HJQA 1QKZA 3HJ8A 4A55A 5EJCA 1QVRA 4LLGM 1GL6A 1PVJA 1JWUD 3C58A 1A70A 2NTTA 2A5YB 1OQRA 3UZUA 2JU6X 1FM0D 3AE2B 2K47A 1L8QA 3U6DA 3E9SA 5EP2A 2L32A 5I4DA 2ZW0A 1FMAD 2EA0A 3AN1A 3J9CA 4LF7M 1IM2A 3EGRA 4LGMA 4RF0A 3J27B 1J7AA 4L1BA 1Z5CA 3B9PA 5ITRA 1LV7A 1WGKA 3ZYYX 3FD9A 4KGSA 1CZPA 3VFDA 3SMPA 1FD6A 1JR3D 2Y3AA 3IFUA 4DV6M 3VDUA 4ITQA 2BTEA 2CHGA 3NS1A 1JCKB 1DO0A 1OJLA 4DXFA 1QAMA 3L29A 4NJCA 4HEA1 1N77A 1VZ8A 4I8OA 2R62A 1DOIA 5H37D 1XCTL 5IZ7D 1I4XA 3U61B 3TWLA 2DWMA 2SEBD 2OEDA 1UUPA 1KFVA 1XMQM 1TYGB 1B9RA 5GKNA 4LF6M 1NVMA 2I38A 4JYAM 1HQRD 2R61A 5FKAC 1QAQA 3GLGB 1QOAA 1UWMA 4C56C 5BMIA 1C4AA 1L1TA 2LJIA 1ESFA 3KOZE 2M19A 4KGTA 3GLIB 4AW4A 3KS4A 2K5PA 2ZAOA 3PHUA 3ZJTA 1G41A 4R3DA 3NVVA 1Q3CA 3IAM1 2CJNA 1TS2A 4WH4A 2J4XA 1JR3A 2WXHA 3BVGA 4JI0M 5D3DA 1I4WA 3FYDA 2K22A 3ZH9B 1ROEA 4GDLB 2XSZD 3ZCBB 1GOZA 5MPOA 4BOZA 1VLBA 3JR4A 4YTMB 1ZDXA 3NVWA 1FFUA 1XLOA 2WS3B 4DV0M 2WU2B 1TGUA 2CHQA 4FWDA 3AEBB 2BBCA 3E56A 3FUWA 2WQYB 4KODA 2QENA 2JSVX 1F2RI 1IGDA 1Q3BA 1D5MC 3MTVA 2YQZA 3I57A 1ET9A 2XLJA 2Z84A 1QOBA 4LJ6A 4MI7A 2MJDA 3MHZA 2V1UA 4LY6A 1FRRA 3SATA 2AHMA 2BU3A 2PVOD 2H1RA 3AE4B 2LH0A 4K0KM 2RDGA 1SXJE 4O1NA 3TSSA 3WCQA 3SAWA 1W5TA 1CQVA 1HT1E 3T1YM 3TMPA 1C79A 1SXJD 2BNKA 4X64M 2YEPF 2L52A 4L2YA 5AUIA 2V0GA 3A42A 1BMLC 4IUMA 4P16A 2DHRA 2XZFA 2XSZA 3LQRA 3A46A 4OHJA 1QILA 3WHKA 4X65M 2X4AA 4JWSC 4FCVA 4LFCM 2GI9A 2PTLA 4JV5M 1VDDA 5G5HA 4XWWA 3GLGA 3BK1A 2QJLA 2RKOA 3MP9A 4JN6A 1OFHA 2CV1A 1N32M 5FR3A 4D8EA 3HGIA 3E4RA 3HKPA 1Z5AA 3UGJA 5BPVA 3I9V1 1NJFA 2VZKB 4LJ9A 5EE1A 1E9SA 3VR8B 4B3MM 1L1ZA 5EXXA 4X62M 4YY3M 2V3NA 2YNMD 5JI2E 4B3RM 1J09A 3TEYA 3MJ5A 4NAWB 2QILA 3P4PB 3DOAA 2F5OA 4AG6A 3FUVA 1N78A 1ACCA 2BS4B 2CEAA 2IGGA 2DWZB 4D82A 1HZ5A 1ZUD2 4OU7A 4IBGA 2P5TA 3URYA 5FTMA 2XEPA 1N33M 3KS8A 5HG2A 3AE6B 3KOXE 3AMZA 1L0XB 1DKIA 1SXJA 4BB9A 1SXJC 1IBKM 1FNNA 5KPTA 1DO2A 3AH7A 2WLBA 1YZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MP2 A;  4M0W A;  4WUR A;  3E9S A;  4OVZ A;  4REZ A;  4OVZ B;  2FE8 A;  4PT5 A;  4RF1 A;  5KO3 A;  4P16 A;  4RNA A;  4R3D A;  4MM3 B;  4RF0 A;  4OW0 A;  3MJ5 A;  5E6J A; 
#chains in the Genus database with same CATH topology
 5CHV C;  3APD A;  3GPP A;  1TS3 A;  5EP4 A;  2B76 B;  4RCO A;  3PO0 A;  5EP1 A;  3VKH A;  4XC2 A;  1R4N I;  3QYB A;  5EXP A;  2KZS A;  2CJO A;  2L1A A;  3I5J C;  2AX5 A;  2KMM A;  2FNA A;  3GLH B;  4CQN A;  1R4M B;  1MJG M;  1HTQ A;  3UK6 A;  5C2T B;  2KZU A;  4GHL A;  2DAJ A;  4ICV A;  1YAL A;  4QRG A;  4QOS A;  1YVB A;  4KLB A;  2VZK D;  3VUY A;  4NRV A;  3RUI B;  4PD2 A;  2UUA M;  1IPG A;  3P4Q B;  3QQ8 B;  4W9E A;  3SFE B;  3WXF A;  4PP2 E;  3J7A S;  1T43 A;  2KFK A;  1ZIV A;  3HVZ A;  1ZP0 B;  2MJ3 A;  3AEE B;  1C9F A;  2DC9 A;  1ZMW A;  1ITO A;  4LNO A;  1A5T A;  3SHG B;  4IWP A;  3H7D A;  4YYV A;  2LUE A;  2IND C;  5IO9 A;  1IBM M;  3AFH A;  3GOE A;  3EIE A;  2Y6E A;  1HA5 A;  1E7V A;  4W5C A;  2MRO B;  1Z6T A;  3M0E A;  4NNJ B;  4Q7J A;  2C7H A;  1K8R B;  1HT2 E;  3MOR A;  3PHW B;  4KV2 A;  2EUC A;  3U60 B;  2WXJ A;  1X37 A;  3P4R B;  2LMC A;  3A33 B;  2M0A A;  1NYQ A;  5C3J B;  3RGP A;  2HCB A;  2O6V B;  2BW2 A;  1BVS A;  1TH4 A;  3H7P B;  2FFJ A;  1TY0 A;  4JI6 M;  4B3S M;  3KXE C;  1UNS A;  4D80 A;  4K7W A;  4W9L A;  5AZF A;  3KFU G;  1KYI A;  1JWS D;  2L76 A;  5BYR A;  2IYD B;  3Q3N C;  4HRO A;  2KX3 A;  3TWM A;  1C76 A;  4TQ0 A;  2DAK A;  5J2R A;  4WJN A;  1TS5 A;  3AE7 B;  4W9C A;  2DBY A;  3J80 S;  3W67 A;  3A1Q A;  2X8A A;  3LW5 F;  1WI0 A;  1QOF A;  2Y5C A;  4W9I A;  1GJZ A;  3ZXR A;  1IBL M;  2UUC M;  4M8N A;  3W0L B;  3T38 A;  3VK8 A;  4FHJ A;  3U30 A;  2KQ7 A;  2V4I B;  2ZM6 M;  5KQD A;  4BKS A;  2RGH A;  5EZS A;  2R0I A;  4YSY B;  1YQ4 B;  3VDP A;  1STE A;  4CJ6 A;  2DAE A;  4JI5 M;  2W3S A;  3MJW A;  2WU5 B;  2BKF A;  2R65 A;  2MR9 A;  2MJE A;  1SGH A;  3P2B A;  2NS5 A;  1M94 A;  1VZ6 A;  4AQ7 A;  3BBZ A;  4YT0 B;  4P6E A;  5AEK B;  4BS6 A;  2F5Q A;  4BOQ A;  2LVA A;  3A98 B;  2J0K A;  2AU1 A;  4LG2 A;  2AL6 A;  2LVQ D;  1YN3 A;  4BOS C;  1KHP A;  3DBH I;  4IIW A;  3NWL A;  1C1Y B;  3K8U A;  2KQS A;  3TPZ A;  2WBF X;  1F77 A;  3SR6 A;  1J5E M;  1MN3 A;  1WMH A;  3W0F A;  1Z5B A;  2J7Q B;  1WGR A;  1OTR B;  2DHZ A;  3PLU A;  4ZRK A;  3KP1 E;  3OWE B;  5G2N A;  1QF6 A;  2WXN A;  2DZY A;  4K1R B;  3EA6 A;  2GBJ A;  4MEM A;  5BR8 M;  2N4F A;  4DR4 M;  2RMM A;  1YJI A;  5G5G A;  1GLN A;  1CJE A;  4AUQ C;  3V62 A;  2QBY B;  1LQB A;  3CF6 E;  1ORY B;  5FTJ A;  2F5N A;  2LTU A;  2NCN A;  4W9G A;  1HNW M;  2MBH A;  4BZA A;  1WXA A;  5EE0 A;  2L4F A;  4MH0 E;  1TL9 A;  2XK5 A;  1WXS A;  3K1J A;  2ZCB A;  2LGX A;  1FPY A;  4P1C C;  3IAS 1;  2G4D B;  2X8X X;  2NTS A;  2DWQ A;  4BOU A;  5IAA C;  3VVW B;  1NEK B;  1SBB B;  1S1Q B;  1SP4 B;  4JL9 A;  4NAW A;  2E5L M;  3FTD A;  4ZHO A;  1TF0 B;  3KOY E;  2C7N B;  4IJF A;  2QZ4 A;  2KRK A;  3TUO A;  2IPK D;  3USV A;  3GRR A;  3VAW A;  1PPP A;  2A4Z A;  1PYW D;  1SE4 A;  3CF0 A;  3V61 A;  2G8E A;  1N62 A;  2QSD A;  2KWV B;  2N1V A;  4NQK E;  2EKE C;  1JQP A;  2QDF A;  1EF1 A;  1PCI A;  2LWX A;  5DNY A;  4OW0 A;  3ECI A;  2WHI A;  3QAU A;  1I35 A;  2BT6 A;  3RVW A;  1JWA D;  3ZNH B;  2XH9 A;  4LNF A;  2KNA A;  1KLU D;  3ERV A;  4WUR A;  2HH5 A;  1TT5 B;  1NSF A;  2KTR A;  1RM6 C;  4EFO A;  4G50 A;  3LYY A;  2OOA A;  1KRH A;  1L4D B;  2OOB B;  3GP7 A;  3Q69 A;  4OX9 M;  1EIJ A;  4ICU A;  4JI8 M;  2XGN A;  4M8M A;  4YWG G;  2PLP A;  4MM3 B;  2O6X A;  4A6Q A;  3ZVV A;  4NQL B;  4UN2 B;  4L23 A;  2BYT A;  2LVQ A;  1KFY B;  2OJW A;  3AE9 B;  2R44 A;  4GH9 A;  3AED B;  1PJJ A;  1DGB A;  2JQG R;  3GP1 A;  1E8X A;  1PBH A;  2BDZ A;  1IXR C;  4CDD B;  4MGK E;  3Q8F A;  4MAC A;  3BY4 B;  3VRB B;  2R45 A;  2DZL A;  1UEL A;  2RGF A;  2R18 A;  1T0Q C;  1GC6 A;  4RKU F;  1S4V A;  3PXG A;  3U60 A;  2WP9 B;  4X57 B;  3WA0 A;  2VHS A;  3BOW A;  2YFQ A;  2P0R A;  1ZW7 A;  1UF0 A;  1TTN A;  8CAT A;  4RM8 A;  1C7Y A;  3LXS A;  3KW5 B;  4GB9 A;  3QHT A;  4AQY M;  2Y5P A;  5FSW A;  2LHG A;  1DOX A;  4ZPX A;  1JRU A;  3EIH A;  3GE3 C;  4GGQ A;  3THG A;  4HKQ A;  1QYR A;  2G4S A;  4JI3 M;  2O01 F;  2HHH M;  3N3G A;  2R9F A;  3Q8E A;  2PEA A;  1VRA B;  4GOC A;  3U4E G;  4DV2 M;  2ZBK B;  4WW0 A;  1P7F A;  4WQO B;  2BWB A;  5LLI A;  2J5Y A;  4CO7 A;  3NZS A;  4E74 A;  2FCQ A;  4GSW A;  2LFI A;  1MI0 A;  4HLQ A;  1PXV A;  3LDZ E;  1N6Z A;  5IRE B;  1YN5 A;  4USA A;  1ZKH A;  2C0Y A;  4WJO A;  2L6O A;  4MGI E;  2JZP A;  3TQS A;  1POP A;  1PGX A;  1XT9 B;  1YQ3 B;  5EXS A;  3N20 C;  4JE3 B;  5D3I B;  4K81 A;  3JAM S;  1QUS A;  1IWD A;  1NBF C;  1VR9 A;  4N8W A;  5EQT A;  1K53 A;  3MC8 A;  3AJI B;  2KMC A;  2AIM A;  4PAD A;  1PAD A;  4OEM A;  4G4R A;  5DPT A;  3VHT C;  1VCB A;  2VQF M;  3RE8 A;  1VJK A;  1VDV A;  1BUI C;  3DDC B;  4ZHP A;  1WJ6 A;  4JI4 M;  4IW0 A;  4JX1 C;  1JW9 D;  2GBR A;  3UIP B;  3N1Y C;  5C1B A;  4DDI D;  3OG5 A;  3PNY A;  1IN8 A;  3ALB A;  1Q02 A;  1LO5 D;  5BO4 B;  1IGC A;  4C80 A;  1MFW A;  2XU4 A;  1HNX M;  1WGL A;  1KF6 B;  2KA6 B;  1P9D U;  3PSE A;  2QBY A;  1L7Y A;  2NQD B;  5JZE A;  4WIP A;  1JML A;  1XXH B;  1NHW C;  2KYW A;  4M0D A;  2KZR A;  4HJG E;  1WGY A;  4EEW A;  2DNA A;  3B1L X;  5H92 C;  1D0L A;  1AU0 A;  3NHE B;  3HHX A;  4IBE A;  2E03 A;  5HKH A;  2LGI A;  3WAM A;  2ZPY A;  4CDE B;  3R66 C;  5HI1 A;  2KHW B;  1SB3 C;  1DGF A;  1TH3 A;  1TJE A;  4M9X A;  1DYQ A;  3L26 A;  1GAQ B;  2XNA C;  2XU5 A;  3RUL A;  1TGZ B;  2NQA A;  3BYT B;  2GRI A;  4AS1 A;  3W30 A;  4IBB A;  2KDM A;  1AYU A;  3S3Q A;  2CU3 A;  1TR8 A;  1NY5 A;  3GE8 C;  4KIK B;  2DJF B;  4KKI A;  3RNB C;  2DJG B;  3PZ7 A;  2LHE A;  4DR5 M;  2L0F A;  1K3B B;  3HU2 A;  1E7P B;  2ZVN A;  1EWC A;  2M56 B;  2DKL A;  5DYI A;  4JI7 M;  1L0Y B;  3M95 A;  5KPZ A;  3DHH C;  3RN9 C;  2BDL A;  4LDT D;  1QDT A;  3B79 A;  3U6O A;  5G55 A;  2L8J A;  1PJS A;  3RVV A;  4TUU A;  2L2D A;  1LXD A;  3WAO A;  3SMS A;  1EF5 A;  3RZW C;  1D5Z C;  2L09 A;  1IBX A;  2VH1 A;  1YX6 B;  4ANX A;  1OKS A;  3PRZ A;  3B2F A;  1E9R A;  1TY2 A;  2DZI A;  2K9X A;  2CUZ A;  3VFK A;  2XN9 C;  5BYS A;  3LXF A;  3EEC A;  1E0Z A;  4FD2 A;  1Q1O A;  1N34 M;  1SSN A;  3UMM A;  4ZOH C;  2DNF A;  3Q3F A;  4GXB A;  1G71 A;  2JRI A;  1YUB A;  4KGR A;  3GO8 A;  1Y08 A;  1MU5 A;  3SAR A;  4S0R A;  2UZJ A;  1KHQ A;  1YJJ A;  3BPM A;  2I7N A;  3K8Z A;  1MX0 A;  4CHT B;  3U6Q A;  1PFD A;  3TEW A;  1AUA A;  2L7H A;  4LRT A;  1L5P A;  2LRW A;  4K3B A;  1YD8 U;  4HK2 A;  2FCM A;  3U2S C;  3B74 A;  5EDS A;  3ZRF A;  4LCB A;  4IP3 A;  1KFX L;  3PFI A;  3NS8 A;  5KO3 A;  3OTO M;  1KTK A;  4RFB A;  5C23 A;  5KPR A;  4FA6 A;  3U5Z B;  3ZNI D;  2QCU A;  1L4Z B;  3H8H A;  3PNV A;  4QNR A;  3W1Y A;  1EWL A;  3IXS A;  1TDH A;  3DFZ A;  4W9K A;  1PUT A;  1GO5 A;  4WWO A;  3LQQ A;  3RNE C;  4US8 A;  3TE6 A;  4MB7 A;  3ZW3 A;  2I1J A;  4B7H A;  1L6V A;  4W9H A;  1CB5 A;  2GFO A;  2D3C A;  2DCA A;  2HL7 A;  2KXJ A;  1S3S G;  2MQJ A;  1ZGU B;  3MHH A;  4HDQ A;  5AUK A;  3AM9 A;  3GPY A;  3OJ4 B;  4PT5 A;  4LJP B;  1DF0 A;  1JAL A;  4EZL A;  4I5S A;  2HJ8 A;  4FWH A;  2N9X A;  3ZQ4 A;  2Z8Y M;  3L27 A;  4LNI A;  2K8C A;  1F29 A;  2DLB A;  2DYO A;  4PS7 A;  3NBI A;  1TH2 A;  1YMH E;  4TKN A;  1A6R A;  3PT2 B;  3GLI E;  1CUK A;  3F92 A;  3HVD A;  3HX3 A;  2O5R A;  3AE5 B;  3KUZ A;  2YVC A;  2RR9 A;  4W9D A;  5GXG B;  2Z0E B;  3DBL B;  3VR9 B;  4N6E B;  1FJG M;  2YJ2 A;  2NQ8 C;  1RYJ A;  1CMX B;  1PPN A;  2UWQ A;  4D8B A;  2D7H A;  3UJN A;  1P98 A;  4G0N B;  2C99 A;  3CTW B;  2LJ5 A;  4YYW A;  2DWL A;  3FYC A;  2LGD A;  5DCN A;  3MTN A;  1QOG A;  9PAP A;  5CHW A;  3B21 A;  5ITT A;  1G3I A;  4YTN B;  3U6C A;  2LZ6 A;  1I4R A;  3BWU D;  1IXS B;  1PRB A;  3QJZ A;  2N7J A;  3DBR B;  3ZTD A;  2P86 A;  1V81 A;  4RGO S;  3NHE A;  4CIS A;  3RI7 C;  1I94 M;  3N30 A;  1MEG A;  4BSQ A;  3KSJ A;  2DZN B;  4DV7 M;  4FAD A;  4YYR A;  4NL4 H;  3IEC A;  4M9S A;  3HU1 A;  3IEJ A;  1VQ1 A;  5E6J A;  2AS8 A;  1EO6 A;  4RM9 A;  3FAH A;  1AIM A;  2AUX A;  4BOP A;  3QJ3 A;  3WAL A;  2G9H D;  2O2V A;  1YK8 A;  1CJL A;  2IBI A;  2JZ3 B;  4PCZ A;  3S3R A;  4GUA A;  4LFA M;  1KLV A;  2WDV B;  5LNK 1;  3P4S B;  4ZTB A;  1Y56 A;  2KW0 A;  1UBI A;  4DR3 M;  2WXG A;  5T8I A;  4J6I A;  5J17 A;  3U61 A;  4PS8 A;  4FJY A;  3SHQ A;  4DUZ M;  3PRE A;  3D8L A;  3GZN B;  3JSV B;  2AYO B;  2Z7J A;  2WXO A;  4JXJ A;  2QP9 X;  1OQQ A;  3R7R A;  3TRK A;  4FUL A;  2ZTC A;  1T6B X;  4ZRI A;  2B1M A;  4W5B A;  4L8R C;  3GS2 A;  2D2Q A;  2FIF A;  2KN5 A;  4BVU C;  2BQQ A;  4X66 M;  3BII D;  5BMG A;  2NQI A;  2ASQ A;  4LGY A;  1GVN A;  1SIJ A;  4L15 A;  2EMT A;  4F7Z A;  5IP4 D;  5JHA A;  2ZVO A;  3I04 M;  3L13 A;  4YTP B;  2PE6 B;  4OZA A;  4FXC A;  1TU6 A;  4LJ4 A;  2BTW B;  4XGI A;  1V1O A;  2J7O A;  4IBI A;  2XEW A;  4HRS A;  2KDL A;  2R6F A;  1UBQ A;  2APL A;  4EIW A;  2K8H A;  2R9N A;  1XEE A;  3K24 A;  2V1Y A;  4YV8 A;  3AOE A;  3AOE C;  3SAV A;  2D7E A;  3K92 A;  3GLI A;  3T15 A;  3P5U A;  4QBB A;  3D8B A;  4QAY A;  3PV1 A;  2LI5 A;  2NVU I;  3BPF A;  2GBM A;  3PZD A;  4BPV A;  3OVX A;  4AZF A;  2LHC A;  3U5Z A;  1NV9 A;  4WA6 A;  4NPN A;  4LFB M;  1XKG A;  2SAK A;  1SE3 A;  2ONQ A;  3P63 A;  3ZXV A;  3D32 A;  4BKG A;  2XBB C;  1FFV A;  5AZG A;  2I2Y A;  2OP3 A;  1Q0W B;  4XBO A;  4RMA A;  4GC9 A;  4B95 A;  1PGB A;  4M9Z A;  1QAN A;  2KWC A;  2TSS A;  4XE0 A;  1WM3 A;  3TL4 X;  1KOT A;  4GDL A;  3GCB A;  5FK9 C;  1IN6 A;  2YLM A;  3MC9 A;  4MDK E;  1C78 A;  4IBJ A;  1WX8 A;  3V3X A;  5LMU M;  2KVZ A;  1WYW B;  2PIA A;  1SIF A;  2JQR B;  2FUG 1;  3AL0 C;  3NOB A;  3E46 A;  3KVF B;  1OIZ A;  4L4U A;  2N9K A;  4S12 A;  4QH6 A;  4B08 A;  2L83 A;  4AP4 C;  1XF5 L;  2R4E A;  4G6Z A;  1VSN A;  3PRM B;  3WAP A;  2LAS A;  1UD7 A;  2KMA A;  3HHW A;  3KWV A;  4I6N B;  1MPE A;  5D7G A;  4PYU A;  4GU2 A;  3PT2 A;  2CHW A;  2LEK A;  1AIP C;  1QQW A;  3RGS A;  5ITY A;  4CGY B;  3T1H M;  2DZK A;  4MT5 A;  4LF4 M;  4P6V F;  2GHU A;  3K9O B;  1P0R A;  1NLJ A;  1V2Y A;  3V6C A;  2VII A;  2BJV A;  3IT4 B;  2K6Q A;  3BOS A;  3Q3O C;  1QDQ A;  1K51 A;  2ZCC A;  1WYG A;  5TSS A;  1M4V A;  1FNV A;  2BPS A;  2PVG C;  2YEP B;  3VDZ A;  2DX5 B;  1FO4 A;  3UGB B;  4WWN A;  1YIW A;  4KSL C;  3Q8A A;  2DWN A;  3AE3 B;  2JPH A;  3CBK A;  1K52 A;  2B3T A;  2HDE A;  3CST A;  4AJY B;  2BB6 A;  1YT7 A;  2HWJ A;  2VF8 A;  2NPT A;  2AWT A;  4F8C B;  4YXD B;  3QX1 A;  1P7E A;  2ZJD A;  4N4Z A;  1PIP A;  2EKK A;  3L4P A;  2L4E A;  1PPO A;  2UXC M;  4Q8G A;  3KKU A;  2LWP A;  1GKI A;  3UQB A;  3R3M A;  1ZCM A;  4DR7 M;  1AYF A;  2LD9 A;  3TBL D;  2CV2 A;  2WXI A;  2KO3 A;  5D94 A;  2WXK A;  4MGZ E;  2B3A A;  2DCC A;  2JF5 A;  4QOZ C;  2KWD A;  3LMM A;  4YYQ A;  3P5X A;  2HD5 B;  3AU5 A;  4LK0 M;  4NZL B;  2DZM A;  3CBJ A;  4FBJ B;  4A8X C;  3MK6 A;  1NI3 A;  1NV8 A;  2D11 A;  3ILK A;  2JUJ A;  3KSX A;  3C19 A;  3RFZ B;  3T3N A;  1N5X A;  3U6P A;  2DYB A;  2LVO A;  4DBG B;  1FNW A;  3O65 B;  1LGR A;  2G45 B;  2MLB A;  1RFK A;  3FKE A;  3GLH E;  5ITQ A;  4I4L A;  1E9M A;  3UIN B;  3O0U A;  1KXR A;  2FID A;  2C96 A;  2G5G X;  1WXV A;  3V6E A;  4IC7 B;  2IGH A;  2RGO A;  2XFT A;  4FHK A;  1ZOY B;  3U8Z A;  1DEU A;  1XNQ M;  3RNV A;  1FEH A;  4D8I A;  3AB5 A;  4BLC A;  2ZNV C;  2FRA A;  2KDI A;  3TWK A;  2GBK A;  2LHD A;  4DDG D;  3DA1 A;  2AYO A;  4ZDV A;  3WXG A;  1IY2 A;  4DUY M;  2N7E A;  2KK8 A;  1OEY A;  2YR0 A;  4MEL A;  4QRV A;  4GIV A;  2E02 A;  2INN E;  3ZRC A;  1PDX A;  4DHJ B;  3PHX A;  4X6I A;  1HZ6 A;  4ACF A;  4C7Y A;  2EKI A;  4K3C A;  3VH4 B;  4DQO C;  3RNG C;  2WDQ B;  3VTW A;  2DZO B;  1EM7 A;  4B7G A;  3Q8C A;  1QT9 A;  4KZ0 A;  1FXA A;  2OHF A;  4DR6 M;  1J0G A;  1HQC A;  2KJR A;  3O13 A;  3R8F A;  2BTW A;  1C1K A;  3LB8 C;  1QDR A;  4DR2 M;  4CYE A;  3B7Z A;  3AEA B;  5KHO A;  1NO1 A;  5CVO B;  4HXD B;  3PZ8 A;  3H4M A;  4YSZ B;  4GIP A;  1OFI A;  3KUD B;  2KRU A;  2HXZ A;  1TKY A;  4B0M A;  2W9N A;  3QCA A;  3SYK A;  1GNU A;  1SJH D;  1C4P A;  2O6V D;  3VTV A;  1EWY C;  2MEK A;  3H8C A;  3W5U B;  3C0R B;  5EE3 A;  2R9O A;  4YL8 A;  2Z4R A;  4XDD A;  2FOI C;  3JW0 X;  4NSR A;  1WGH A;  2MX2 A;  3C3D A;  3R9X B;  4A5U A;  3FTE A;  4Z6Y A;  4RGN A;  2WXL A;  3X0W A;  3GPX A;  3M63 B;  3A9J B;  3FUX A;  3F75 A;  5EF4 A;  3H7S A;  4RKX A;  4DV4 M;  4P7I A;  1XCQ L;  3BXW A;  1R4N B;  4NSO B;  3DQV A;  3R7Q A;  1N5W A;  1I4G A;  3HM3 A;  3M6A A;  2N1W A;  1MHW A;  1AWD A;  4G3O A;  2F5S A;  3C9P A;  4B3T M;  2WXM A;  4K7S A;  4FIP A;  3WAN A;  1EU3 A;  4B0E A;  2Y5B B;  1WHC A;  3CSF A;  2JVC A;  1NNU C;  1IQP A;  3Q8B A;  3HY5 A;  4RH6 A;  4ZRP A;  2UXB M;  3HRD D;  4C7Z A;  1B1Z A;  3N1Z C;  4IDI A;  4N79 A;  4JI2 M;  1FNU A;  3TEZ A;  2KNZ A;  4GKK M;  3ONS A;  3J81 S;  4I05 A;  2KJH B;  4XK8 F;  2KVR A;  2X38 A;  3HK0 A;  2HTH A;  3GLH A;  4JWU C;  4L16 A;  2K0P A;  2WZJ A;  3HWN A;  1SE2 A;  2N9L A;  4FN2 A;  3KWL A;  1NI2 A;  3CWI A;  5BYQ A;  1VZ7 A;  3U52 E;  1E32 A;  2WXF A;  1UM8 A;  2DAG A;  4EUT A;  1KH0 A;  4HPM B;  3K9P B;  1NEN B;  1V6E A;  4KSK C;  1V80 A;  1XB2 B;  3BVZ A;  1N36 M;  2AGA A;  3HHY A;  1SJE D;  3N1X C;  4ANR A;  1CVZ A;  4IM3 A;  3DZD A;  2AQ2 B;  3I4Y A;  1L2D A;  1HXY D;  2UU9 M;  4ZRQ A;  2K8B A;  1I4P A;  1ISN A;  1JB0 F;  4DMY A;  3FC4 A;  1GJT A;  4EZK A;  1NDD A;  2DXI A;  4TUW A;  2RDH A;  2RD0 A;  3ZTC A;  1L2N A;  3KWB X;  4S17 A;  2H89 B;  3TL5 A;  2FNJ B;  3PHW A;  3KW9 A;  3B9J A;  1L6U A;  4MSM B;  1MIR A;  2O6V A;  3H7P A;  1WJN A;  4DBG A;  3KDS E;  7CAT A;  2F5P A;  3I4V A;  3O65 A;  1OGW A;  4G11 A;  4MJS B;  1AAR A;  1CSB B;  4W9J A;  3AUL A;  3QK0 A;  4FVM A;  2DAF A;  4BKT A;  1Y8R C;  3B7N A;  1BXT A;  3HD3 A;  5IKC M;  4IBF A;  4HCN B;  2IO2 B;  2PPH A;  3KOW E;  3B0A A;  2CFO A;  2ZAN A;  1YX5 B;  1YNT E;  2M17 A;  3F5V A;  4RNA A;  3I01 M;  5C18 A;  2K3U A;  4P17 A;  3DF0 A;  4FCT A;  2WDR B;  3DBH B;  1N63 A;  4KO8 A;  3BBA A;  1V5O A;  4TSS A;  3UIO B;  3WIM A;  1C77 A;  1CTE A;  2JWU A;  2IJ0 A;  1D0M A;  3SYL A;  2WX0 A;  2Z8L A;  2Q5W D;  2D3A A;  3UI3 A;  2LBC A;  2WSC F;  1R7R A;  3MHS D;  1HQY E;  2V3P A;  2WGS A;  3OLM D;  3DWG C;  2KN4 A;  4W5W A;  5L83 A;  1BQI A;  2L7R A;  4JGH B;  1PM5 A;  5CHF A;  4BBA A;  3ZGZ A;  1TKG A;  5IWA M;  3M99 A;  4H2A A;  1E90 A;  3AU4 A;  2MRP A;  1HEZ E;  2HKJ A;  1PE6 A;  3BC3 A;  3FIL B;  3W31 A;  2UUB M;  2MH7 A;  4HDO A;  1YJ1 A;  2EO2 A;  1P3Q U;  1Z5S B;  3BIN A;  4AOF A;  2J7Q A;  1GC7 A;  2J7Q C;  1OTR A;  3GRY A;  1UZX B;  3QSD A;  3PW3 A;  3A45 A;  5E6P A;  4HPL B;  2OUL A;  1PGA A;  3ZDM C;  1W5S A;  4F1I A;  4KKJ A;  1ET6 A;  5E6N A;  1V8C A;  4DWF A;  1F2B A;  3FKY A;  2XU1 A;  3OIS A;  1SG9 A;  3GQ5 A;  4YSX B;  4BQV A;  3C0R A;  2JXN A;  2M0X A;  2LUM A;  1VEK A;  5H8Y E;  1WM2 A;  2LVP A;  4LJA A;  3I3T B;  2LVP C;  1U9X A;  3OVZ A;  4GC5 A;  4HCP B;  3BYY B;  1F2A A;  4A9A A;  2CV0 A;  1YE9 A;  5CVN B;  4KZC A;  1KSF X;  4WQM A;  2G3Q B;  3AI8 A;  3VUX A;  3A9J A;  3FUT A;  2ACZ B;  4I07 A;  4A90 A;  2HTM E;  2XF3 A;  3A4R A;  2J53 A;  1WRI A;  2RSU A;  3MHV C;  1IP9 A;  1OQY A;  2K1F A;  2IDY A;  1N61 A;  4EKU A;  3ABV B;  3RFW A;  3VLF B;  4CDF B;  3RVX A;  2ZAM A;  2Y5B A;  2E6X A;  3T3O A;  3PVL A;  4LF5 M;  1IXZ A;  1EUV B;  1E8Z A;  3IG3 A;  3AE1 B;  1NHG C;  3ZNH A;  2Q2E B;  3U7D A;  4II7 A;  1YN4 A;  1NJG A;  1XXH E;  1R2Z A;  1DGJ A;  1C4C A;  2PW9 A;  1R5L A;  1LFD A;  4IBD A;  4JQW C;  1WX9 A;  4D81 A;  2IO0 B;  2WNM A;  2DAI A;  1VEG A;  3OAW A;  5FTN A;  2OOB A;  1R7S A;  1V49 A;  4IUM B;  2J52 A;  1CK1 A;  1K3X A;  2KWU B;  3ZDT A;  3P42 A;  2JP7 A;  2FH0 A;  4MM3 A;  1JQ4 A;  3MHS A;  4ARI A;  1QLB B;  3ZJV A;  1XLP A;  4HLE A;  2KHH A;  2INP E;  3ZLZ A;  1I42 A;  1AW7 A;  2VF7 A;  1H8C A;  4GN1 A;  1L2C A;  1FCC C;  3DVN U;  1MEM A;  2FCS A;  4QHS A;  3ZQJ A;  3M62 B;  1JRO A;  3ZC7 B;  1XHB A;  4HKZ E;  4LRS A;  2DYM A;  2I1K A;  5EE9 A;  2IGD A;  1Z59 A;  2UYZ B;  2IZV B;  1XXG A;  2KAJ A;  4LTU A;  3IHP A;  3HIZ A;  4XWT A;  3VKG A;  1SEB D;  2FE8 A;  1K3W A;  1WE7 A;  1M6D A;  3R2I A;  3BY4 A;  1FCL A;  4C4V B;  1UH6 A;  4GKJ M;  4HJK A;  4DXG A;  1J7K A;  1K82 A;  1Z2M A;  1JRP A;  1GL7 A;  2QIE B;  4ZYN A;  2AQ3 B;  4LNK A;  1ME3 A;  4II3 B;  1MG4 A;  4W9F A;  1OIP A;  4YVA A;  1T0S C;  1T5X D;  1PGY A;  4P6G A;  1ENF A;  4B9K A;  4NAM A;  3HJS A;  1U4A A;  2INC C;  4OZC A;  2W55 A;  5FR6 A;  2ZEQ A;  2AVW A;  2OZ2 A;  4MZO A;  2NMQ A;  2HAK A;  2V9H A;  2D07 B;  2HHN A;  2QC8 A;  3VRA B;  3T6P A;  5JXV A;  4L78 A;  4EZJ A;  2L7I A;  1D0K A;  1T3Q A;  3B2G A;  2DC8 A;  3BCN A;  2KT7 A;  3AEC B;  3IOQ A;  2AL3 A;  1WH3 A;  1EWM A;  4WAA A;  3Q8G A;  3RT3 B;  4ZYS A;  2E3T A;  1FH0 A;  4IKG A;  2DC7 A;  2JY6 B;  2N7D A;  4XDC A;  1IUE A;  3WHL A;  1WF9 A;  2HJ1 A;  1D4B A;  3GB1 A;  2RPV A;  2KNV A;  4DV1 M;  2BWE S;  2KKC A;  2CRU A;  3BK2 A;  4FCW A;  5ITX E;  2PE9 A;  4LZJ A;  4PI3 A;  3PRP B;  3N9Y C;  1WJU A;  2G6D A;  1FRD A;  5HHD G;  3IV2 A;  1L0V B;  3L16 A;  1D6E C;  1P3Q Q;  3C3E A;  4YYU A;  4MGH A;  3H8B A;  4YYS A;  4B7F A;  2ERC A;  2K9D A;  3APF A;  4XZX A;  1NY6 A;  3RYT A;  3FIL A;  4RY2 A;  1SXJ B;  2D7G A;  1RLF A;  2JZ0 A;  3SEB A;  4G54 A;  2MBO A;  1T0Y A;  3KWZ A;  2M5Z A;  3QC8 B;  2KJ6 A;  3A9K B;  1NNJ A;  4DHZ B;  4MGY E;  1ZPS A;  3MP2 A;  4A3P A;  4TV3 A;  1WX7 A;  2DHY A;  2JX5 A;  1VDL A;  2RDB C;  3AV8 A;  3KYD D;  1ME4 A;  2FQ9 A;  2R4J A;  2FRQ A;  3H89 A;  4ZUX U;  4GIT A;  1FIQ A;  1I4H A;  4FWG A;  3SFZ A;  1V9J A;  3B7Q A;  3TEX A;  1CPJ A;  1SF0 A;  1XXH A;  2JA2 A;  3HU3 A;  3NY5 A;  4PDG A;  2QHO B;  4BBN C;  4AKG A;  2Z3X A;  1V1P B;  3NUH B;  1J8C A;  4NC6 A;  2N0S B;  3SDL C;  3P5V A;  2W54 A;  4LJ8 A;  4A3V B;  3RD2 A;  3I3T A;  3U8E A;  3NRZ A;  3WXE A;  2X49 A;  2G3Q A;  2Y0Q A;  2KFK B;  2FO5 A;  3AKZ A;  3SD5 A;  2C98 A;  1G4A E;  4N9F 4;  3BB7 A;  4KIK A;  3U6E A;  2VRR B;  3IG5 A;  2BYV E;  3FTC A;  2ARY A;  1R4M I;  3EFC A;  4G4Q A;  5JA7 A;  4B6W A;  3L28 A;  5J94 A;  1MHX A;  1WXM A;  1P1A A;  2GB1 A;  3QA8 A;  3KP0 E;  1ZE3 D;  2KDB A;  3KSE A;  3AV0 A;  5TR5 A;  3ZO5 B;  1NYR A;  3H6N A;  1R4G A;  3M3J A;  3FRH A;  4FJV B;  2DZJ A;  2YJB A;  4NOO B;  1LM8 B;  2D5G A;  4YHH M;  4D2K A;  3ML8 A;  3MC0 B;  3VQI A;  4ZRJ A;  3W5V B;  1U5I A;  2K39 A;  4JIO U;  4XX5 A;  4DMX A;  2MH8 A;  3CMM B;  5D6J B;  2JTC A;  3H1U A;  2JNH A;  2GLS A;  1GMY A;  1RWS A;  2RPQ A;  2KEB A;  2D10 A;  4LF8 M;  3M7G A;  5F02 A;  5HFY A;  2CS4 A;  3GLF B;  3RCZ A;  4NJ6 A;  1MHH E;  3LVW A;  1I4Q A;  4II2 B;  3U7Z A;  2W82 A;  3C8Y A;  2FS1 A;  3AEF B;  4PYZ A;  3ZIM A;  1U9Q X;  1QZM A;  2WXR A;  4ARC A;  2F4V M;  1WXQ A;  3O1G A;  4PP1 A;  3C9E A;  4LF9 M;  4KHP M;  4OVV A;  1U9W A;  4JLC A;  4I04 A;  3IFW B;  1QQR A;  1WZ0 A;  4ASW C;  5ITX A;  1NL6 A;  2HWK A;  1Q39 A;  2L3Z A;  3AEG B;  1R6B X;  2XFS A;  2K6D B;  4ITK A;  4ANU A;  3VK7 A;  1AYV A;  1J7C A;  3W2D A;  4GRI A;  1HR0 M;  4KX6 B;  2FAZ A;  4IM2 A;  3NVZ A;  2L0T A;  4IG7 B;  4R7G A;  1A5R A;  2KFJ A;  1NVI D;  4K7U A;  2IY0 B;  1MVK A;  4NXM M;  1STF E;  1ZQ9 A;  2G7Y A;  1TBE A;  4Q8H A;  4AI6 A;  1WWT A;  2ZPN A;  1L2B A;  1SE9 A;  1BGO A;  4AXM A;  3V05 A;  1ZAE A;  4JPS A;  3SU8 X;  3K9M A;  2CIO A;  3KW6 A;  1NB5 A;  4PS3 A;  1T3T A;  3DBS A;  1DGH B;  3GLF E;  5E6O A;  3HM6 X;  2JWZ A;  4C00 A;  3LCU A;  2JRH A;  3OQC A;  2R46 A;  5JH5 C;  4OVZ B;  2WWZ A;  2CE7 A;  3H6S A;  2MWS B;  1IN7 A;  2FYE A;  4HVB A;  3TIX A;  5PAD A;  4DV3 M;  3KX1 A;  1QOL A;  2G8L A;  2KDF B;  3W1S A;  5LMN M;  5DYG A;  2IO1 B;  4PDI A;  2J42 A;  1UGM A;  3K2L A;  2KX0 A;  2QMT A;  4IWO A;  1HE8 A;  3DPD A;  2C9W B;  2LRU A;  3J7B A;  3KUC B;  4M0W B;  3PRP A;  3S2A A;  5LXH A;  1QMY A;  5A2Q S;  3SAU A;  2MP2 B;  4J3O D;  3U6L A;  2XU3 A;  3BZD B;  4US9 A;  2ICI A;  2PAD A;  2JZZ A;  1N75 A;  1ZXI A;  2C9O A;  3NZ3 A;  5FTK A;  4GDK B;  1U9V A;  2R2O A;  2OPF A;  5JHB A;  3L25 A;  3HHZ A;  1WGN A;  4WJP A;  2LNH C;  1ZXH A;  3PTF C;  3KVW A;  2BYF A;  4L6V 6;  5ITU A;  3HUI A;  3KQ4 A;  4FJC A;  3GQ3 A;  1ZMU A;  1D2N A;  2WXP A;  3QT4 A;  2Y21 A;  3DHI C;  1E10 A;  1YSY A;  3L08 A;  5CHV A;  1V92 A;  5F3W A;  4CIZ A;  2MBB B;  1IN4 A;  1XMO M;  3BWK A;  2E01 A;  2KAC A;  3E21 A;  1V97 A;  3DOW A;  4R71 A;  4F1S A;  1KLG D;  2JY8 A;  1IY1 A;  2KTR B;  3BVM A;  1VG5 A;  1IXS A;  3Q8X A;  3Q2A C;  1OEY J;  2QHO A;  2CHV A;  3SC3 A;  2MSE D;  3N4C A;  3JR5 A;  2DVW B;  4FJZ A;  3I06 A;  1F1H A;  2H7J A;  4QHT A;  1V1P A;  1XC8 A;  3IG8 A;  1LTM A;  3KH0 A;  3IUT A;  5IT9 S;  2KXE A;  4IM0 A;  2JYT A;  5DPR A;  5AZH A;  2C5R A;  2FBW B;  4PK1 A;  4P1B C;  5FPW A;  2KLC A;  3UF8 A;  3SFD B;  5EXT A;  4AKH A;  2BVC A;  1UWX A;  2UXD M;  1E6E B;  1GLO A;  3SAS A;  4DR1 M;  1XQQ A;  2DC6 A;  2VQE M;  3L54 A;  1SXT A;  3LCV B;  2V1C A;  3QYE A;  3MFG A;  1PJQ A;  4OVU A;  1XO3 A;  2Z4S A;  2LVO C;  1AYW A;  1XLQ A;  1AU2 A;  4WWM A;  1WR1 B;  1NPZ A;  2QSF X;  1EF7 A;  4RF1 A;  2DOS A;  2R9M A;  3PVS A;  2WYQ A;  2P7U A;  2BF8 B;  2PMV A;  4OEL A;  1R2Y A;  1H6U A;  1OAO C;  2IO3 B;  2V3S A;  3L2A A;  3JSV A;  2KAN A;  5KQ8 A;  3NJT A;  1OFF A;  4G3X B;  4EE2 A;  4JI1 M;  3U6M A;  2C60 A;  4WWP A;  1EU4 A;  3PPA A;  3Q6B A;  2DI0 A;  4LZZ A;  3B08 A;  2CR5 A;  3DWM A;  3GLF A;  2VDB B;  4G4N A;  4GMQ A;  1TKE A;  2MW5 A;  4TQ1 A;  3X23 A;  2BB5 A;  5A24 A;  2J0J A;  3R8B A;  1S3S A;  3GQ4 A;  4LJ7 A;  2JT4 B;  1F2C A;  4X6J A;  1T0R C;  4RGT A;  2FUD A;  5E26 A;  3T9L A;  1WFY A;  2Y0T A;  4AKI A;  4NRW A;  2FUH B;  1KFU L;  4GHA A;  2CWB A;  4HL4 A;  5BMH A;  1PQS A;  1BY8 A;  1I7H A;  4GMV A;  4URK A;  3TNX A;  2W3R A;  3CF2 A;  1PJI A;  2D3B A;  3ZJU A;  4WAF A;  5IN7 A;  1HUC B;  2N9E B;  3CIR B;  3LJ3 A;  1Q10 A;  3Q14 C;  1THE A;  3W9C B;  1WJ4 A;  2OJR A;  4BOS A;  3GRV A;  3I51 A;  2KDE B;  2JUO A;  5EP3 A;  2VHF A;  1XWI A;  4CHK A;  4XYC A;  3GPU A;  3VUW A;  1XD3 B;  2V6Z M;  5JI3 E;  2M8S A;  3ZNG C;  1WSP A;  3SBJ A;  1G6J A;  4AXL A;  4DV5 M;  1DGH A;  1JWB D;  3DVG X;  4LNN A;  4LJ5 A;  2KOX A;  3HHM A;  2A5U A;  3PSE B;  2N9P C;  3RPF C;  1IYF A;  1HTO A;  4UDU C;  1G59 A;  2LXC A;  3IBE A;  4OVZ A;  5JZE B;  1K50 A;  4REZ A;  2C9C A;  4G4O A;  1F2R C;  2WX1 A;  4AJW A;  3IT6 B;  3DVG Y;  4KDI C;  2G8J A;  3H9D A;  3HZJ A;  1GB1 A;  3R2T A;  1HNZ M;  2KQ4 X;  1TLO A;  4OZB A;  1TZO A;  2BJW A;  5FTL A;  2BS2 B;  2KLG A;  4RGM A;  4DHJ D;  2ON8 A;  4CDC B;  1G8P A;  2B1N A;  2PRE A;  4IBK A;  1AEC A;  3PRM A;  2QEJ C;  3P1M A;  4M0W A;  1IY0 A;  1IN5 A;  1O0E A;  3HWS A;  2R9C A;  1WIV A;  1WR6 E;  5FLX S;  1NQC A;  2JWS A;  1RRB A;  2EMS A;  2MP2 A;  1JQJ C;  3K9O A;  1UGJ A;  4QNM A;  4IOI E;  4GDK A;  3ZKJ C;  4TMA B;  3L10 B;  2EKF A;  2Y20 A;  1EWP A;  4GLS C;  4DXA B;  1F0Z A;  1D5X C;  2DAM A;  3Q3J A;  1JWM D;  2V4L A;  2GBN A;  2AQ1 B;  1TDZ A;  3CGW A;  1XNR M;  2GMI C;  2XZU A;  1TS4 A;  1DOY A;  2PKO A;  6PAD A;  4ANV A;  4I6L B;  2EEL A;  4BBN F;  1X9Y A;  4IBC A;  3W68 A;  1J7B A;  4AG5 A;  2KC2 A;  3QAR A;  1WJ7 A;  1IBX B;  2I7P A;  2GOW A;  3N3K B;  4MZS A;  2OQ4 A;  3FTF A;  2LGS A;  2L00 B;  2JYE A;  2WXQ A;  3QWL A;  1GB4 A;  4NXN M;  1MG8 A;  2FT2 A;  2QPA A;  2G1E A;  4Q2J A;  1TIF A;  3RNF C;  2MHJ A;  2PNS A;  2JY5 A;  2JRI B;  4I81 A;  1T6O A;  3APC A;  1OAI A;  1F9J A;  2HD5 A;  2BYE A;  2JXT A;  2UU7 A;  1EWO A;  2M60 A;  3ZUA A;  2NBU A;  1E8W A;  1AN8 A;  4M01 A;  2NQG A;  3KLS X;  1GPX A;  1RAX A;  5DFL A;  3U6S A;  2LXE A;  2K6B A;  1X1M A;  3J2P B;  4Z8X A;  1E7U A;  3AXC A;  1WR1 A;  4MH8 A;  8PCH A;  3NVY A;  1RU3 A;  3ETR A;  3EC8 A;  4KLN A;  4N58 A;  2H88 B;  2MA9 B;  3GRU A;  1ZDV A;  1YQB A;  3FUU A;  3LVV A;  3I63 C;  2IPP B;  2Z59 B;  1N60 A;  3PNR A;  1QZE A;  4M02 A;  1XLN A;  3AOG A;  5EZQ A;  2ZW1 A;  1V86 A;  3L17 A;  3EUB 2;  4N59 A;  4FW9 A;  2H5X A;  3SHF A;  2REX A;  1TZ1 A;  1DGG A;  1FXI A;  1QAO A;  1UKF A;  1EE8 A;  2J7N A;  1E94 E;  2BS3 B;  3AE8 B;  4IJE A;  3HJQ A;  1QKZ A;  4DK5 A;  3HJ8 A;  1CV8 A;  4A55 A;  5EJC A;  4X6H A;  1GJS A;  1QVR A;  4LLG M;  3A4S C;  4BOZ B;  2J0M A;  1GL6 A;  1PVJ A;  1Y4H A;  2EJS A;  2ZZP B;  1JWU D;  3C58 A;  1A70 A;  2NTT A;  2A5Y B;  3AI5 A;  1MDW A;  2N35 A;  1OQR A;  3UZU A;  4HWY A;  2LGY A;  4LDT B;  4M00 A;  3MMP A;  2JU6 X;  4HXD A;  4BFR A;  1FM0 D;  3AE2 B;  2K47 A;  1L8Q A;  5LXI B;  3U6D A;  3B89 A;  3E9S A;  2MBE A;  3PS6 A;  5EP2 A;  2L32 A;  5I4D A;  2ZW0 A;  1FMA D;  1F4I A;  2DEN B;  5CTR C;  2EA0 A;  2MCN B;  1KM7 A;  3AN1 A;  3J9C A;  4LF7 M;  1IM2 A;  1MS6 A;  1UFZ A;  3N32 A;  3EGR A;  2JZ1 A;  4LGM A;  3OF9 A;  5CX3 A;  4RF0 A;  1JR3 E;  3J27 B;  1J7A A;  3MTN B;  2Z0D B;  2KTF A;  3V60 A;  4L1B A;  1Z5C A;  4BAX A;  4K7C A;  3B9P A;  5ITR A;  3DVN V;  3QIJ A;  2WSF F;  1LV7 A;  5EGW A;  1WGK A;  3ZYY X;  4XR7 A;  3DBL I;  3FD9 A;  4KGS A;  1HJP A;  2AUZ A;  1CZP A;  1ZMV A;  3VFD A;  3SMP A;  3ZNZ B;  1WE6 A;  1FD6 A;  1JR3 D;  2Y3A A;  4WP2 A;  4DV6 M;  3IFU A;  3VDU A;  3E1Z B;  5JH3 A;  2WSE F;  4ITQ A;  2BTE A;  1VEJ A;  2CHG A;  3NS1 A;  1AU3 A;  5GMV A;  2R2Q A;  1JCK B;  3T8M A;  1DO0 A;  1OJL A;  4KT0 F;  4DXF A;  2YJ9 A;  1QAM A;  3L29 A;  1TTE A;  2MBQ A;  3QWZ B;  3HHA A;  4NJC A;  4HEA 1;  3TMP B;  1NB3 A;  1N77 A;  1VZ8 A;  1QUT A;  3DBR I;  1PPD A;  4I8O A;  2O2V B;  1ZV1 A;  1IFY A;  2IBI B;  1QXP A;  2R62 A;  4ANW A;  1DOI A;  5J18 A;  5H37 D;  2DCB A;  1WY8 A;  2QCZ A;  1XCT L;  5IZ7 D;  1F52 A;  1I4X A;  4HPP A;  2BWE A;  2LXA A;  3U61 B;  3TWL A;  2DWM A;  2SEB D;  2OED A;  1UUP A;  1KFV A;  3K9P A;  1XMQ M;  1TYG B;  3DCG A;  1B9R A;  5GKN A;  2ACT A;  2DCD A;  4LF6 M;  3D6S A;  3N3K A;  1NVM A;  2I38 A;  1RFA A;  3IHP C;  2CHZ A;  1GEC E;  4JYA M;  3HHI A;  3IVF A;  3ZUN A;  7PCK A;  1Y8G A;  1HQR D;  3JYU A;  2R61 A;  2CHX A;  5FKA C;  1J19 A;  1QAQ A;  3GZN I;  4NJ7 A;  3GLG B;  1QOA A;  1UWM A;  4W4U A;  1CS8 A;  2KC1 A;  4C56 C;  5BMI A;  4XZ4 A;  1ICF A;  1C4A A;  5D2M B;  3NZU A;  1L1T A;  2LJI A;  1ESF A;  3KOZ E;  2M19 A;  4KGT A;  1V34 A;  4MJS A;  2DZZ A;  1H4R A;  3GLI B;  4AW4 A;  2VH2 A;  3KS4 A;  2K5P A;  2ZAO A;  4E71 A;  3CH2 X;  4BS5 A;  2GQF A;  3PHU A;  3TJP A;  3ZJT A;  1G41 A;  4R3D A;  2PJH A;  3NG0 A;  3NVV A;  1Q3C A;  3IAM 1;  2CJN A;  1TS2 A;  4WH4 A;  1C3T A;  2JQF R;  2J4X A;  4MSQ B;  1ATK A;  1JR3 A;  1YOV B;  1V33 A;  2WXH A;  3BVG A;  4JI0 M;  3OF8 A;  5IA7 A;  5D3D A;  1I4W A;  1CQD A;  4FK5 A;  3FYD A;  2K22 A;  3ZH9 B;  1ROE A;  2D3G A;  3PLV A;  4GDL B;  2XSZ D;  3ZCB B;  3VTU A;  1GOZ A;  5MPO A;  4BOZ A;  1VLB A;  3PDF A;  3JR4 A;  4YTM B;  3GLG E;  1ZDX A;  2ZTD A;  2YJ8 A;  3NVW A;  1FFU A;  1XLO A;  1SNK A;  2WS3 B;  4DV0 M;  2WU2 B;  1TGU A;  2C7M B;  2CHQ A;  4FWD A;  3AEB B;  3RNA C;  2BBC A;  4FLH A;  4A3O A;  3E56 A;  3FUW A;  2WQY B;  2QNJ A;  1WGD A;  3EFU A;  1E8Y A;  4KOD A;  2QEN A;  2JSV X;  1WRD B;  2QQ8 A;  1F2R I;  4A20 A;  1IGD A;  2DEN A;  1FXT B;  3V6C B;  1Q3B A;  3P5W A;  3JVZ X;  1D5M C;  3ML9 A;  3LFY A;  3MTV A;  2YQZ A;  3I57 A;  1ET9 A;  2CKH B;  2AEH A;  3ENE A;  2C5L C;  1GAB A;  2R6N A;  2K0B X;  2XLJ A;  3PBH A;  2Z84 A;  4CZW A;  2MJ5 B;  4LJ6 A;  1QOB A;  4MI7 A;  2MJD A;  3MHZ A;  1BT0 A;  2V1U A;  2NBW B;  4LY6 A;  3RMK C;  3VH3 B;  5DPW A;  1FRR A;  2FCN A;  3SAT A;  2NPT B;  2AHM A;  2BU3 A;  1GUA B;  2PVO D;  2H1R A;  4XUI A;  1YLA A;  2LVN C;  5CVM A;  1MJD A;  3AE4 B;  3H4J A;  2LH0 A;  4K0K M;  3L0W B;  5CHT A;  2F7D A;  2RDG A;  2BWF A;  4F2L A;  4HWI B;  2OO9 A;  1SXJ E;  2IY1 B;  2ATO A;  5KHQ A;  3IMA A;  1DV0 A;  4KDL B;  4O1N A;  4WJQ A;  2WDT B;  3TSS A;  4DHZ E;  3Q3M C;  3WCQ A;  4Y28 F;  3PGE A;  2L05 A;  3SAW A;  1W5T A;  1CQV A;  1HT1 E;  3T1Y M;  3TMP A;  1C79 A;  1SXJ D;  2BNK A;  4X64 M;  2YEP F;  3KYC D;  2L52 A;  4L2Y A;  5AUI A;  4LCD E;  2V0G A;  3A42 A;  3V6E B;  4KVG B;  1BML C;  4IUM A;  1VJV A;  4P16 A;  2ZNV B;  3OJ3 A;  4EOY A;  3A1Q B;  2DHR A;  5K16 A;  2O25 A;  2XZF A;  1D3Z A;  2XSZ A;  3LQR A;  3A46 A;  4OHJ A;  2CU1 A;  1YK7 A;  1BP4 A;  1QIL A;  3WHK A;  3UQA A;  2MGW A;  2X4A A;  4X65 M;  4E3C A;  4JWS C;  4FCV A;  3V76 A;  4LFC M;  2BGF A;  4GEW A;  2GI9 A;  2PTL A;  3RNC C;  2RRU A;  3PHX B;  4JV5 M;  3CH3 X;  1WGG A;  3EHV A;  3QAQ A;  3RZF A;  1VDD A;  5G5H A;  4XWW A;  2E00 A;  2BKR B;  4C4V A;  2YJC A;  2KD0 A;  3GLG A;  3BK1 A;  2QJL A;  2RKO A;  3MP9 A;  4JN6 A;  1OFH A;  2CV1 A;  1N32 M;  5IOI A;  5FR3 A;  5L8R F;  3VXW A;  1PJT A;  3HGI A;  2JY7 A;  4D8E A;  1AU4 A;  3E4R A;  3HKP A;  1WMH B;  1Z5A A;  3DHG C;  1Q6K A;  3UGJ A;  2CB5 A;  5BPV A;  3I9V 1;  2GNO A;  1NJF A;  2VZK B;  2NBV B;  3TCA A;  4LJ9 A;  1E5W A;  4XGA B;  4AWJ A;  4I6P A;  5EE1 A;  1E9S A;  3VR8 B;  4IWQ A;  4B3M M;  1WIA A;  5DPS A;  2K25 A;  1L1Z A;  5EXX A;  4X62 M;  4YY3 M;  2V3N A;  2XK5 B;  2FTD A;  2YNM D;  1WZ3 A;  5JI2 E;  4MSX A;  4B3R M;  3W1S C;  1V5T A;  1J09 A;  2JY6 A;  3TEY A;  3MJ5 A;  4NAW B;  2QIL A;  3P4P B;  1KJT A;  3DOA A;  4AG6 A;  3FUV A;  2F5O A;  1N78 A;  2CP8 A;  1ACC A;  4LJO B;  2BS4 B;  2CEA A;  2IGG A;  2DWZ B;  3FE3 A;  3FRI A;  2F1G A;  4D82 A;  1HZ5 A;  1ZUD 2;  2KNB A;  4OU7 A;  4HEO A;  4IBG A;  1GCB A;  2P5T A;  2JXX A;  5FTM A;  2XEP A;  1N33 M;  3URY A;  3KS8 A;  1GG3 A;  5HG2 A;  2NR2 A;  3AE6 B;  4BKS D;  3KFQ A;  3KOX E;  3AMZ A;  4QRX A;  1Q5W B;  1L0X B;  1DKI A;  2M4N A;  5C1Z A;  1SXJ A;  4BB9 A;  2AYN A;  3NBX X;  1SXJ C;  1IBK M;  1FNN A;  5KPT A;  4NY0 A;  2HE7 A;  2PBH A;  1DO2 A;  1VD2 A;  3AH7 A;  1EFU B;  5L95 C;  2M1M A;  2WLB A;  1YZB A;  3A9K A; 
#chains in the Genus database with same CATH homology
 3GPP A;  1TS3 A;  5EP4 A;  2B76 B;  4RCO A;  3PO0 A;  5EP1 A;  3VKH A;  5EXP A;  2KZS A;  2CJO A;  2L1A A;  2AX5 A;  2KMM A;  2FNA A;  3GLH B;  4CQN A;  3UK6 A;  5C2T B;  2KZU A;  4GHL A;  4QOS A;  2VZK D;  4NRV A;  4PD2 A;  2UUA M;  3P4Q B;  3SFE B;  3J7A S;  3HVZ A;  1ZP0 B;  2MJ3 A;  3AEE B;  1C9F A;  3SHG B;  1IBM M;  3AFH A;  3EIE A;  1HA5 A;  1Z6T A;  3M0E A;  1HT2 E;  2EUC A;  3U60 B;  2WXJ A;  1X37 A;  3P4R B;  2LMC A;  2M0A A;  1NYQ A;  5C3J B;  3RGP A;  2HCB A;  2BW2 A;  1TH4 A;  2FFJ A;  1TY0 A;  4JI6 M;  4B3S M;  3KXE C;  1UNS A;  4D80 A;  3KFU G;  1KYI A;  1JWS D;  5BYR A;  4HRO A;  3TWM A;  1C76 A;  4TQ0 A;  1TS5 A;  3AE7 B;  2DBY A;  3J80 S;  2X8A A;  2Y5C A;  1QOF A;  1IBL M;  2UUC M;  3W0L B;  3T38 A;  3VK8 A;  2V4I B;  2ZM6 M;  5KQD A;  2RGH A;  5EZS A;  4YSY B;  1YQ4 B;  3VDP A;  1STE A;  4JI5 M;  2W3S A;  2WU5 B;  2R65 A;  2MJE A;  1VZ6 A;  4AQ7 A;  4YT0 B;  2F5Q A;  4BOQ A;  3A98 B;  4LG2 A;  1YN3 A;  4IIW A;  3NWL A;  3TPZ A;  1F77 A;  3SR6 A;  1J5E M;  3W0F A;  1Z5B A;  1QF6 A;  3KP1 E;  3OWE B;  2WXN A;  3EA6 A;  5BR8 M;  4DR4 M;  2RMM A;  1YJI A;  5G5G A;  1GLN A;  1CJE A;  2QBY B;  3CF6 E;  1ORY B;  5FTJ A;  2F5N A;  1HNW M;  5EE0 A;  4MH0 E;  3K1J A;  3IAS 1;  2NTS A;  2DWQ A;  4BOU A;  1NEK B;  1SBB B;  2E5L M;  3FTD A;  4ZHO A;  3KOY E;  4IJF A;  2QZ4 A;  2KRK A;  3TUO A;  2IPK D;  3GRR A;  1PYW D;  1SE4 A;  3CF0 A;  1N62 A;  2QSD A;  2LWX A;  5DNY A;  4OW0 A;  3QAU A;  2BT6 A;  1JWA D;  2XH9 A;  1KLU D;  4WUR A;  1NSF A;  1RM6 C;  3LYY A;  1KRH A;  1L4D B;  3GP7 A;  3Q69 A;  4OX9 M;  4JI8 M;  2XGN A;  4YWG G;  2PLP A;  4MM3 B;  4A6Q A;  4L23 A;  2BYT A;  1KFY B;  3AE9 B;  4GH9 A;  3AED B;  1PJJ A;  1DGB A;  3GP1 A;  1IXR C;  4MGK E;  3Q8F A;  4MAC A;  3VRB B;  2R45 A;  2R18 A;  3PXG A;  3U60 A;  2WP9 B;  2YFQ A;  8CAT A;  4AQY M;  2Y5P A;  5FSW A;  1DOX A;  4ZPX A;  3EIH A;  3THG A;  4HKQ A;  1QYR A;  4JI3 M;  2HHH M;  3Q8E A;  1VRA B;  3U4E G;  4DV2 M;  2ZBK B;  4WW0 A;  1P7F A;  2LFI A;  1MI0 A;  4HLQ A;  5IRE B;  1YN5 A;  4USA A;  2L6O A;  4MGI E;  2JZP A;  3TQS A;  1PGX A;  1YQ3 B;  5EXS A;  4JE3 B;  5D3I B;  3JAM S;  1VR9 A;  5EQT A;  1K53 A;  3AJI B;  4G4R A;  2VQF M;  3RE8 A;  1VJK A;  1VDV A;  1BUI C;  4ZHP A;  4JI4 M;  4JX1 C;  1JW9 D;  5C1B A;  3PNY A;  1IN8 A;  1LO5 D;  4C80 A;  1IGC A;  1HNX M;  1KF6 B;  2KA6 B;  3PSE A;  2QBY A;  5JZE A;  4WIP A;  1JML A;  1XXH B;  1NHW C;  4HJG E;  4M0D A;  5H92 C;  3HHX A;  4IBE A;  2LGI A;  5HI1 A;  1SB3 C;  1DGF A;  1TH3 A;  1TJE A;  4M9X A;  1DYQ A;  3L26 A;  1GAQ B;  2XNA C;  3BYT B;  2GRI A;  4AS1 A;  3W30 A;  4IBB A;  2KDM A;  2CU3 A;  1NY5 A;  4KKI A;  3PZ7 A;  2LHE A;  4DR5 M;  3HU2 A;  1E7P B;  1EWC A;  2M56 B;  5DYI A;  4JI7 M;  1L0Y B;  5KPZ A;  3U6O A;  3SMS A;  1D5Z C;  2L09 A;  1IBX A;  3B2F A;  1E9R A;  1TY2 A;  2K9X A;  2CUZ A;  2XN9 C;  5BYS A;  3LXF A;  1E0Z A;  4FD2 A;  1SSN A;  1N34 M;  3UMM A;  4ZOH C;  2JRI A;  1YUB A;  4KGR A;  3GO8 A;  1MU5 A;  3SAR A;  2UZJ A;  1YJJ A;  2I7N A;  3K8Z A;  1MX0 A;  4CHT B;  3U6Q A;  1PFD A;  3TEW A;  2L7H A;  4LRT A;  1L5P A;  3U2S C;  4LCB A;  4IP3 A;  3PFI A;  4RFB A;  5KO3 A;  3OTO M;  1KTK A;  5KPR A;  3U5Z B;  2QCU A;  1L4Z B;  3H8H A;  3PNV A;  4QNR A;  3IXS A;  1TDH A;  3DFZ A;  1PUT A;  3LQQ A;  4US8 A;  3TE6 A;  4MB7 A;  4B7H A;  1L6V A;  2HL7 A;  5AUK A;  3AM9 A;  3GPY A;  4PT5 A;  1JAL A;  4I5S A;  4FWH A;  3ZQ4 A;  3L27 A;  2DLB A;  2DYO A;  3NBI A;  1TH2 A;  1YMH E;  3HVD A;  2O5R A;  3AE5 B;  5GXG B;  3VR9 B;  4N6E B;  1FJG M;  2NQ8 C;  1RYJ A;  4D8B A;  2D7H A;  3UJN A;  2C99 A;  3CTW B;  2DWL A;  3FYC A;  1QOG A;  3B21 A;  5ITT A;  1G3I A;  4YTN B;  3U6C A;  1I4R A;  3BWU D;  1IXS B;  2N7J A;  4RGO S;  4CIS A;  1I94 M;  3KSJ A;  2DZN B;  4DV7 M;  4NL4 H;  4M9S A;  3HU1 A;  5E6J A;  3FAH A;  4BOP A;  2G9H D;  4PCZ A;  4GUA A;  4LFA M;  2WDV B;  5LNK 1;  3P4S B;  4ZTB A;  1Y56 A;  2KW0 A;  4DR3 M;  2WXG A;  5T8I A;  3U61 A;  4DUZ M;  3D8L A;  2Z7J A;  2WXO A;  4JXJ A;  2QP9 X;  1OQQ A;  3TRK A;  1T6B X;  4L8R C;  3GS2 A;  4X66 M;  3BII D;  5BMG A;  1SIJ A;  1GVN A;  4LGY A;  4L15 A;  4YTP B;  4OZA A;  4FXC A;  2BTW B;  4LJ4 A;  4XGI A;  1V1O A;  2J7O A;  4IBI A;  4HRS A;  4EIW A;  1XEE A;  3AOE A;  3AOE C;  3SAV A;  2D7E A;  3K92 A;  3GLI A;  3T15 A;  3D8B A;  4AZF A;  3U5Z A;  4LFB M;  2SAK A;  1SE3 A;  2ONQ A;  3P63 A;  1FFV A;  2I2Y A;  4XBO A;  4GC9 A;  1PGB A;  4M9Z A;  1QAN A;  2TSS A;  4XE0 A;  3TL4 X;  5FK9 C;  1IN6 A;  4IBJ A;  1C78 A;  3V3X A;  5LMU M;  2PIA A;  2JQR B;  2FUG 1;  3AL0 C;  4L4U A;  2N9K A;  4S12 A;  4B08 A;  2L83 A;  1XF5 L;  2R4E A;  4G6Z A;  3HHW A;  3KWV A;  3PT2 A;  1MPE A;  5D7G A;  2LEK A;  4CGY B;  1QQW A;  3RGS A;  5ITY A;  3T1H M;  4MT5 A;  4P6V F;  4LF4 M;  2VII A;  2BJV A;  3IT4 B;  3BOS A;  1K51 A;  1WYG A;  5TSS A;  1M4V A;  1FNV A;  2PVG C;  2YEP B;  1FO4 A;  3Q8A A;  2DWN A;  3AE3 B;  1K52 A;  2HDE A;  2BB6 A;  4YXD B;  1P7E A;  3L4P A;  2UXC M;  1GKI A;  4DR7 M;  1AYF A;  2CV2 A;  2WXI A;  2WXK A;  4MGZ E;  4QOZ C;  2KWD A;  3LMM A;  4LK0 M;  4NZL B;  4A8X C;  3MK6 A;  1NI3 A;  3ILK A;  3KSX A;  3RFZ B;  3T3N A;  1N5X A;  3U6P A;  1FNW A;  1RFK A;  3FKE A;  5ITQ A;  4I4L A;  1E9M A;  2C96 A;  2G5G X;  2IGH A;  2RGO A;  2XFT A;  1ZOY B;  1XNQ M;  3RNV A;  1FEH A;  4D8I A;  3AB5 A;  4BLC A;  3TWK A;  2LHD A;  3DA1 A;  1IY2 A;  4DUY M;  2YR0 A;  2INN E;  1PDX A;  3PHX A;  1HZ6 A;  4C7Y A;  2EKI A;  4DQO C;  2WDQ B;  2DZO B;  1EM7 A;  4B7G A;  3Q8C A;  1QT9 A;  1FXA A;  2OHF A;  4DR6 M;  1HQC A;  3O13 A;  3R8F A;  2BTW A;  1C1K A;  3LB8 C;  4DR2 M;  3AEA B;  4HXD B;  3PZ8 A;  3H4M A;  4YSZ B;  4GIP A;  1OFI A;  2KRU A;  1TKY A;  4B0M A;  3SYK A;  1SJH D;  1C4P A;  1EWY C;  2MEK A;  3W5U B;  5EE3 A;  2Z4R A;  4XDD A;  2FOI C;  4NSR A;  3R9X B;  4A5U A;  3FTE A;  4Z6Y A;  4RGN A;  2WXL A;  3GPX A;  3FUX A;  4RKX A;  4DV4 M;  1XCQ L;  4NSO B;  1N5W A;  1I4G A;  3M6A A;  1AWD A;  2F5S A;  4B3T M;  2WXM A;  1EU3 A;  4B0E A;  1NNU C;  1IQP A;  3Q8B A;  4RH6 A;  4ZRP A;  2UXB M;  3HRD D;  4C7Z A;  1B1Z A;  4IDI A;  4JI2 M;  1FNU A;  3TEZ A;  4GKK M;  3J81 S;  2X38 A;  4JWU C;  3GLH A;  4L16 A;  2K0P A;  1SE2 A;  2N9L A;  3KWL A;  3CWI A;  5BYQ A;  1VZ7 A;  3U52 E;  1E32 A;  2WXF A;  1UM8 A;  1KH0 A;  1NEN B;  3BVZ A;  1N36 M;  2AGA A;  3HHY A;  1SJE D;  3DZD A;  2AQ2 B;  3I4Y A;  1L2D A;  1HXY D;  2UU9 M;  4ZRQ A;  1I4P A;  3FC4 A;  2DXI A;  4TUW A;  2RDH A;  2H89 B;  3PHW A;  3B9J A;  1L6U A;  3KDS E;  7CAT A;  2F5P A;  3I4V A;  3O65 A;  4FVM A;  1BXT A;  4IBF A;  3KOW E;  2CFO A;  2ZAN A;  1YNT E;  4RNA A;  5C18 A;  2K3U A;  4FCT A;  2WDR B;  1N63 A;  4KO8 A;  3BBA A;  4TSS A;  1C77 A;  2JWU A;  2IJ0 A;  3SYL A;  2Z8L A;  2Q5W D;  3UI3 A;  1R7R A;  1HQY E;  2V3P A;  3DWG C;  2KN4 A;  4W5W A;  1PM5 A;  4BBA A;  3ZGZ A;  1TKG A;  5IWA M;  4H2A A;  1HEZ E;  2HKJ A;  3FIL B;  3W31 A;  2UUB M;  2MH7 A;  2EO2 A;  2J7Q A;  2J7Q C;  3GRY A;  3A45 A;  1PGA A;  1W5S A;  4KKJ A;  1ET6 A;  1V8C A;  3GQ5 A;  4YSX B;  3C0R A;  2LUM A;  5H8Y E;  4LJA A;  4GC5 A;  3BYY B;  4A9A A;  2CV0 A;  1YE9 A;  1KSF X;  4WQM A;  3FUT A;  2ACZ B;  4A90 A;  2HTM E;  2XF3 A;  2J53 A;  1WRI A;  3MHV C;  2IDY A;  1N61 A;  3ABV B;  3RFW A;  3VLF B;  2ZAM A;  2E6X A;  3T3O A;  4LF5 M;  1IXZ A;  3AE1 B;  1NHG C;  3ZNH A;  2Q2E B;  4II7 A;  1YN4 A;  1NJG A;  1R2Z A;  1DGJ A;  1C4C A;  2PW9 A;  4IBD A;  4D81 A;  2WNM A;  5FTN A;  1R7S A;  2J52 A;  1CK1 A;  1K3X A;  3P42 A;  1JQ4 A;  4ARI A;  1QLB B;  3ZJV A;  1XLP A;  2INP E;  1AW7 A;  1L2C A;  1FCC C;  4QHS A;  1JRO A;  3ZC7 B;  1XHB A;  4HKZ E;  4LRS A;  2DYM A;  5EE9 A;  2IGD A;  1Z59 A;  1XXG A;  2KAJ A;  4LTU A;  4XWT A;  3VKG A;  1SEB D;  2FE8 A;  1K3W A;  3BY4 A;  3R2I A;  1FCL A;  4GKJ M;  4DXG A;  1J7K A;  1K82 A;  2QIE B;  1JRP A;  1GL7 A;  2AQ3 B;  1T5X D;  1ENF A;  4NAM A;  3HJS A;  4OZC A;  2W55 A;  2NMQ A;  3VRA B;  5JXV A;  4L78 A;  2L7I A;  1T3Q A;  3B2G A;  3AEC B;  4ZYS A;  2E3T A;  4IKG A;  4XDC A;  1IUE A;  3WHL A;  1D4B A;  3GB1 A;  2RPV A;  4DV1 M;  3BK2 A;  4FCW A;  5ITX E;  4LZJ A;  3N9Y C;  1FRD A;  5HHD G;  1L0V B;  1D6E C;  4MGH A;  4B7F A;  2ERC A;  4XZX A;  1NY6 A;  3FIL A;  1SXJ B;  2D7G A;  3SEB A;  2M5Z A;  1NNJ A;  4MGY E;  1ZPS A;  3MP2 A;  2JX5 A;  3AV8 A;  2R4J A;  4GIT A;  1FIQ A;  1I4H A;  4FWG A;  3SFZ A;  3TEX A;  1SF0 A;  1XXH A;  2JA2 A;  3HU3 A;  4PDG A;  4AKG A;  2Z3X A;  1V1P B;  3NUH B;  2N0S B;  2W54 A;  4LJ8 A;  4A3V B;  3NRZ A;  2X49 A;  2Y0Q A;  3AKZ A;  2C98 A;  1G4A E;  3BB7 A;  3U6E A;  3IG5 A;  3FTC A;  4G4Q A;  3L28 A;  1MHX A;  2GB1 A;  3KP0 E;  1ZE3 D;  3AV0 A;  1NYR A;  4NOO B;  2D5G A;  4YHH M;  4D2K A;  3MC0 B;  3VQI A;  3W5V B;  2JTC A;  1RWS A;  2KEB A;  4LF8 M;  3M7G A;  5HFY A;  3GLF B;  1MHH E;  3LVW A;  1I4Q A;  3U7Z A;  2W82 A;  3C8Y A;  3AEF B;  1QZM A;  2WXR A;  4ARC A;  2F4V M;  1WXQ A;  4LF9 M;  4KHP M;  1QQR A;  5ITX A;  2HWK A;  1Q39 A;  3AEG B;  4ITK A;  1R6B X;  2XFS A;  3VK7 A;  1J7C A;  3W2D A;  4GRI A;  1HR0 M;  4KX6 B;  3NVZ A;  4R7G A;  1NVI D;  1MVK A;  4NXM M;  1ZQ9 A;  4AI6 A;  1WWT A;  1L2B A;  3V05 A;  1ZAE A;  4JPS A;  3KW6 A;  1T3T A;  1DGH B;  3OQC A;  2R46 A;  4OVZ B;  2CE7 A;  1IN7 A;  4DV3 M;  2G8L A;  3W1S A;  5LMN M;  5DYG A;  4PDI A;  2J42 A;  3K2L A;  2QMT A;  3J7B A;  3PRP A;  5A2Q S;  3SAU A;  4J3O D;  3U6L A;  3BZD B;  4US9 A;  2ICI A;  1N75 A;  1ZXI A;  2C9O A;  3NZ3 A;  5FTK A;  4GDK B;  2OPF A;  3L25 A;  3HHZ A;  2LNH C;  1ZXH A;  3KVW A;  3HUI A;  5ITU A;  3KQ4 A;  3GQ3 A;  2WXP A;  1D2N A;  2Y21 A;  1E10 A;  1YSY A;  5F3W A;  1IN4 A;  1XMO M;  2KAC A;  1V97 A;  1KLG D;  1IY1 A;  3BVM A;  3Q8X A;  2CHV A;  3SC3 A;  3JR5 A;  2DVW B;  4QHT A;  1V1P A;  1XC8 A;  3IG8 A;  5IT9 S;  2KXE A;  2JYT A;  2C5R A;  2FBW B;  3SFD B;  5EXT A;  4AKH A;  1UWX A;  2UXD M;  1E6E B;  3SAS A;  4DR1 M;  2VQE M;  1SXT A;  2V1C A;  3MFG A;  1XO3 A;  2Z4S A;  1XLQ A;  4WWM A;  4RF1 A;  2DOS A;  3PVS A;  2PMV A;  1R2Y A;  1H6U A;  3L2A A;  5KQ8 A;  1OFF A;  4EE2 A;  4JI1 M;  3U6M A;  1EU4 A;  4LZZ A;  3DWM A;  3GLF A;  1TKE A;  4G4N A;  4GMQ A;  4TQ1 A;  2BB5 A;  3R8B A;  1S3S A;  3GQ4 A;  4LJ7 A;  4RGT A;  5E26 A;  2Y0T A;  4AKI A;  4NRW A;  4GHA A;  4HL4 A;  5BMH A;  1I7H A;  2W3R A;  3CF2 A;  1PJI A;  3ZJU A;  4WAF A;  3CIR B;  1Q10 A;  3W9C B;  4BOS A;  3GRV A;  3I51 A;  5EP3 A;  1XWI A;  3GPU A;  2V6Z M;  5JI3 E;  1WSP A;  3SBJ A;  4DV5 M;  1DGH A;  1JWB D;  4LJ5 A;  3RPF C;  4UDU C;  1G59 A;  4OVZ A;  1K50 A;  4REZ A;  2C9C A;  4G4O A;  1F2R C;  3IT6 B;  1GB1 A;  3R2T A;  1HNZ M;  2KQ4 X;  4OZB A;  1TZO A;  2BJW A;  5FTL A;  2BS2 B;  4RGM A;  2ON8 A;  1G8P A;  4IBK A;  3PRM A;  2QEJ C;  3P1M A;  4M0W A;  1IY0 A;  1IN5 A;  3HWS A;  5FLX S;  1JQJ C;  1UGJ A;  4QNM A;  4IOI E;  4TMA B;  2Y20 A;  4GLS C;  1F0Z A;  1D5X C;  1JWM D;  2AQ1 B;  1TDZ A;  1XNR M;  2XZU A;  1TS4 A;  1DOY A;  2PKO A;  2EEL A;  4IBC A;  1J7B A;  4AG5 A;  1IBX B;  2I7P A;  2OQ4 A;  3FTF A;  2WXQ A;  2JYE A;  1GB4 A;  3QWL A;  4NXN M;  2QPA A;  2G1E A;  4Q2J A;  4I81 A;  2JXT A;  2M60 A;  1AN8 A;  3KLS X;  1GPX A;  3U6S A;  2LXE A;  3J2P B;  4Z8X A;  4MH8 A;  3NVY A;  3ETR A;  4KLN A;  4N58 A;  2H88 B;  3GRU A;  1ZDV A;  3FUU A;  3LVV A;  1N60 A;  1XLN A;  3AOG A;  5EZQ A;  2ZW1 A;  3EUB 2;  4N59 A;  4FW9 A;  3SHF A;  1DGG A;  1FXI A;  1QAO A;  1UKF A;  1EE8 A;  2J7N A;  1E94 E;  2BS3 B;  3AE8 B;  4IJE A;  3HJQ A;  1QKZ A;  3HJ8 A;  4A55 A;  5EJC A;  1QVR A;  4LLG M;  1GL6 A;  1PVJ A;  1JWU D;  3C58 A;  1A70 A;  2NTT A;  2A5Y B;  1OQR A;  3UZU A;  2JU6 X;  1FM0 D;  3AE2 B;  2K47 A;  1L8Q A;  3U6D A;  3E9S A;  5EP2 A;  2L32 A;  5I4D A;  2ZW0 A;  1FMA D;  2EA0 A;  3AN1 A;  3J9C A;  4LF7 M;  1IM2 A;  3EGR A;  4LGM A;  4RF0 A;  3J27 B;  1J7A A;  4L1B A;  1Z5C A;  3B9P A;  5ITR A;  1LV7 A;  1WGK A;  3ZYY X;  3FD9 A;  4KGS A;  1CZP A;  3VFD A;  3SMP A;  1FD6 A;  1JR3 D;  2Y3A A;  3IFU A;  4DV6 M;  3VDU A;  4ITQ A;  2BTE A;  2CHG A;  3NS1 A;  1JCK B;  1DO0 A;  1OJL A;  4DXF A;  1QAM A;  3L29 A;  4NJC A;  4HEA 1;  1N77 A;  1VZ8 A;  4I8O A;  2R62 A;  1DOI A;  5H37 D;  1XCT L;  5IZ7 D;  1I4X A;  3U61 B;  3TWL A;  2DWM A;  2SEB D;  2OED A;  1UUP A;  1KFV A;  1XMQ M;  1TYG B;  1B9R A;  5GKN A;  4LF6 M;  1NVM A;  2I38 A;  4JYA M;  1HQR D;  2R61 A;  5FKA C;  1QAQ A;  3GLG B;  1QOA A;  1UWM A;  4C56 C;  5BMI A;  1C4A A;  1L1T A;  2LJI A;  1ESF A;  3KOZ E;  2M19 A;  4KGT A;  3GLI B;  4AW4 A;  3KS4 A;  2K5P A;  2ZAO A;  3PHU A;  3ZJT A;  1G41 A;  4R3D A;  3NVV A;  1Q3C A;  3IAM 1;  2CJN A;  1TS2 A;  4WH4 A;  2J4X A;  1JR3 A;  2WXH A;  3BVG A;  4JI0 M;  5D3D A;  1I4W A;  3FYD A;  2K22 A;  3ZH9 B;  1ROE A;  4GDL B;  2XSZ D;  3ZCB B;  1GOZ A;  5MPO A;  4BOZ A;  1VLB A;  3JR4 A;  4YTM B;  1ZDX A;  3NVW A;  1FFU A;  1XLO A;  2WS3 B;  4DV0 M;  2WU2 B;  1TGU A;  2CHQ A;  4FWD A;  3AEB B;  2BBC A;  3E56 A;  3FUW A;  2WQY B;  4KOD A;  2QEN A;  2JSV X;  1F2R I;  1IGD A;  1Q3B A;  1D5M C;  3MTV A;  2YQZ A;  3I57 A;  1ET9 A;  2XLJ A;  2Z84 A;  1QOB A;  4LJ6 A;  4MI7 A;  2MJD A;  3MHZ A;  2V1U A;  4LY6 A;  1FRR A;  3SAT A;  2AHM A;  2BU3 A;  2PVO D;  2H1R A;  3AE4 B;  2LH0 A;  4K0K M;  2RDG A;  1SXJ E;  4O1N A;  3TSS A;  3WCQ A;  3SAW A;  1W5T A;  1CQV A;  1HT1 E;  3T1Y M;  3TMP A;  1C79 A;  1SXJ D;  2BNK A;  4X64 M;  2YEP F;  2L52 A;  4L2Y A;  5AUI A;  2V0G A;  3A42 A;  1BML C;  4IUM A;  4P16 A;  2DHR A;  2XZF A;  2XSZ A;  3LQR A;  3A46 A;  4OHJ A;  1QIL A;  3WHK A;  4X65 M;  2X4A A;  4JWS C;  4FCV A;  4LFC M;  2GI9 A;  2PTL A;  4JV5 M;  1VDD A;  5G5H A;  4XWW A;  3GLG A;  3BK1 A;  2QJL A;  2RKO A;  3MP9 A;  4JN6 A;  1OFH A;  2CV1 A;  1N32 M;  5FR3 A;  4D8E A;  3HGI A;  3E4R A;  3HKP A;  1Z5A A;  3UGJ A;  5BPV A;  3I9V 1;  1NJF A;  2VZK B;  4LJ9 A;  5EE1 A;  1E9S A;  3VR8 B;  4B3M M;  1L1Z A;  5EXX A;  4X62 M;  4YY3 M;  2V3N A;  2YNM D;  5JI2 E;  4B3R M;  1J09 A;  3TEY A;  3MJ5 A;  4NAW B;  2QIL A;  3P4P B;  3DOA A;  2F5O A;  4AG6 A;  3FUV A;  1N78 A;  1ACC A;  2BS4 B;  2CEA A;  2IGG A;  2DWZ B;  4D82 A;  1HZ5 A;  1ZUD 2;  4OU7 A;  4IBG A;  2P5T A;  3URY A;  5FTM A;  2XEP A;  1N33 M;  3KS8 A;  5HG2 A;  3AE6 B;  3KOX E;  3AMZ A;  1L0X B;  1DKI A;  1SXJ A;  4BB9 A;  1SXJ C;  1IBK M;  1FNN A;  5KPT A;  1DO2 A;  3AH7 A;  2WLB A;  1YZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...