4P16A

Crystal structure of the papain-like protease of middle-east respiratory syndrome coronavirus
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
319
structure length
314
Chain Sequence
QLTIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF1a
publication title Crystal structure of the papain-like protease of MERS coronavirus reveals unusual, potentially druggable active-site features.
pubmed doi rcsb
source organism Human betacoronavirus 2c emc/2012
molecule tags Hydrolase
total genus 84
structure length 314
sequence length 319
ec nomenclature
pdb deposition date 2014-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4p16A02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4p16A01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4p16A03
3MJ5A 2FE8A 4REZA 4R3DA 4RNAA 4P16A 4RF0A 3MP2A 4WURA 5E6JA 4OVZB 4M0WA 3E9SA 4OW0A 5KO3A 4RF1A 4PT5A 4MM3B 4OVZA
chains in the Genus database with same CATH superfamily
1GG3A 1I7HA 3PTFC 1SXJC 4GC5A 3PHWB 3KWBX 2UWQA 2KNZA 1TF0B 4YWGG 5AZHA 3WALA 1XWIA 2KOXA 4R7GA 2DENA 3SU8X 1NB5A 3C19A 2FCNA 3K9OA 3U6OA 4DXFA 3FILB 3ZUNA 2KHHA 3U7ZA 2N9EB 1U5IA 1F2RC 2M60A 5E6JA 2QSFX 4II2B 4RM8A 5H92C 3RD2A 3RUIB 4C00A 4I04A 3W5VB 3E4RA 3BYYB 2K6QA 4HL4A 3FUWA 3AJIB 1YX5B 3BVGA 4FCVA 4MH8A 3W31A 4HCNB 1XNRM 2E5LM 1TH4A 3B7ZA 4OVZA 3ALBA 1DYQA 1B9RA 1GKIA 3PFIA 3PRZA 2L83A 4CO7A 3CGWA 4XWWA 4MGKE 3QA8A 2I1KA 3NY5A 3K9PB 3CH2X 3R8FA 1N5XA 4PDGA 4JI5M 3AXCA 2R2QA 2UXBM 1WX7A 5J18A 2ZCBA 1QYRA 4MH0E 3TEZA 3MHZA 2X4AA 1WYWB 3K8ZA 3VKGA 3BBZA 3X0WA 3I04M 3GQ5A 1BP4A 1QANA 2PPHA 1YQBA 2XZFA 3UGJA 1L2BA 4PS8A 2MRPA 3R7QA 2XSZD 3N32A 3DCGA 2WSEF 2BBCA 1XCTL 1AWDA 5LXHA 1BMLC 5LXIB 4IBIA 1CSBB 2OPFA 4M0WB 3UGBB 4QHSA 3KVWA 3N1ZC 2DHYA 3ZVVA 2NBUA 2DCBA 1GC7A 2CV2A 3BVZA 3A4SC 4GLSC 2XBBC 1UKFA 1WF9A 3BYTB 3NS8A 4FXCA 3DHGC 3FRIA 4LGMA 2DZYA 3N1XC 1Y8GA 4P6GA 4S12A 4PS7A 2DC6A 1E32A 5IO9A 2RD0A 3GRRA 2LD9A 2DCAA 1TTEA 4Y28F 4L4UA 2FO5A 4B7HA 2IGHA 4WIPA 3IMAA 4LF5M 4F2LA 2WXQA 4EKUA 2AL3A 1GAQB 2R4EA 3QHTA 2ZM6M 2PVGC 3UQBA 2R9CA 3FTFA 2BS4B 4RGNA 3ZRCA 4W9DA 3W1SA 2IPKD 1JALA 3KWZA 4OHJA 3KX1A 4FA6A 3I4YA 4HK2A 4HEA1 3C8YA 2ZCCA 1TH3A 4QNRA 3RNCC 2V1YA 4IW0A 4WH4A 2Q5WD 2ZTCA 1K50A 4IBKA 4HKQA 1ZGUB 3MTVA 3OVXA 4HLEA 3S3RA 4MZOA 3U30A 3R2IA 2JQGR 3U8ZA 1TS3A 1C3TA 5FTKA 2MBQA 2C0YA 2E01A 5AEKB 4DV4M 2G3QA 4MGYE 4LGYA 3M99A 4FJZA 3N3GA 4F8CB 3JSVB 4ANVA 2XLJA 3PRPB 3PVSA 2XH9A 3QYEA 1HEZE 3SFZA 2KVZA 1UZXB 4HVBA 3Q8EA 3U6MA 2DAEA 2BS2B 1KXRA 1L5PA 1TLOA 4A5UA 1NJFA 1F1HA 5ITQA 2WX0A 3U4EG 2BW2A 5C3JB 2GB1A 2JRIB 3K2LA 3U6CA 1MJGM 1YD8U 2KANA 2M0AA 1VZ6A 2V3NA 2G5GX 4JI3M 1N32M 2LZ6A 4LNIA 2K0BX 5CVOB 1FMAD 3AH7A 3AOEC 2R46A 2MHJA 4KGRA 3RMKC 1E9RA 4HDQA 3KDSE 1PE6A 1HNZM 2ZPYA 4EZJA 2ZTDA 2KWDA 2DZLA 3ILKA 2L6OA 2KNAA 5L95C 4LJ4A 3RVXA 3D32A 4TUUA 4W9FA 3J7BA 2IY0B 3GLFE 4XDDA 3RPFC 3WHKA 4AG6A 3ZQ4A 2R9NA 1STEA 4ANWA 3W30A 2KWCA 4IM3A 2X49A 3B79A 2BKFA 1ZXIA 3RNGC 3SEBA 2YJ2A 2M8SA 3BIID 1CS8A 1E7UA 2AYOA 3U60A 3E9SA 4BSQA 2EKFA 2LXEA 4B0EA 4BVUC 2R18A 3W2DA 1MG4A 4IUMB 1HT2E 2CU1A 2DX5B 4LF7M 4JI4M 4TKNA 3U6LA 1PJJA 3AU4A 2DHRA 2LI5A 4K3BA 4MDKE 4GHLA 1KRHA 4QBBA 1TIFA 4G6ZA 2EUCA 3Q3FA 5L8RF 2D3AA 1TGZB 3W0LB 1L0VB 3CTWB 2KX3A 2SEBD 2O6XA 5EXSA 2JWSA 3P2BA 1XF5L 1JR3D 2R65A 5J2RA 3HHYA 3ERVA 2NMQA 3I57A 3KSXA 2KJRA 3K24A 2ACTA 2WXFA 3KLSX 4YY3M 3AE1B 3PHUA 4EUTA 2NBWB 2H88B 1WXMA 3U61A 1D4BA 1CPJA 4W9CA 1L2DA 5GKNA 4HLQA 1AYFA 3OAWA 1WJNA 2RDHA 1IWDA 1MG8A 3RFZB 3SARA 1FXAA 2KO3A 3P1MA 4WQOB 1KHQA 1EE8A 1T6OA 2KD0A 2KYWA 4PP2E 3GCBA 3I06A 3ZJTA 3RNAC 4PK1A 2BWEA 2D10A 3R8BA 2DAMA 3AE4B 3T8MA 2LGDA 3NHEB 3U6EA 4GIVA 2FT2A 5ITYA 2BJVA 3SR6A 2V0GA 4YTMB 3MTNB 2ACZB 4X66M 4LJ6A 2WXGA 4XWTA 2JU6X 2Z3XA 1OFFA 5EE1A 1FNWA 2EJSA 5DPRA 1TS4A 1C4PA 1ISNA 4DDID 2ONQA 3O65B 3HJ8A 2V1UA 2OHFA 4W9EA 3H89A 1EIJA 1TZ1A 1F0ZA 2DOSA 4P1CC 3EUB2 2Y0QA 4JN6A 1U9WA 4LCBA 2N0SB 5DPWA 2FH0A 3DBLB 2XU1A 2LFIA 3W67A 4W5WA 2GRIA 3VFKA 3VH3B 1AIMA 3H7DA 4URKA 1JWUD 5EZSA 2WXIA 2Y5PA 3MHSD 2WU5B 4BOUA 2FCMA 3FE3A 5BMHA 3H6SA 2Z84A 3SHGB 1NVMA 1YX6B 1PPOA 2CHVA 4KODA 4WJPA 3PREA 3L4PA 1NNUC 4FN2A 3ZXVA 1R2ZA 3Q3NC 2KDEB 1TY2A 4IM2A 4FWGA 1XNQM 4UDUC 4D81A 4AS1A 1WY8A 3LB8C 3GLFA 4HJGE 1YK8A 4HEOA 2BPSA 1F52A 4D82A 1NNJA 3OWEB 1NSFA 5KPTA 4CDDB 1ZPSA 1KLUD 2WX1A 4PI3A 2HAKA 2VIIA 4W5BA 3H4JA 1CK1A 1C1KA 3ML8A 2QIEB 1DKIA 1VZ8A 4R3DA 3ZH9B 4II3B 3GLHB 1T5XD 3C9EA 3CSTA 2H5XA 4DXAB 1CB5A 4DR4M 3DDCB 2WXRA 1VLBA 3DOWA 2UU9M 3R2TA 1VG5A 2K22A 3UQAA 4MJSB 3IG3A 1TY0A 2L4FA 2DZOB 1UM8A 2XEWA 4M01A 3DVGX 4KSLC 4P6VF 2HJ1A 4M9ZA 3M95A 2DCDA 4FVMA 5BPVA 3P4QB 3BCNA 1NI3A 1RAXA 3NG0A 1BY8A 5CTRC 3T6PA 1KM7A 2FAZA 2YJ9A 2LHEA 3V6EB 2DYBA 4DV7M 5EXXA 1NBFC 4REZA 2DI0A 5C18A 1XCQL 2KTRA 7CATA 2B1NA 2CIOA 1CZPA 2FFJA 4RNAA 4YSZB 1N63A 1PYWD 4O1NA 4WWPA 4B0MA 1AU0A 4BOZB 3HRDD 3WAOA 1SE4A 3QJ3A 4KLNA 4G3XB 3ZKJC 1ME4A 3ZLZA 3KW5B 3A4RA 3W9CB 4LRSA 4X64M 2QHOA 4OW0A 5T8IA 2RGHA 2FIDA 2L7IA 4IBEA 3DBSA 3IG8A 3EIEA 3OF9A 2VQFM 3B08A 4L6V6 3JYUA 1QAQA 3I5JC 5EE3A 2G45B 5JA7A 4RF0A 4HPPA 2BQQA 1C1YB 3DQVA 1JQ4A 2AS8A 2I1JA 2AQ3B 2OULA 3U7DA 1EWMA 3CF0A 1PGYA 3WA0A 4Q8GA 2MP2B 4NPNA 3PRMA 1EU3A 3KP0E 1DOXA 1IY2A 1FEHA 1P7FA 3IBEA 2WXPA 4FIPA 4Z8XA 2LUMA 4LJ7A 3Q6BA 1G59A 1PJSA 1L7YA 3IFUA 5HG2A 3B0AA 4DHJD 3SC3A 2WZJA 1IPGA 1THEA 3L13A 2BJWA 1TS2A 3KVFB 3BPMA 3QQ8B 4XGAB 3PZDA 4OZBA 3TMPA 5PADA 1ZMWA 2NS5A 5EZQA 1VJKA 1PQSA 2ZW0A 2R9OA 2VQEM 4RH6A 2I7NA 2JXNA 3KS8A 1DGBA 4K7UA 1UH6A 5KQ8A 2KDBA 3D6SA 5BMGA 2QJLA 2MW5A 4L1BA 2FS1A 4AXLA 3SATA 3SYKA 2KW0A 1RU3A 2GLSA 3GP1A 4C7YA 1PADA 3EECA 3UINB 4KZ0A 1KFXL 3AI5A 4S17A 4CISA 2JZ3B 1NB3A 2KWUB 1Y08A 3SMPA 1E6EB 3CH3X 2KRUA 3TWLA 1SE2A 4OZAA 2KNBA 3KOXE 4J3OD 3AEEB 3GS2A 5GMVA 4ASWC 3TRKA 4YYSA 4YYVA 2QQ8A 2LXCA 3L0WB 2WXNA 2BYEA 2V3SA 2LGIA 2CV0A 4IJEA 2ARYA 4LJ5A 4FW9A 3KWVA 4DV3M 3LVVA 4DUYM 2ZAMA 3ECIA 2EA0A 1J7KA 4WWOA 2PIAA 1Z5CA 2BYFA 1ZCMA 2LVOA 5D6JB 2O01F 1UGJA 5J17A 1SXJB 3R7RA 3FC4A 2LWXA 5AZFA 2KN4A 1E8WA 4A55A 2WSCF 2KXEA 3I9V1 1PPPA 2RGOA 2V9HA 1OIZA 1Q6KA 2FUG1 1TTNA 4DV5M 4NZLB 3IVFA 1GO5A 2DAFA 1V49A 5FPWA 2NR2A 3L25A 1K8RB 3HJSA 4AP4C 3P5WA 4FD2A 3ZJVA 1ZDVA 3BBAA 4JXJA 3TIXA 4A6QA 3PW3A 4ARCA 3AEAB 2DJFB 1JWMD 4K7SA 5D2MB 2MH8A 2LGYA 2IBIA 2G8EA 2IYDB 2WYQA 1J7AA 3AI8A 2WXOA 3RVVA 4JL9A 1L1TA 3HY5A 1AIPC 1R4NI 1WJ4A 5C1BA 3MK6A 3AE8B 1R6BX 4ANXA 1T43A 2NTTA 1XB2B 2NQAA 2XN9C 3HU3A 1IN6A 4NL4H 2AEHA 4BPVA 3SMSA 5L83A 2DAGA 4GXBA 4I6LB 3N4CA 1WJ6A 3L26A 2JZ1A 3VVWB 1FCLA 4EZKA 3KOWE 1IP9A 3ETRA 3TNXA 1OTRA 4M00A 1QUTA 5IREB 3C9PA 5JH5C 4BZAA 4BBAA 5TR5A 3HHWA 2FQ9A 4MSXA 3QIJA 1MS6A 2L2DA 1BXTA 1LXDA 4XC2A 1FNVA 2L0FA 2KC2A 3OJ3A 3PNVA 1SE9A 1MPEA 4A9AA 1M4VA 3WIMA 3HGIA 4I81A 1V1PA 3B2GA 3ZW3A 1E9MA 3PSEB 4HKZE 1QOLA 4HXDB 3A1QA 4LNFA 2M1MA 3V6CA 5DYGA 4CDCB 4DR7M 4KO8A 2FNJB 2WXHA 4YTPB 3L27A 1FRDA 4GHAA 1R4MB 2L7HA 2XK5A 1UELA 2OZ2A 2INNE 3B74A 3VRAB 1QDTA 1C4AA 2KFKB 3MHVC 1JWSD 1QOAA 4MACA 4FHJA 3PHWA 2DZKA 3L28A 3FYCA 3LYYA 4GDLB 5BR8M 2A5YB 2HD5B 1NYQA 4GU2A 3FILA 4B08A 1KOTA 2O5RA 4XX5A 4BKSA 3ZNGC 1JB0F 3LCUA 2J4XA 4MEMA 3FTEA 2XFSA 2Z7JA 2BS3B 2MBHA 2QCZA 2L0TA 2KMCA 5BO4B 1XMQM 1LGRA 1PCIA 3P5UA 2O6VB 4I6PA 4ANRA 2MJ3A 3PLUA 2DXIA 1LV7A 3NZSA 3AKZA 4IWQA 4IIWA 2J7NA 1VZ7A 3GB1A 1EUVB 2FUHB 4D2KA 2CHQA 3GE3C 2LGSA 4L23A 1YJJA 4LFAM 1J8CA 1QZEA 2DWZB 2F1GA 4XDCA 3CBKA 5EF4A 5AUIA 4YTNB 1GL6A 4XZ4A 1HTQA 5A2QS 1R7RA 4WJNA 1DOIA 2EMTA 2LVPA 1XKGA 2NTSA 4LZZA 3W68A 4DV1M 4AUQC 3HM6X 3DOAA 4YYWA 2PADA 2YLMA 3I3TB 4EE2A 2E03A 2JWUA 4M0WA 4ZYNA 2JYEA 4BOQA 5EDSA 2DWNA 3PPAA 4PT5A 4JYAM 1HZ5A 2QSDA 4KGTA 4PS3A 2EKEC 1XMOM 2AUZA 2H1RA 4MELA 3U8EA 2NPTB 2R2OA 4X62M 2J7QB 1U9XA 2E00A 3Q8AA 2K8CA 5DNYA 4RKUF 1N33M 4GB9A 1WI0A 1TDZA 4BBNC 4IWOA 2JUOA 4LRTA 1IGCA 4YL8A 5EP1A 3QWLA 1EF7A 4C56C 4JI6M 3CIRB 2KZRA 1YN4A 5G5HA 1D3ZA 1R7SA 2F5PA 1MJDA 3WXFA 3FUTA 3KUZA 2BYTA 1OEYJ 2BYVE 1KH0A 4LF9M 4D8BA 3NVYA 2A4ZA 2HKJA 1NY5A 2TSSA 5EP4A 2WXJA 1K53A 4LJ8A 3VTWA 3OF8A 3LVWA 1NV8A 1D6EC 1P9DU 3P4PB 2W54A 3HWSA 2WS3B 3APCA 4GIPA 1NVID 4W5CA 3PZ7A 3TL4X 4QAYA 3RGPA 5E6NA 2DC7A 1DGFA 4XGIA 2MJ5B 4FWHA 2ICIA 3EFCA 4LZJA 5ITXE 4GMQA 2KKCA 1KLVA 1NLJA 2F4VM 2FRAA 2CHXA 1W5SA 1F2RI 1PDXA 4GUAA 4JGHB 3BB7A 1YE9A 3DVNU 4DUZM 3CMMB 1Y56A 1WWTA 2UUAM 1E8XA 5H8YE 2NQDB 3JSVA 5G55A 2APLA 1X9YA 3P5XA 3PRPA 1GNUA 1OAIA 3QYBA 4XE0A 4BFRA 1Q02A 4YVAA 1K3WA 4YSXB 1TKYA 4ITQA 2MWSB 1K52A 3HHMA 1D5MC 2RDGA 1UBIA 3RE8A 1SF0A 4XZXA 1FCCC 5EQTA 4ITKA 1GUAB 5JHBA 4RGTA 2JRIA 4GDKB 1MN3A 1OFHA 1XLQA 3H8BA 1JRUA 4CIZA 3GPUA 1WJUA 2DBYA 3ZNID 4JI8M 1EWCA 2M56B 4TSSA 3TJPA 3VTUA 4B3SM 1IBXB 1OJLA 2ZAOA 2EO2A 1HJPA 3K1JA 3AV8A 3BVMA 5C23A 1HQRD 3B1LX 1LFDA 3IHPA 2WDVB 3HKPA 1PM5A 3WXGA 2F5OA 4DR6M 3CBJA 2JNHA 5EP3A 2V1CA 4AW4A 4PCZA 1ZXHA 2BTWB 1WRDB 2KT7A 2KXJA 3SFEB 1V6EA 3AB5A 1WH3A 4DHZB 1GLNA 4JI7M 3C58A 3UI3A 1K3BB 2WP9B 2AYNA 3H6NA 1BT0A 3FUUA 1QQWA 3N30A 4EEWA 4HWIB 4A90A 1AUAA 2MJDA 4TQ0A 1VD2A 4I05A 3N1YC 4DQOC 2ZANA 1PGXA 3GLHE 4J6IA 4NOOB 4NJ7A 2JA2A 1FPYA 3E56A 3GLGB 4KVGB 2K9DA 2OQ4A 4UN2B 2IY1B 3MP2A 4IUMA 2KWVB 3KFUG 3FKEA 4KHPM 3MJWA 4G4QA 4K0KM 2PE9A 4IP3A 2AHMA 1EF5A 1R4MI 1ZQ9A 1YUBA 1R2YA 2GQFA 2I7PA 2LGXA 3OG5A 4AI6A 4MT5A 1E8ZA 3IUTA 3IT4B 1C77A 3IECA 4OZCA 2DZNB 2C7NB 1XXGA 3CWIA 2XF3A 2HHNA 2VF7A 3RI7C 1GOZA 3FTCA 2JY6B 5IN7A 3GPYA 4RCOA 1E94E 2MLBA 1G71A 1NDDA 2KZSA 2L7RA 2K0PA 3V61A 1CJEA 4CHTB 4ZPXA 4AG5A 4IDIA 2PKOA 2FTDA 2FYEA 2W55A 1L4ZB 3QSDA 1TJEA 2ERCA 2FNAA 4HPLB 1SIFA 2Z0DB 2EELA 4HRSA 3QT4A 2XFTA 1XQQA 2B1MA 1JQJC 5ITXA 2QENA 1KFYB 3WAPA 3ZUAA 1WGGA 2B76B 3EA6A 4RMAA 3KOZE 3A98B 3QX1A 1XXHB 4TMAB 1T0RC 1F4IA 2PBHA 2L09A 1HZ6A 1NYRA 1VDVA 1GJZA 3NHEA 1TT5B 1UGMA 1DO0A 1EFUB 4IJFA 2Z8YM 3ZC7B 3MTNA 3DA1A 3DVGY 1MIRA 5LMNM 1KLGD 4JI0M 3L29A 3P42A 4ZRIA 4FLHA 4ZRKA 1JW9D 3AEBB 3BZDB 1STFE 4LDTD 2C5RA 2BNKA 1GCBA 3O65A 3K92A 1D0KA 1WGYA 1V2YA 2LTUA 1U9QX 2KHWB 3OTOM 3KSEA 4NAMA 4MZSA 2UYZB 2V4LA 3OQCA 4GC9A 3HUIA 2CWBA 3Q14C 3VRBB 5JI2E 4WURA 1Z59A 2QILA 4OVVA 3DFZA 1WZ0A 1NENB 2PW9A 1VDLA 2DAKA 3KXEC 3KSJA 4GITA 4ZYSA 4RF1A 4C4VB 4L8RC 2IZVB 5CHVA 1N60A 2KRKA 2K39A 2P7UA 3U2SC 2DHZA 1ZE3D 1KFVA 4RM9A 4ZRJA 2CJOA 4LCDE 2KX0A 1PJIA 2XU5A 4BKGA 4HJKA 3M0EA 5AZGA 4E74A 1V81A 2K47A 1D5ZC 1H4RA 5F3WA 2JX5A 5EP2A 4HCPB 1F9JA 4BS6A 4L16A 2E02A 1IY1A 3GLHA 1MHHE 3GE8C 4MGHA 3PHXB 2PEAA 2CR5A 3IAS1 2BDLA 5CHTA 3MHHA 4F7ZA 2WSFF 2F5SA 2DZIA 4YSYB 4DBGB 4MJSA 3PZ8A 3VUXA 4JLCA 4II7A 1R4NB 4IWPA 3URYA 1S3SA 4KIKB 3Q8BA 1SXJE 2R62A 1WYGA 5FR3A 4AKGA 4LG2A 2M5ZA 2R6NA 4P6EA 3AN1A 3ZDTA 4I5SA 2LHDA 1N62A 1QAOA 2JY5A 3V6EA 1H8CA 4JPSA 4OX9M 2IDYA 3T3NA 2L8JA 1NQCA 2K5PA 3KQ4A 2BGFA 1A70A 5C2TB 4AXMA 3RNFC 2YQZA 1ZDXA 3W1SC 2AU1A 4BOZA 3HZJA 4GOCA 4HROA 3W1YA 1IYFA 4S0RA 2LASA 1TDHA 4MSMB 3CF6E 3TL5A 3PLVA 1C9FA 2MBEA 4IM0A 3QWZB 1HUCB 4M02A 4BKSD 2ZNVC 3AEFB 1OAOC 3PS6A 4M9SA 1WHCA 2WWZA 4B7GA 2JZ0A 5IZ7D 2F5QA 1T0YA 2WNMA 3IHPC 1UWXA 2BT6A 1P3QQ 2DCCA 2LVAA 2BWBA 2B3AA 4IBFA 1MDWA 1OEYA 3ZYYX 5BYSA 2JTCA 2P0RA 2M4NA 1D0LA 2REXA 2MP2A 3M62B 1XO3A 1ORYB 3O13A 4PADA 2ZPNA 4E71A 5IT9S 2FBWB 1IBLM 1X37A 1Q3BA 3HX3A 2A5UA 3HD3A 1Q0WB 1WM2A 3Q3JA 2KN5A 3VUWA 5BMIA 1JWBD 3TWMA 2N1WA 3GZNB 3L16A 1YJIA 3U52E 4LJPB 1OQYA 1RYJA 2YNMD 3AU5A 1ZV1A 1NL6A 2CKHB 1G6JA 3C3EA 1NEKB 4YYRA 4MM3B 3SAVA 4JV5M 2K8BA 4IBDA 5D94A 1IN5A 2MA9B 2OOBA 1C4CA 3IT6B 4KSKC 1UFZA 3VAWA 3ZXRA 2BWES 5CVMA 1N75A 1J19A 1GJTA 3L10B 4LFBM 1I42A 3APDA 4FADA 3KUCB 4B6WA 4GSWA 2PE6B 3KH0A 4B3MM 1QILA 1H6UA 1UNSA 1UD7A 2Z8LA 2P86A 1F2BA 4G4NA 1Z2MA 1CVZA 3IOQA 1SNKA 2LVQA 3VUYA 3ENEA 1TGUA 3KP1E 4WA6A 3B9JA 1ZIVA 4JE3B 5EXPA 4FHKA 4M9XA 1WR1B 2BVCA 2WDTB 2AIMA 3LCVB 2KJ6A 2V4IB 2R9FA 2R45A 4M8NA 2LRWA 1FXTB 1FXIA 1YMHE 3J9CA 2QBYB 3H8CA 3EIHA 1SXJA 4GRIA 2N9LA 3A9JB 1PUTA 2GOWA 3TEYA 2CUZA 3C0RB 2DKLA 3DWGC 2NVUI 3VK7A 3ZGZA 1LO5D 3RYTA 4LJAA 4N58A 3THGA 1HA5A 1YJ1A 3L17A 3QK0A 5HI1A 5ITUA 3PDFA 3MC0B 4FWDA 2MJEA 3AEGB 4GGQA 3BOSA 3FD9A 2RPVA 1XD3B 4ICUA 2JZPA 2G8LA 3U6DA 1A6RA 5J94A 4G50A 4NSOB 5FKAC 2C9CA 4DV0M 3BXWA 5G2NA 4CJ6A 1YSYA 3P4SB 4NNJB 1IGDA 2DYOA 1SE3A 2OJWA 2WHIA 4Q8HA 3BINA 5FTNA 1F2CA 2R44A 2KDLA 3MFGA 2C7MB 3AMZA 3UIPB 2M17A 3EHVA 2WBFX 3NVVA 3V62A 2RDBC 5JZEB 4ICVA 4NQKE 3AFHA 2IO3B 4L78A 3WAMA 1PPNA 1CJLA 2JZZA 5CHVC 4G3OA 3UZUA 3RCZA 1MVKA 1R4GA 2JYTA 4I8OA 2BB5A 1AU4A 3L2AA 4NXNM 3MP9A 4XYCA 2PVOD 3NRZA 3TMPB 2FRQA 2YEPB 1F29A 2Z59B 4KKIA 4GEWA 2X8XX 1I4HA 4YT0B 2LHGA 3N3KB 1V92A 4YXDB 1QMYA 4BB9A 1TYGB 2ZJDA 3B9PA 1PVJA 1ESFA 2YEPF 3Q8FA 1HNXM 1U4AA 4IKGA 4F1IA 2HL7A 1IY0A 3PSEA 4AWJA 4NAWB 1VCBA 4HXDA 6PADA 2O25A 1YQ4B 2Y5BB 4BOSA 4AKHA 4BBNF 4LFCM 1G4AE 3ABVB 3A46A 2DJGB 2N1VA 3SHQA 4AKIA 3SFDB 2L3ZA 4L2YA 1L2NA 3AE9B 4AZFA 3U5ZA 2N9XA 5KPZA 1WMHB 4A3VB 1ZOYB 3GOEA 4X6IA 1HE8A 5DFLA 3I51A 1L4DB 2J0MA 4LF6M 2KFKA 2GBNA 2ATOA 2RMMA 2J42A 2M0XA 3HU2A 3QCAA 4GDLA 1N61A 2HD5A 2AUXA 1JQPA 4MGZE 2JXXA 4TV3A 1SB3C 2KA6B 3PNYA 3VH4B 2ZZPB 3FKYA 1NV9A 2FCQA 4HPMB 3IFWB 1ZUD2 3APFA 2Y3AA 1Y8RC 3ZO5B 3VQIA 2INDC 4FULA 1G8PA 2UZJA 5CHFA 3O0UA 2O6VA 3Q3OC 4K81A 2R0IA 3TSSA 3F5VA 2HDEA 1BQIA 3DBHI 3M7GA 2WU2B 3EFUA 4RKXA 4YHHM 1ZKHA 1GMYA 4QH6A 1DF0A 2C99A 1L0XB 1L0YB 2LJ5A 4ZTBA 3J80S 3F92A 1WM3A 3TE6A 2JPHA 3HHXA 2QP9X 1P1AA 2YJCA 2IO1B 4YYQA 1FRRA 3KKUA 3GRVA 3JVZX 2XZUA 4P7IA 4ZHPA 3EC8A 1IM2A 3P5VA 4RFBA 1WXVA 2M19A 2MCNB 2DVWB 2W9NA 3PT2B 3GZNI 1C79A 4DHZE 5FSWA 1HR0M 1V97A 3KYCD 1J7BA 2CJNA 4FJYA 4I07A 1J7CA 1ZAEA 4QNMA 4DV2M 2GNOA 3ZNHB 3JAMS 3I3TA 4LNOA 3H7PB 1OFIA 3S2AA 4TQ1A 1FM0D 1VDDA 3AOEA 4IBGA 1GL7A 4BQVA 4G0NB 2O2VB 5D7GA 3NWLA 2N7JA 3GLGE 2NPTA 3IXSA 2J7QA 1VEJA 4GH9A 4EIWA 3VK8A 2XEPA 4BOPA 4N6EB 2OOAA 2UUCM 2R4JA 4W9LA 2WXMA 3K9PA 2LBCA 2FUDA 1QUSA 3UIOB 4AJYB 3QJZA 5IA7A 2G4DB 1PJTA 1YIWA 1EU4A 2CHWA 1IN4A 1RRBA 2YJBA 2JP7A 2VHFA 1ZW7A 3GLIB 1L8QA 5C1ZA 4CQNA 3SBJA 3IAM1 4KDIC 4NC6A 3SYLA 2Z4SA 1N77A 3HVDA 1XLNA 1IXSB 2B3TA 4H2AA 3CSFA 2HHHM 3LJ3A 2D2QA 2KLGA 3RFWA 2DC9A 2KFJA 5E6PA 3FTDA 1AYVA 2DAIA 4AQ7A 3AE6B 2BB6A 5FK9C 1DGJA 1YN5A 2LHCA 2CB5A 4IG7B 4PYUA 4IC7B 1W5TA 3L08A 2Z0EB 1DEUA 4WW0A 4L15A 4JWUC 3M3JA 1JCKB 3ZRFA 1TS5A 2KMMA 3ZTDA 3FYDA 2Z4RA 2YJ8A 1R5LA 2L4EA 4X65M 5EE0A 2WDRB 3FUXA 2OO9A 1CMXB 1XXHE 1IFYA 1IBKM 2G4SA 2D3BA 1V5TA 2LMCA 3KOYE 5JHAA 5E6OA 3HHIA 4OELA 3A9KB 1VEGA 3AL0C 2Y6EA 1C78A 4MGIE 2BDZA 4WWMA 1TH2A 2MR9A 2VH1A 4NY0A 1KJTA 3LFYA 4QRGA 2E6XA 3GP7A 4NRWA 2BTEA 3BY4B 1QOFA 2N35A 4LNKA 1I4XA 2WQYB 2RSUA 3R3MA 4EZLA 4PP1A 5G5GA 2GHUA 5IAAC 4GDKA 3LQQA 4GN1A 5HHDG 2INCC 2HTME 1DGHB 1N78A 1IBXA 2LVOC 2H89B 1NO1A 4DMXA 3HHZA 1OQQA 3V3XA 2DENB 2G1EA 1SIJA 5IP4D 2GBRA 2KACA 3K9OB 2DZZA 2C9WB 3O1GA 1GLOA 2K9XA 2BTWA 1V9JA 1T0SC 1Q10A 1MX0A 1KHPA 4OEMA 4P17A 1YALA 4GKKM 2K1FA 3ZCBB 4JWSC 2HE7A 3QC8B 4LTUA 3W0FA 5AUKA 1WSPA 4PD2A 2BWFA 1C76A 1MFWA 3P63A 1K51A 2CE7A 1SBBB 2HWJA 3FRHA 1Q5WB 2C96A 4KV2A 2IPPB 4OVZB 1F2AA 2KEBA 1KTKA 2V3PA 1GB4A 1AECA 1A5TA 1I4RA 1AYUA 4RY2A 2D7HA 4LK0M 2N7DA 1XT9B 3DZDA 3GLGA 4BOSC 4FCTA 4W9HA 3R9XB 1T3TA 1FO4A 3HHAA 2RR9A 4DHJB 3JR5A 2L32A 1Z6TA 3NUHB 1D2NA 3GRYA 2XU3A 1CQDA 1ATKA 1ROEA 2DNFA 3MC8A 2IGGA 2CS4A 2IO0B 2KAJA 3DF0A 2L1AA 2Y20A 3E46A 1CUKA 4N9F4 1T3QA 1L1ZA 3IG5A 3V60A 3VKHA 2LEKA 3BPFA 3GQ4A 2L52A 1E0ZA 5KHOA 2JY6A 2F7DA 3SAUA 3HM3A 2DC8A 1WR6E 1N5WA 4CYEA 3KYDD 2X38A 1WGDA 1WIAA 2AL6A 2ON8A 2FIFA 5I4DA 3DHHC 1N34M 3WHLA 4LJOB 1YQ3B 4BAXA 3B7QA 1P3QU 2J53A 4AJWA 3JR4A 2CEAA 2KC1A 2LVQD 1Q3CA 3RZFA 1WIVA 3AE7B 1O0EA 3ZNZB 5FLXS 1XXHA 4M0DA 3IEJA 1SXTA 2G8JA 1FJGM 3OVZA 3TEWA 1IBMM 3TWKA 1KF6B 4RGOS 2GBJA 1KYIA 4LNNA 8CATA 5D3DA 1V1OA 1SXJD 2KQ7A 1GPXA 1TU6A 3GRUA 1QQRA 2MSED 3ZTCA 1KFUL 2LH0A 1QT9A 4PDIA 1I4QA 4GKJM 3PGEA 3BK2A 2KNVA 3IV2A 1BVSA 1V5OA 4D8EA 1TKGA 1FNNA 2KDMA 2QC8A 5CX3A 2I2YA 2ZNVB 2CFOA 4CHKA 4N79A 2CRUA 4A20A 3SASA 3TBLD 4FJVB 3GPXA 5KO3A 5ITRA 5GXGB 3HJQA 2VZKB 2J7QC 2J7OA 2G3QB 3HVZA 1Z5AA 3HIZA 3VXWA 1CTEA 3LDZE 1TBEA 3USVA 1SJHD 3VHTC 2Y0TA 4C4VA 1DOYA 1UF0A 1OKSA 2CV1A 2KK8A 1E5WA 5EXTA 1YT7A 4K1RB 1MU5A 4ZRQA 2DWMA 2W3SA 4NJ6A 3T3OA 1JRPA 3SHFA 1ET9A 2LVPC 3VR8B 3TQSA 4N8WA 4A3PA 2RPQA 2VF8A 1CQVA 1I35A 3B2FA 1K3XA 2D7EA 2D3CA 2R9MA 1QZMA 4K3CA 2J5YA 1GB1A 3PHXA 2WXKA 5FTJA 4B95A 3BOWA 1NI2A 1SEBD 2KDFB 4NQLB 2OP3A 4XUIA 4DBGA 1ME3A 1QAMA 2SAKA 2BF8B 3E1ZB 1E90A 1XLPA 2K6DB 4KLBA 7PCKA 2PTLA 4KIKA 3N9YC 1BGOA 1ITOA 4WWNA 2L76A 1TL9A 3GQ3A 4ARIA 5FTLA 3RULA 1XLOA 1AN8A 1E7PB 4Q7JA 1FFUA 3MJ5A 1L6VA 2WGSA 4K7CA 2OJRA 1NHWC 3UJNA 3U60B 2AYOB 4W9IA 2LXAA 2E3TA 3CF2A 1Q1OA 1HNWM 2MEKA 1WJ7A 1ZMUA 1QDQA 2JQRB 2INPE 1KSFX 4IBBA 3HK0A 3A33B 4P1BC 2PNSA 4BS5A 4WAFA 1ZP0B 3AE3B 1E10A 2DWLA 2JY8A 2IJ0A 2BU3A 1QKZA 2N9KA 4USAA 2J52A 2D07B 4G54A 3NJTA 1SSNA 3UMMA 5JI3E 1L2CA 1ENFA 1HT1E 4B7FA 5ITTA 4ZOHC 3TCAA 1PGBA 1RFAA 3MORA 2QEJC 2HXZA 2R6FA 2C7HA 1S4VA 2BKRB 1JWAD 2EMSA 3OJ4B 3B21A 2O6VD 2AWTA 2WXLA 2ZEQA 1WXAA 1TKEA 4W9GA 5HFYA 2JUJA 4DR1M 3DBRB 1J5EM 5EJCA 4WQMA 3J81S 1BUIC 1E8YA 4IOIE 3WXEA 1P98A 1EWLA 5KPRA 2VH2A 4JIOU 1LM8B 2IGDA 2PREA 3U61B 1MHWA 3T9LA 1VJVA 2NQGA 2MROB 1Q39A 4B3TM 2KQ4X 3BK1A 2GBMA 2KQSA 3BC3A 4XR7A 2K3UA 1LTMA 1GJSA 4N59A 1YZBA 3PBHA 1WGLA 1QOBA 4FCWA 1M6DA 1MEGA 2FE8A 3Q2AC 3QAQA 2QDFA 1WGHA 2D3GA 1I4WA 2ZVOA 5MPOA 1GECE 4TUWA 4CDFB 4QOSA 3RT3B 3PXGA 1P7EA 2MX2A 3NVZA 1NHGC 4KKJA 4W9JA 1SGHA 5DCNA 1SP4B 4WAAA 1WE6A 4ZRPA 2XSZA 1YNTE 4WJQA 3SAWA 2AX5A 4MM3A 2CHZA 1YVBA 2HCBA 2QZ4A 3NS1A 3A42A 1VRAB 3DBHB 1YN3A 4JX1C 1POPA 3RNEC 1EWPA 4DMYA 1HQYE 1S3SG 4DXGA 2LJIA 1PRBA 2KJHB 1Z5SB 1E7VA 1XEEA 1Z5BA 3KW9A 2DYMA 1QDRA 1ACCA 1V34A 1GVNA 3FAHA 2DAJA 2D7GA 1ICFA 3H4MA 1RLFA 4ACFA 5DPSA 1WRIA 2MH7A 3B89A 3NZUA 2JF5A 3DVNV 2G9HD 1PPDA 4HWYA 3T38A 1VR9A 4F1SA 3LXSA 3Q69A 1WGKA 2VDBB 3GPPA 4NSRA 1G3IA 5JXVA 3L54A 1YK7A 2JQFR 4XBOA 1OQRA 4A8XC 2Q2EB 5KHQA 1WR1A 3I4VA 2UXCM 4LJ9A 4ANUA 1RM6C 2P5TA 2NCNA 1JR3E 1NY6A 5FTMA 3KWLA 5FR6A 3Q3MC 3AE5B 2H7JA 5CVNB 1EM7A 2J0JA 3K9MA 2QBYA 3DPDA 3GLFB 3LXFA 3W5UB 5EGWA 3AULA 2J0KA 3U6QA 3A9JA 4LY6A 3H1UA 4PYZA 3PVLA 3C0RA 2QPAA 3AV0A 3B7NA 1RFKA 1SG9A 3NBXX 3HU1A 1V86A 1VSNA 2I38A 2KLCA 2G7YA 4B9KA 2X8AA 3AE2B 3NVWA 4JI1M 1X1MA 4FK5A 1GC6A 2JSVX 2KZUA 2GFOA 2RGFA 1MEMA 4M8MA 2N4FA 1EF1A 5KQDA 2KTFA 4I4LA 3Q8CA 2W82A 2GI9A 4LLGM 4B3RM 2JVCA 4X6HA 4JI2M 2JWZA 3P4RB 1G41A 2AQ2B 5K16A 2DLBA 3KW6A 5BYQA 3H7SA 2Y21A 1QXPA 1JROA 2NBVB 5JZEA 2L05A 5F02A 1HXYD 2LRUA 3JW0X 3ONSA 3RN9C 1WGRA 3VLFB 2KTRB 9PAPA 3LMMA 1FNUA 2CP8A 4G11A 2KVRA 4Z6YA 4DK5A 5JH3A 1U9VA 2D11A 5HKHA 3ZQJA 3RGSA 2FCSA 2UU7A 2F5NA 3MC9A 3M63B 1WGNA 4CZWA 1N6ZA 2QHOB 3R66C 1N36M 5CHWA 3ZIMA 4A3OA 3DWMA 1PXVA 1AYWA 1I94M 1YLAA 1WX9A 3GLIE 5LNK1 3A45A 1XHBA 2QNJA 3PV1A 3N3KA 1NPZA 1DO2A 1IQPA 2GMIC 1QOGA 4FJCA 2C9OA 5D3IB 2MBOA 3J7AS 4AOFA 2OOBB 4RGMA 3AEDB 4NAWA 2NQIA 4QRXA 1F77A 1WFYA 3Q8XA 2Y5BA 1J09A 3AECB 2ASQA 2JXTA 4EFOA 3I01M 3PRMB 4WJOA 3SD5A 2K6BA 2N7EA 2ZBKB 1CV8A 2G6DA 2LWPA 2KDIA 4C7ZA 1UWMA 1DGGA 3U6SA 1EWOA 3HWNA 3K8UA 1HQCA 1WMHA 2EKIA 2QMTA 4XK8F 4IBJA 3J2PB 2VRRB 1V8CA 5H37D 1V80A 2AQ1B 1UUPA 1PGAA 4D8IA 1QLBB 4Q2JA 2YR0A 4D80A 1GABA 1FFVA 4I6NB 3KFQA 1S1QB 3T15A 2MQJA 4E3CA 4NJCA 4QRVA 2AGAA 4G4RA 3TUOA 2C60A 3J27B 4X57B 2OEDA 3RZWC 2JT4B 4X6JA 2PJHA 1OGWA 3VDPA 1IUEA 1SJED 3S3QA 1JR3A 5BYRA 4US9A 4EOYA 1C7YA 2K25A 4W9KA 1T0QC 3PNRA 2HTHA 4GMVA 5IKCM 3LQRA 1RWSA 1IN8A 4G4OA 4QHTA 4DR5M 3DBRI 1MI0A 2D5GA 2VZKD 2XNAC 4QOZC 2C98A 2DZMA 4US8A 1I4PA 2EKKA 4KDLB 4FBJB 3DBLI 1M94A 2YFQA 4CDEB 5DYIA 4KT0F 1P0RA 1FH0A 3TPZA 3PT2A 4ZDVA 2WDQB 1T6BX 3NOBA 3U6PA 1PBHA 1D0MA 3KS4A 1K82A 3SDLC 2N9PC 1EWYC 4YYUA 3ZNHA 3H7PA 4K7WA 3T1HM 3KUDB 5DPTA 2PLPA 1J0GA 1D5XC 2PMVA 3H8HA 2V6ZM 4DDGD 3H9DA 4NXMM 4IBCA 2O2VA 3F75A 2K8HA 4MSQB 3OLMD 4LDTB 2AVWA 1IN7A 3D8BA 1YOVB 3V05A 1AARA 4DWFA 2LNHC 3BWKA 3RVWA 1EO6A 3C3DA 2RKOA 3GO8A 3ML9A 3FUVA 2HJ8A 3NZ3A 2DZJA 3N20C 2HWKA 2QCUA 3VDUA 4KX6B 5EE9A 5LMUM 2NQ8C 4CGYB 2L00B 1MHXA 5LLIA 4DV6M 5IOIA 3MHSA 4R71A 2IBIB 3AOGA 4KZCA 2R61A 3UF8A 3GLIA 4DR2M 4YV8A 1I4GA 2YVCA 2MBBB 2FOIC 2XU4A 1IXSA 2UXDM 3I63C 4W4UA 3ZDMC 3UK6A 2GBKA 3QARA 3T1YM 3VTVA 1AU2A 2LUEA 3Q8GA 4ZUXU 1WZ3A 4HDOA 3QAUA 1ZMVA 1QF6A 2RRUA 5A24A 2CU3A 1PJQA 2CHGA 3U5ZB 5TSSA 2LVNC 1V33A 4MB7A 2VHSA 3WCQA 2DNAA 2UUBM 1WE7A 4LF4M 1TZOA 4AQYM 1VQ1A 1PFDA 1AW7A 1OTRB 3X23A 1WXQA 3BWUD 4LF8M 3AM9A 1FD6A 4WP2A 4KGSA 4BKTA 3E21A 1IXZA 3VR9B 1A5RA 1WX8A 1IXRC 4NRVA 3LW5F 1UBQA 3PO0A 3ZJUA 3OISA 3RNVA 3M6AA 5IWAM 2XGNA 5E26A 3A9KA 4ZHOA 1Y4HA 2DWQA 2WLBA 1JMLA 4DR3M 4N4ZA 2JY7A 2MGWA 3EGRA 1V1PB 1WXSA 4P16A 3A1QB 3TEXA 1QVRA 3VFDA 3V6CB 3V76A 3BY4A 2C5LC 3MMPA 3RNBC 4C80A 1PIPA 3DHIC 3NBIA 4MI7A 1DV0A 4OU7A 1HTOA 1L6UA 2W3RA 2HH5A 1TR8A 1VEKA 4BLCA 1XC8A 1NJGA 4JQWC 2XK5B 2ZVNA 4OVUA 1OIPA 1LQBA 1ET6A 1E9SA 2IO2B 3WANA 3D8LA 2JRHA 8PCHA 1DGHA 1FIQA 2KMAA 3VDZA 1AU3A 1B1ZA 2ZW1A 2Y5CA
chains in the Genus database with same CATH topology
1I7HA 1SXJC 4GC5A 4YWGG 1XWIA 4R7GA 3U6OA 4DXFA 3FILB 3U7ZA 1F2RC 2M60A 5E6JA 5H92C 3W5VB 3E4RA 3BYYB 4HL4A 3FUWA 3AJIB 3BVGA 4FCVA 4MH8A 3W31A 1XNRM 2E5LM 1TH4A 4OVZA 1DYQA 1B9RA 1GKIA 3PFIA 2L83A 4XWWA 4MGKE 3R8FA 1N5XA 4PDGA 4JI5M 2UXBM 1QYRA 4MH0E 3TEZA 3MHZA 2X4AA 3K8ZA 3VKGA 3GQ5A 1QANA 2XZFA 3UGJA 1L2BA 2XSZD 2BBCA 1XCTL 1AWDA 1BMLC 4IBIA 2OPFA 4QHSA 3KVWA 2CV2A 3BVZA 4GLSC 1UKFA 3BYTB 4FXCA 4LGMA 4S12A 1E32A 3GRRA 4L4UA 4B7HA 2IGHA 4WIPA 4LF5M 2WXQA 1GAQB 2R4EA 2ZM6M 2PVGC 3FTFA 2BS4B 4RGNA 3W1SA 2IPKD 1JALA 4OHJA 3I4YA 4HEA1 3C8YA 1TH3A 4QNRA 4WH4A 2Q5WD 1K50A 4IBKA 4HKQA 3MTVA 3R2IA 1TS3A 5FTKA 4DV4M 4MGYE 4LGYA 2XLJA 3PVSA 2XH9A 1HEZE 3SFZA 3Q8EA 3U6MA 2BS2B 1L5PA 4A5UA 1NJFA 5ITQA 3U4EG 2BW2A 5C3JB 2GB1A 3K2LA 3U6CA 2M0AA 1VZ6A 2V3NA 2G5GX 4JI3M 1N32M 1FMAD 3AH7A 3AOEC 2R46A 4KGRA 1E9RA 3KDSE 1HNZM 2KWDA 3ILKA 2L6OA 4LJ4A 3J7BA 3ZQ4A 4XDDA 3RPFC 3WHKA 4AG6A 1STEA 3W30A 2X49A 3SEBA 1ZXIA 3BIID 3U60A 3E9SA 2LXEA 4B0EA 2R18A 3W2DA 1HT2E 4LF7M 4JI4M 3U6LA 1PJJA 2DHRA 4GHLA 1KRHA 4G6ZA 2EUCA 3W0LB 1L0VB 3CTWB 2SEBD 5EXSA 1XF5L 1JR3D 2R65A 3HHYA 2NMQA 3I57A 3KSXA 2WXFA 3KLSX 4YY3M 3AE1B 3PHUA 2H88B 1D4BA 3U61A 1L2DA 5GKNA 4HLQA 1AYFA 2RDHA 3RFZB 3SARA 1FXAA 3P1MA 1EE8A 3ZJTA 3R8BA 3AE4B 3U6EA 5ITYA 2BJVA 3SR6A 2V0GA 4YTMB 2ACZB 4X66M 4LJ6A 2WXGA 4XWTA 2JU6X 2Z3XA 1OFFA 5EE1A 1FNWA 1TS4A 1C4PA 2ONQA 3HJ8A 2V1UA 2OHFA 1F0ZA 2DOSA 3EUB2 2Y0QA 4JN6A 4LCBA 2N0SB 2LFIA 4W5WA 2GRIA 1JWUD 5EZSA 2WXIA 2Y5PA 2WU5B 4BOUA 5BMHA 2Z84A 3SHGB 1NVMA 2CHVA 4KODA 3L4PA 1NNUC 1R2ZA 1TY2A 4AS1A 4FWGA 1XNQM 4UDUC 4D81A 3LB8C 3GLFA 4HJGE 4D82A 1NNJA 3OWEB 1NSFA 5KPTA 1ZPSA 1KLUD 2VIIA 1CK1A 1C1KA 2QIEB 1DKIA 1VZ8A 4R3DA 3ZH9B 3GLHB 1T5XD 4DR4M 2WXRA 1VLBA 2UU9M 3R2TA 2K22A 1TY0A 2DZOB 1UM8A 4P6VF 4M9ZA 4FVMA 5BPVA 3P4QB 1NI3A 2LHEA 4DV7M 5EXXA 4REZA 5C18A 1XCQL 7CATA 1CZPA 2FFJA 4RNAA 4YSZB 1N63A 1PYWD 4O1NA 4B0MA 3HRDD 1SE4A 4KLNA 3W9CB 4LRSA 4X64M 4OW0A 5T8IA 2RGHA 2L7IA 4IBEA 3IG8A 3EIEA 2VQFM 1QAQA 5EE3A 4RF0A 1JQ4A 2AQ3B 3CF0A 3PRMA 1EU3A 3KP0E 1DOXA 1IY2A 1FEHA 1P7FA 2WXPA 4Z8XA 2LUMA 4LJ7A 1G59A 3IFUA 5HG2A 3SC3A 2BJWA 1TS2A 4OZBA 3TMPA 5EZQA 1VJKA 2ZW0A 2VQEM 4RH6A 2I7NA 3KS8A 1DGBA 5KQ8A 5BMGA 2QJLA 4L1BA 3SYKA 3SATA 2KW0A 3GP1A 4C7YA 4CISA 3SMPA 1E6EB 2KRUA 3TWLA 1SE2A 4OZAA 3KOXE 4J3OD 3AEEB 3GS2A 3TRKA 2WXNA 2LGIA 2CV0A 4IJEA 4LJ5A 4FW9A 3KWVA 4DV3M 3LVVA 4DUYM 2ZAMA 2EA0A 1J7KA 2PIAA 1Z5CA 1UGJA 1SXJB 3FC4A 2LWXA 4A55A 2KN4A 2KXEA 3I9V1 2RGOA 2FUG1 4DV5M 4NZLB 3L25A 3HJSA 4FD2A 3ZJVA 1ZDVA 3BBAA 4JXJA 4A6QA 4ARCA 3AEAB 1JWMD 1J7AA 2WXOA 1L1TA 5C1BA 3MK6A 3AE8B 1R6BX 2NTTA 2XN9C 3HU3A 1IN6A 4NL4H 3SMSA 3L26A 1FCLA 3KOWE 3ETRA 5IREB 4BBAA 3HHWA 1BXTA 1FNVA 3PNVA 1MPEA 4A9AA 1M4VA 3HGIA 4I81A 1V1PA 3B2GA 1E9MA 4HKZE 4HXDB 5DYGA 4DR7M 4KO8A 2WXHA 4YTPB 3L27A 1FRDA 4GHAA 2L7HA 2INNE 3VRAB 1C4AA 3MHVC 1JWSD 1QOAA 4MACA 3PHWA 3L28A 3FYCA 3LYYA 4GDLB 5BR8M 2A5YB 1NYQA 3FILA 4B08A 2O5RA 2J4XA 3FTEA 2Z7JA 2XFSA 2BS3B 1XMQM 2MJ3A 2DXIA 1LV7A 3AKZA 4IIWA 2J7NA 1VZ7A 3GB1A 4D2KA 2CHQA 4L23A 1YJJA 4LFAM 2DWZB 4XDCA 5AUIA 4YTNB 1GL6A 5A2QS 1R7RA 1DOIA 2NTSA 4LZZA 4DV1M 3DOAA 4EE2A 2JWUA 4M0WA 2JYEA 2DWNA 4PT5A 4JYAM 1HZ5A 2QSDA 4KGTA 1XMOM 2H1RA 4X62M 3Q8AA 5DNYA 1N33M 1TDZA 4LRTA 1IGCA 5EP1A 3QWLA 4C56C 4JI6M 3CIRB 5G5HA 1YN4A 1R7SA 2F5PA 3FUTA 2BYTA 1KH0A 4LF9M 4D8BA 3NVYA 2HKJA 1NY5A 2TSSA 5EP4A 2WXJA 1K53A 4LJ8A 3LVWA 1D6EC 3P4PB 2W54A 3HWSA 2WS3B 4GIPA 1NVID 3PZ7A 3TL4X 3RGPA 1DGFA 4XGIA 4FWHA 2ICIA 4LZJA 5ITXE 4GMQA 2F4VM 1W5SA 1F2RI 1PDXA 4GUAA 3BB7A 1YE9A 4DUZM 1Y56A 1WWTA 2UUAM 5H8YE 3PRPA 4XE0A 1K3WA 4YSXB 1TKYA 4ITQA 1K52A 1D5MC 2RDGA 3RE8A 1SF0A 4XZXA 1FCCC 5EQTA 4ITKA 4RGTA 2JRIA 4GDKB 1OFHA 1XLQA 3GPUA 2DBYA 4JI8M 1EWCA 2M56B 4TSSA 1IBXB 4B3SM 1OJLA 2ZAOA 2EO2A 3K1JA 3AV8A 3BVMA 1HQRD 2WDVB 3HKPA 1PM5A 2F5OA 4DR6M 5EP3A 4AW4A 2V1CA 4PCZA 1ZXHA 2BTWB 3SFEB 3AB5A 1GLNA 4JI7M 3C58A 3UI3A 2WP9B 3FUUA 1QQWA 4A90A 2MJDA 4TQ0A 4DQOC 2ZANA 1PGXA 4NOOB 2JA2A 4IUMA 3E56A 3GLGB 2OQ4A 3MP2A 3KFUG 3FKEA 4KHPM 4G4QA 4K0KM 4IP3A 2AHMA 1ZQ9A 1YUBA 1R2YA 2I7PA 4MT5A 4AI6A 3IT4B 1C77A 4OZCA 2DZNB 1XXGA 3CWIA 2XF3A 1GOZA 3FTCA 3GPYA 4RCOA 1E94E 2KZSA 2K0PA 1CJEA 4CHTB 4ZPXA 4AG5A 4IDIA 2PKOA 2W55A 1L4ZB 1TJEA 2ERCA 2FNAA 2EELA 4HRSA 2XFTA 1JQJC 5ITXA 2QENA 1KFYB 2B76B 3EA6A 3KOZE 3A98B 1XXHB 4TMAB 2L09A 1HZ6A 1NYRA 1VDVA 1DO0A 4IJFA 3ZC7B 3DA1A 5LMNM 1KLGD 4JI0M 3L29A 3P42A 1JW9D 3AEBB 3BZDB 2C5RA 2BNKA 3O65A 3K92A 3OTOM 4NAMA 3OQCA 4GC9A 3HUIA 3VRBB 5JI2E 4WURA 1Z59A 2QILA 3DFZA 1NENB 2PW9A 3KXEC 3KSJA 4GITA 4ZYSA 4RF1A 4L8RC 1N60A 2KRKA 3U2SC 1ZE3D 1KFVA 2CJOA 1PJIA 3M0EA 2K47A 1D5ZC 5F3WA 2JX5A 5EP2A 4L16A 1IY1A 3GLHA 1MHHE 4MGHA 3IAS1 2F5SA 4YSYB 3PZ8A 4II7A 3URYA 1S3SA 3Q8BA 1SXJE 2R62A 1WYGA 5FR3A 4AKGA 4LG2A 2M5ZA 3AN1A 4I5SA 2LHDA 1N62A 1QAOA 4JPSA 4OX9M 2IDYA 3T3NA 2K5PA 3KQ4A 1A70A 5C2TB 2YQZA 1ZDXA 4BOZA 4HROA 1TDHA 3CF6E 1C9FA 3AEFB 4M9SA 4B7GA 5IZ7D 2F5QA 2WNMA 1UWXA 2BT6A 4IBFA 3ZYYX 5BYSA 2JTCA 1XO3A 1ORYB 3O13A 5IT9S 2FBWB 1IBLM 1X37A 1Q3BA 5BMIA 1JWBD 3TWMA 1YJIA 3U52E 1RYJA 2YNMD 1NEKB 4MM3B 3SAVA 4JV5M 4IBDA 1IN5A 1C4CA 3IT6B 1N75A 4LFBM 4B3MM 1QILA 1H6UA 1UNSA 2Z8LA 4G4NA 1TGUA 3KP1E 3B9JA 4JE3B 5EXPA 4M9XA 2V4IB 2R45A 1FXIA 1YMHE 3J9CA 2QBYB 3EIHA 1SXJA 4GRIA 2N9LA 1PUTA 3TEYA 2CUZA 3DWGC 3VK7A 3ZGZA 1LO5D 4LJAA 4N58A 3THGA 1HA5A 5HI1A 5ITUA 3MC0B 4FWDA 2MJEA 3AEGB 3BOSA 3FD9A 2RPVA 2JZPA 2G8LA 3U6DA 4NSOB 5FKAC 2C9CA 4DV0M 1YSYA 3P4SB 1IGDA 2DYOA 1SE3A 5FTNA 3MFGA 3AMZA 3NVVA 3AFHA 4L78A 3UZUA 1MVKA 2JYTA 4I8OA 2BB5A 3L2AA 4NXNM 3MP9A 2PVOD 3NRZA 2YEPB 4KKIA 4YT0B 1I4HA 4YXDB 4BB9A 1TYGB 3B9PA 1PVJA 1ESFA 2YEPF 3Q8FA 1HNXM 4IKGA 2HL7A 1IY0A 3PSEA 4NAWB 1YQ4B 4BOSA 4AKHA 4LFCM 1G4AE 3ABVB 3A46A 4AKIA 3SFDB 4L2YA 3AE9B 4AZFA 3U5ZA 5KPZA 4A3VB 1ZOYB 1L4DB 3I51A 4LF6M 2RMMA 2J42A 3HU2A 1N61A 4MGZE 1SB3C 2KA6B 3PNYA 1ZUD2 2Y3AA 3VQIA 2UZJA 1G8PA 3TSSA 2HDEA 3M7GA 2WU2B 4RKXA 4YHHM 2C99A 1L0XB 1L0YB 4ZTBA 3J80S 3TE6A 3HHXA 2QP9X 1FRRA 3GRVA 2XZUA 4ZHPA 1IM2A 4RFBA 2M19A 2DVWB 1C79A 5FSWA 1HR0M 1V97A 1J7BA 2CJNA 1J7CA 1ZAEA 4QNMA 4DV2M 3JAMS 1OFIA 4TQ1A 1FM0D 1VDDA 3AOEA 4IBGA 1GL7A 5D7GA 3NWLA 2N7JA 3IXSA 2J7QA 4GH9A 4EIWA 3VK8A 2XEPA 4BOPA 4N6EB 2UUCM 2R4JA 2WXMA 1EU4A 1IN4A 3GLIB 1L8QA 4CQNA 3SBJA 3IAM1 3SYLA 3HVDA 2Z4SA 1N77A 1XLNA 1IXSB 4H2AA 2HHHM 3RFWA 3FTDA 4AQ7A 3AE6B 2BB6A 5FK9C 1DGJA 1YN5A 1W5TA 4WW0A 4L15A 4JWUC 1JCKB 1TS5A 2KMMA 3FYDA 2Z4RA 4X65M 5EE0A 2WDRB 3FUXA 1IBKM 2LMCA 3KOYE 3AL0C 1C78A 4MGIE 4WWMA 1TH2A 2E6XA 3GP7A 4NRWA 2BTEA 1QOFA 1I4XA 2WQYB 5G5GA 3LQQA 5HHDG 2HTME 1DGHB 1N78A 1IBXA 2H89B 3HHZA 1OQQA 3V3XA 2G1EA 1SIJA 2KACA 2K9XA 2BTWA 1Q10A 1MX0A 4GKKM 3ZCBB 4JWSC 4LTUA 3W0FA 5AUKA 1WSPA 4PD2A 1C76A 3P63A 1K51A 2CE7A 1SBBB 2C96A 4OVZB 2KEBA 1KTKA 2V3PA 1GB4A 1I4RA 2D7HA 4LK0M 3DZDA 3GLGA 4FCTA 3R9XB 1T3TA 1FO4A 3JR5A 2L32A 1Z6TA 3NUHB 1D2NA 3GRYA 1ROEA 2IGGA 2KAJA 2L1AA 2Y20A 1T3QA 1L1ZA 3IG5A 3VKHA 2LEKA 3GQ4A 2L52A 1E0ZA 3SAUA 1N5WA 2X38A 2ON8A 5I4DA 1N34M 3WHLA 1YQ3B 2J53A 3JR4A 2CEAA 1Q3CA 3AE7B 5FLXS 1XXHA 4M0DA 1SXTA 1FJGM 3TEWA 1IBMM 3TWKA 1KF6B 4RGOS 1KYIA 8CATA 5D3DA 1V1OA 1SXJD 1GPXA 3GRUA 1QQRA 2LH0A 1QT9A 4PDIA 1I4QA 4GKJM 3BK2A 4D8EA 1TKGA 1FNNA 2KDMA 2I2YA 2CFOA 3SASA 3GPXA 5KO3A 5ITRA 5GXGB 3HJQA 2VZKB 2J7QC 2J7OA 3HVZA 1Z5AA 1SJHD 2Y0TA 1DOYA 2CV1A 5EXTA 1MU5A 4ZRQA 2DWMA 2W3SA 3T3OA 1JRPA 3SHFA 1ET9A 3VR8B 3TQSA 1CQVA 3B2FA 1K3XA 2D7EA 1QZMA 1GB1A 3PHXA 2WXKA 5FTJA 1SEBD 1QAMA 2SAKA 1XLPA 2PTLA 3N9YC 3GQ3A 4ARIA 5FTLA 1XLOA 1AN8A 1E7PB 1FFUA 3MJ5A 1L6VA 1NHWC 3UJNA 3U60B 2E3TA 3CF2A 1HNWM 2MEKA 2JQRB 2INPE 1KSFX 4IBBA 4WAFA 1ZP0B 3AE3B 1E10A 2DWLA 2IJ0A 2BU3A 1QKZA 2N9KA 4USAA 2J52A 1SSNA 3UMMA 5JI3E 1L2CA 1ENFA 1HT1E 4B7FA 5ITTA 4ZOHC 1PGBA 2QEJC 1JWAD 3B21A 2WXLA 1TKEA 5HFYA 4DR1M 1J5EM 5EJCA 4WQMA 3J81S 1BUIC 4IOIE 5KPRA 2IGDA 3U61B 4B3TM 1Q39A 2KQ4X 3BK1A 2K3UA 4N59A 1YZBA 1QOBA 4FCWA 2FE8A 1I4WA 5MPOA 4TUWA 4QOSA 3PXGA 1P7EA 4KKJA 3NVZA 1NHGC 4BOQA 4ZRPA 2XSZA 1YNTE 3SAWA 2AX5A 2HCBA 2QZ4A 3NS1A 3A42A 1VRAB 1YN3A 4JX1C 1HQYE 4DXGA 2LJIA 1XEEA 1Z5BA 2DYMA 1ACCA 1GVNA 3FAHA 2D7GA 3H4MA 1WRIA 2MH7A 2G9HD 3T38A 1VR9A 3Q69A 1WGKA 3GPPA 4NSRA 1G3IA 5JXVA 4XBOA 1OQRA 4A8XC 2Q2EB 3I4VA 2UXCM 4LJ9A 1RM6C 2P5TA 1NY6A 5FTMA 3KWLA 3AE5B 1EM7A 2QBYA 3LXFA 3GLFB 3W5UB 3U6QA 4LY6A 3C0RA 2QPAA 3AV0A 1RFKA 3HU1A 2I38A 2X8AA 3AE2B 3NVWA 4JI1M 2JSVX 2KZUA 5KQDA 4I4LA 3Q8CA 2W82A 2GI9A 4LLGM 4B3RM 4JI2M 3P4RB 1G41A 2AQ2B 2DLBA 3KW6A 5BYQA 2Y21A 1JROA 5JZEA 1HXYD 3VLFB 3LMMA 1FNUA 4Z6YA 3RGSA 2F5NA 1N36M 3DWMA 1I94M 5LNK1 3A45A 1XHBA 1DO2A 1IQPA 1QOGA 2C9OA 5D3IB 3J7AS 4RGMA 3AEDB 1F77A 3Q8XA 1J09A 3AECB 2JXTA 2ZBKB 4C7ZA 1UWMA 1DGGA 3U6SA 1HQCA 2QMTA 2EKIA 4IBJA 3J2PB 1V8CA 5H37D 2AQ1B 1UUPA 1PGAA 4D8IA 1QLBB 4Q2JA 2YR0A 4D80A 1FFVA 3T15A 4NJCA 2AGAA 4G4RA 3TUOA 3J27B 2OEDA 3VDPA 1IUEA 1SJED 1JR3A 5BYRA 4US9A 3LQRA 1RWSA 1IN8A 4G4OA 4QHTA 4DR5M 1MI0A 2D5GA 2VZKD 2XNAC 4QOZC 2C98A 4US8A 1I4PA 2YFQA 5DYIA 3TPZA 3PT2A 2WDQB 1T6BX 3U6PA 3KS4A 1K82A 1EWYC 3ZNHA 3T1HM 2PLPA 1D5XC 2PMVA 3H8HA 2V6ZM 4NXMM 4IBCA 1IN7A 3D8BA 3V05A 2LNHC 2RKOA 3GO8A 3FUVA 3NZ3A 2HWKA 2QCUA 3VDUA 4KX6B 5EE9A 5LMUM 2NQ8C 4CGYB 1MHXA 4DV6M 3AOGA 2R61A 3GLIA 4DR2M 1I4GA 2FOIC 2UXDM 3UK6A 3T1YM 3QAUA 1QF6A 2CU3A 2CHGA 3U5ZB 5TSSA 4MB7A 3WCQA 2UUBM 4LF4M 1TZOA 4AQYM 1PFDA 1AW7A 1WXQA 3BWUD 4LF8M 3AM9A 1FD6A 4KGSA 1IXZA 3VR9B 1IXRC 4NRVA 3PO0A 3ZJUA 3RNVA 3M6AA 5IWAM 2XGNA 5E26A 4ZHOA 2DWQA 2WLBA 1JMLA 4DR3M 3EGRA 1V1PB 4P16A 3TEXA 1QVRA 3VFDA 3BY4A 4C80A 3NBIA 4MI7A 2W3RA 4OU7A 1L6UA 4BLCA 1XC8A 1NJGA 1ET6A 1E9SA 3D8LA 1DGHA 1FIQA 1B1ZA 2ZW1A 2Y5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MJ5 A;  2FE8 A;  4REZ A;  4R3D A;  4RNA A;  4P16 A;  4RF0 A;  3MP2 A;  4WUR A;  5E6J A;  4OVZ B;  4M0W A;  3E9S A;  4OW0 A;  5KO3 A;  4RF1 A;  4PT5 A;  4MM3 B;  4OVZ A; 
#chains in the Genus database with same CATH topology
 1GG3 A;  1I7H A;  3PTF C;  1SXJ C;  4GC5 A;  3PHW B;  3KWB X;  2UWQ A;  2KNZ A;  1TF0 B;  4YWG G;  5AZH A;  3WAL A;  1XWI A;  2KOX A;  4R7G A;  2DEN A;  3SU8 X;  1NB5 A;  3C19 A;  2FCN A;  3K9O A;  3U6O A;  4DXF A;  3FIL B;  3ZUN A;  2KHH A;  3U7Z A;  2N9E B;  1U5I A;  1F2R C;  2M60 A;  5E6J A;  2QSF X;  4II2 B;  4RM8 A;  5H92 C;  3RD2 A;  3RUI B;  4C00 A;  4I04 A;  3W5V B;  3E4R A;  3BYY B;  2K6Q A;  4HL4 A;  3FUW A;  3AJI B;  1YX5 B;  3BVG A;  4FCV A;  4MH8 A;  3W31 A;  4HCN B;  1XNR M;  2E5L M;  1TH4 A;  3B7Z A;  4OVZ A;  3ALB A;  1DYQ A;  1B9R A;  1GKI A;  3PFI A;  3PRZ A;  2L83 A;  4CO7 A;  3CGW A;  4XWW A;  4MGK E;  3QA8 A;  2I1K A;  3NY5 A;  3K9P B;  3CH2 X;  3R8F A;  1N5X A;  4PDG A;  4JI5 M;  3AXC A;  2R2Q A;  2UXB M;  1WX7 A;  5J18 A;  2ZCB A;  1QYR A;  4MH0 E;  3TEZ A;  3MHZ A;  2X4A A;  1WYW B;  3K8Z A;  3VKG A;  3BBZ A;  3X0W A;  3I04 M;  3GQ5 A;  1BP4 A;  1QAN A;  2PPH A;  1YQB A;  2XZF A;  3UGJ A;  1L2B A;  4PS8 A;  2MRP A;  3R7Q A;  2XSZ D;  3N32 A;  3DCG A;  2WSE F;  2BBC A;  1XCT L;  1AWD A;  5LXH A;  1BML C;  5LXI B;  4IBI A;  1CSB B;  2OPF A;  4M0W B;  3UGB B;  4QHS A;  3KVW A;  3N1Z C;  2DHY A;  3ZVV A;  2NBU A;  2DCB A;  1GC7 A;  2CV2 A;  3BVZ A;  3A4S C;  4GLS C;  2XBB C;  1UKF A;  1WF9 A;  3BYT B;  3NS8 A;  4FXC A;  3DHG C;  3FRI A;  4LGM A;  2DZY A;  3N1X C;  1Y8G A;  4P6G A;  4S12 A;  4PS7 A;  2DC6 A;  1E32 A;  5IO9 A;  2RD0 A;  3GRR A;  2LD9 A;  2DCA A;  1TTE A;  4Y28 F;  4L4U A;  2FO5 A;  4B7H A;  2IGH A;  4WIP A;  3IMA A;  4LF5 M;  4F2L A;  2WXQ A;  4EKU A;  2AL3 A;  1GAQ B;  2R4E A;  3QHT A;  2ZM6 M;  2PVG C;  3UQB A;  2R9C A;  3FTF A;  2BS4 B;  4RGN A;  3ZRC A;  4W9D A;  3W1S A;  2IPK D;  1JAL A;  3KWZ A;  4OHJ A;  3KX1 A;  4FA6 A;  3I4Y A;  4HK2 A;  4HEA 1;  3C8Y A;  2ZCC A;  1TH3 A;  4QNR A;  3RNC C;  2V1Y A;  4IW0 A;  4WH4 A;  2Q5W D;  2ZTC A;  1K50 A;  4IBK A;  4HKQ A;  1ZGU B;  3MTV A;  3OVX A;  4HLE A;  3S3R A;  4MZO A;  3U30 A;  3R2I A;  2JQG R;  3U8Z A;  1TS3 A;  1C3T A;  5FTK A;  2MBQ A;  2C0Y A;  2E01 A;  5AEK B;  4DV4 M;  2G3Q A;  4MGY E;  4LGY A;  3M99 A;  4FJZ A;  3N3G A;  4F8C B;  3JSV B;  4ANV A;  2XLJ A;  3PRP B;  3PVS A;  2XH9 A;  3QYE A;  1HEZ E;  3SFZ A;  2KVZ A;  1UZX B;  4HVB A;  3Q8E A;  3U6M A;  2DAE A;  2BS2 B;  1KXR A;  1L5P A;  1TLO A;  4A5U A;  1NJF A;  1F1H A;  5ITQ A;  2WX0 A;  3U4E G;  2BW2 A;  5C3J B;  2GB1 A;  2JRI B;  3K2L A;  3U6C A;  1MJG M;  1YD8 U;  2KAN A;  2M0A A;  1VZ6 A;  2V3N A;  2G5G X;  4JI3 M;  1N32 M;  2LZ6 A;  4LNI A;  2K0B X;  5CVO B;  1FMA D;  3AH7 A;  3AOE C;  2R46 A;  2MHJ A;  4KGR A;  3RMK C;  1E9R A;  4HDQ A;  3KDS E;  1PE6 A;  1HNZ M;  2ZPY A;  4EZJ A;  2ZTD A;  2KWD A;  2DZL A;  3ILK A;  2L6O A;  2KNA A;  5L95 C;  4LJ4 A;  3RVX A;  3D32 A;  4TUU A;  4W9F A;  3J7B A;  2IY0 B;  3GLF E;  4XDD A;  3RPF C;  3WHK A;  4AG6 A;  3ZQ4 A;  2R9N A;  1STE A;  4ANW A;  3W30 A;  2KWC A;  4IM3 A;  2X49 A;  3B79 A;  2BKF A;  1ZXI A;  3RNG C;  3SEB A;  2YJ2 A;  2M8S A;  3BII D;  1CS8 A;  1E7U A;  2AYO A;  3U60 A;  3E9S A;  4BSQ A;  2EKF A;  2LXE A;  4B0E A;  4BVU C;  2R18 A;  3W2D A;  1MG4 A;  4IUM B;  1HT2 E;  2CU1 A;  2DX5 B;  4LF7 M;  4JI4 M;  4TKN A;  3U6L A;  1PJJ A;  3AU4 A;  2DHR A;  2LI5 A;  4K3B A;  4MDK E;  4GHL A;  1KRH A;  4QBB A;  1TIF A;  4G6Z A;  2EUC A;  3Q3F A;  5L8R F;  2D3A A;  1TGZ B;  3W0L B;  1L0V B;  3CTW B;  2KX3 A;  2SEB D;  2O6X A;  5EXS A;  2JWS A;  3P2B A;  1XF5 L;  1JR3 D;  2R65 A;  5J2R A;  3HHY A;  3ERV A;  2NMQ A;  3I57 A;  3KSX A;  2KJR A;  3K24 A;  2ACT A;  2WXF A;  3KLS X;  4YY3 M;  3AE1 B;  3PHU A;  4EUT A;  2NBW B;  2H88 B;  1WXM A;  3U61 A;  1D4B A;  1CPJ A;  4W9C A;  1L2D A;  5GKN A;  4HLQ A;  1AYF A;  3OAW A;  1WJN A;  2RDH A;  1IWD A;  1MG8 A;  3RFZ B;  3SAR A;  1FXA A;  2KO3 A;  3P1M A;  4WQO B;  1KHQ A;  1EE8 A;  1T6O A;  2KD0 A;  2KYW A;  4PP2 E;  3GCB A;  3I06 A;  3ZJT A;  3RNA C;  4PK1 A;  2BWE A;  2D10 A;  3R8B A;  2DAM A;  3AE4 B;  3T8M A;  2LGD A;  3NHE B;  3U6E A;  4GIV A;  2FT2 A;  5ITY A;  2BJV A;  3SR6 A;  2V0G A;  4YTM B;  3MTN B;  2ACZ B;  4X66 M;  4LJ6 A;  2WXG A;  4XWT A;  2JU6 X;  2Z3X A;  1OFF A;  5EE1 A;  1FNW A;  2EJS A;  5DPR A;  1TS4 A;  1C4P A;  1ISN A;  4DDI D;  2ONQ A;  3O65 B;  3HJ8 A;  2V1U A;  2OHF A;  4W9E A;  3H89 A;  1EIJ A;  1TZ1 A;  1F0Z A;  2DOS A;  4P1C C;  3EUB 2;  2Y0Q A;  4JN6 A;  1U9W A;  4LCB A;  2N0S B;  5DPW A;  2FH0 A;  3DBL B;  2XU1 A;  2LFI A;  3W67 A;  4W5W A;  2GRI A;  3VFK A;  3VH3 B;  1AIM A;  3H7D A;  4URK A;  1JWU D;  5EZS A;  2WXI A;  2Y5P A;  3MHS D;  2WU5 B;  4BOU A;  2FCM A;  3FE3 A;  5BMH A;  3H6S A;  2Z84 A;  3SHG B;  1NVM A;  1YX6 B;  1PPO A;  2CHV A;  4KOD A;  4WJP A;  3PRE A;  3L4P A;  1NNU C;  4FN2 A;  3ZXV A;  1R2Z A;  3Q3N C;  2KDE B;  1TY2 A;  4IM2 A;  4FWG A;  1XNQ M;  4UDU C;  4D81 A;  4AS1 A;  1WY8 A;  3LB8 C;  3GLF A;  4HJG E;  1YK8 A;  4HEO A;  2BPS A;  1F52 A;  4D82 A;  1NNJ A;  3OWE B;  1NSF A;  5KPT A;  4CDD B;  1ZPS A;  1KLU D;  2WX1 A;  4PI3 A;  2HAK A;  2VII A;  4W5B A;  3H4J A;  1CK1 A;  1C1K A;  3ML8 A;  2QIE B;  1DKI A;  1VZ8 A;  4R3D A;  3ZH9 B;  4II3 B;  3GLH B;  1T5X D;  3C9E A;  3CST A;  2H5X A;  4DXA B;  1CB5 A;  4DR4 M;  3DDC B;  2WXR A;  1VLB A;  3DOW A;  2UU9 M;  3R2T A;  1VG5 A;  2K22 A;  3UQA A;  4MJS B;  3IG3 A;  1TY0 A;  2L4F A;  2DZO B;  1UM8 A;  2XEW A;  4M01 A;  3DVG X;  4KSL C;  4P6V F;  2HJ1 A;  4M9Z A;  3M95 A;  2DCD A;  4FVM A;  5BPV A;  3P4Q B;  3BCN A;  1NI3 A;  1RAX A;  3NG0 A;  1BY8 A;  5CTR C;  3T6P A;  1KM7 A;  2FAZ A;  2YJ9 A;  2LHE A;  3V6E B;  2DYB A;  4DV7 M;  5EXX A;  1NBF C;  4REZ A;  2DI0 A;  5C18 A;  1XCQ L;  2KTR A;  7CAT A;  2B1N A;  2CIO A;  1CZP A;  2FFJ A;  4RNA A;  4YSZ B;  1N63 A;  1PYW D;  4O1N A;  4WWP A;  4B0M A;  1AU0 A;  4BOZ B;  3HRD D;  3WAO A;  1SE4 A;  3QJ3 A;  4KLN A;  4G3X B;  3ZKJ C;  1ME4 A;  3ZLZ A;  3KW5 B;  3A4R A;  3W9C B;  4LRS A;  4X64 M;  2QHO A;  4OW0 A;  5T8I A;  2RGH A;  2FID A;  2L7I A;  4IBE A;  3DBS A;  3IG8 A;  3EIE A;  3OF9 A;  2VQF M;  3B08 A;  4L6V 6;  3JYU A;  1QAQ A;  3I5J C;  5EE3 A;  2G45 B;  5JA7 A;  4RF0 A;  4HPP A;  2BQQ A;  1C1Y B;  3DQV A;  1JQ4 A;  2AS8 A;  2I1J A;  2AQ3 B;  2OUL A;  3U7D A;  1EWM A;  3CF0 A;  1PGY A;  3WA0 A;  4Q8G A;  2MP2 B;  4NPN A;  3PRM A;  1EU3 A;  3KP0 E;  1DOX A;  1IY2 A;  1FEH A;  1P7F A;  3IBE A;  2WXP A;  4FIP A;  4Z8X A;  2LUM A;  4LJ7 A;  3Q6B A;  1G59 A;  1PJS A;  1L7Y A;  3IFU A;  5HG2 A;  3B0A A;  4DHJ D;  3SC3 A;  2WZJ A;  1IPG A;  1THE A;  3L13 A;  2BJW A;  1TS2 A;  3KVF B;  3BPM A;  3QQ8 B;  4XGA B;  3PZD A;  4OZB A;  3TMP A;  5PAD A;  1ZMW A;  2NS5 A;  5EZQ A;  1VJK A;  1PQS A;  2ZW0 A;  2R9O A;  2VQE M;  4RH6 A;  2I7N A;  2JXN A;  3KS8 A;  1DGB A;  4K7U A;  1UH6 A;  5KQ8 A;  2KDB A;  3D6S A;  5BMG A;  2QJL A;  2MW5 A;  4L1B A;  2FS1 A;  4AXL A;  3SAT A;  3SYK A;  2KW0 A;  1RU3 A;  2GLS A;  3GP1 A;  4C7Y A;  1PAD A;  3EEC A;  3UIN B;  4KZ0 A;  1KFX L;  3AI5 A;  4S17 A;  4CIS A;  2JZ3 B;  1NB3 A;  2KWU B;  1Y08 A;  3SMP A;  1E6E B;  3CH3 X;  2KRU A;  3TWL A;  1SE2 A;  4OZA A;  2KNB A;  3KOX E;  4J3O D;  3AEE B;  3GS2 A;  5GMV A;  4ASW C;  3TRK A;  4YYS A;  4YYV A;  2QQ8 A;  2LXC A;  3L0W B;  2WXN A;  2BYE A;  2V3S A;  2LGI A;  2CV0 A;  4IJE A;  2ARY A;  4LJ5 A;  4FW9 A;  3KWV A;  4DV3 M;  3LVV A;  4DUY M;  2ZAM A;  3ECI A;  2EA0 A;  1J7K A;  4WWO A;  2PIA A;  1Z5C A;  2BYF A;  1ZCM A;  2LVO A;  5D6J B;  2O01 F;  1UGJ A;  5J17 A;  1SXJ B;  3R7R A;  3FC4 A;  2LWX A;  5AZF A;  2KN4 A;  1E8W A;  4A55 A;  2WSC F;  2KXE A;  3I9V 1;  1PPP A;  2RGO A;  2V9H A;  1OIZ A;  1Q6K A;  2FUG 1;  1TTN A;  4DV5 M;  4NZL B;  3IVF A;  1GO5 A;  2DAF A;  1V49 A;  5FPW A;  2NR2 A;  3L25 A;  1K8R B;  3HJS A;  4AP4 C;  3P5W A;  4FD2 A;  3ZJV A;  1ZDV A;  3BBA A;  4JXJ A;  3TIX A;  4A6Q A;  3PW3 A;  4ARC A;  3AEA B;  2DJF B;  1JWM D;  4K7S A;  5D2M B;  2MH8 A;  2LGY A;  2IBI A;  2G8E A;  2IYD B;  2WYQ A;  1J7A A;  3AI8 A;  2WXO A;  3RVV A;  4JL9 A;  1L1T A;  3HY5 A;  1AIP C;  1R4N I;  1WJ4 A;  5C1B A;  3MK6 A;  3AE8 B;  1R6B X;  4ANX A;  1T43 A;  2NTT A;  1XB2 B;  2NQA A;  2XN9 C;  3HU3 A;  1IN6 A;  4NL4 H;  2AEH A;  4BPV A;  3SMS A;  5L83 A;  2DAG A;  4GXB A;  4I6L B;  3N4C A;  1WJ6 A;  3L26 A;  2JZ1 A;  3VVW B;  1FCL A;  4EZK A;  3KOW E;  1IP9 A;  3ETR A;  3TNX A;  1OTR A;  4M00 A;  1QUT A;  5IRE B;  3C9P A;  5JH5 C;  4BZA A;  4BBA A;  5TR5 A;  3HHW A;  2FQ9 A;  4MSX A;  3QIJ A;  1MS6 A;  2L2D A;  1BXT A;  1LXD A;  4XC2 A;  1FNV A;  2L0F A;  2KC2 A;  3OJ3 A;  3PNV A;  1SE9 A;  1MPE A;  4A9A A;  1M4V A;  3WIM A;  3HGI A;  4I81 A;  1V1P A;  3B2G A;  3ZW3 A;  1E9M A;  3PSE B;  4HKZ E;  1QOL A;  4HXD B;  3A1Q A;  4LNF A;  2M1M A;  3V6C A;  5DYG A;  4CDC B;  4DR7 M;  4KO8 A;  2FNJ B;  2WXH A;  4YTP B;  3L27 A;  1FRD A;  4GHA A;  1R4M B;  2L7H A;  2XK5 A;  1UEL A;  2OZ2 A;  2INN E;  3B74 A;  3VRA B;  1QDT A;  1C4A A;  2KFK B;  3MHV C;  1JWS D;  1QOA A;  4MAC A;  4FHJ A;  3PHW A;  2DZK A;  3L28 A;  3FYC A;  3LYY A;  4GDL B;  5BR8 M;  2A5Y B;  2HD5 B;  1NYQ A;  4GU2 A;  3FIL A;  4B08 A;  1KOT A;  2O5R A;  4XX5 A;  4BKS A;  3ZNG C;  1JB0 F;  3LCU A;  2J4X A;  4MEM A;  3FTE A;  2XFS A;  2Z7J A;  2BS3 B;  2MBH A;  2QCZ A;  2L0T A;  2KMC A;  5BO4 B;  1XMQ M;  1LGR A;  1PCI A;  3P5U A;  2O6V B;  4I6P A;  4ANR A;  2MJ3 A;  3PLU A;  2DXI A;  1LV7 A;  3NZS A;  3AKZ A;  4IWQ A;  4IIW A;  2J7N A;  1VZ7 A;  3GB1 A;  1EUV B;  2FUH B;  4D2K A;  2CHQ A;  3GE3 C;  2LGS A;  4L23 A;  1YJJ A;  4LFA M;  1J8C A;  1QZE A;  2DWZ B;  2F1G A;  4XDC A;  3CBK A;  5EF4 A;  5AUI A;  4YTN B;  1GL6 A;  4XZ4 A;  1HTQ A;  5A2Q S;  1R7R A;  4WJN A;  1DOI A;  2EMT A;  2LVP A;  1XKG A;  2NTS A;  4LZZ A;  3W68 A;  4DV1 M;  4AUQ C;  3HM6 X;  3DOA A;  4YYW A;  2PAD A;  2YLM A;  3I3T B;  4EE2 A;  2E03 A;  2JWU A;  4M0W A;  4ZYN A;  2JYE A;  4BOQ A;  5EDS A;  2DWN A;  3PPA A;  4PT5 A;  4JYA M;  1HZ5 A;  2QSD A;  4KGT A;  4PS3 A;  2EKE C;  1XMO M;  2AUZ A;  2H1R A;  4MEL A;  3U8E A;  2NPT B;  2R2O A;  4X62 M;  2J7Q B;  1U9X A;  2E00 A;  3Q8A A;  2K8C A;  5DNY A;  4RKU F;  1N33 M;  4GB9 A;  1WI0 A;  1TDZ A;  4BBN C;  4IWO A;  2JUO A;  4LRT A;  1IGC A;  4YL8 A;  5EP1 A;  3QWL A;  1EF7 A;  4C56 C;  4JI6 M;  3CIR B;  2KZR A;  1YN4 A;  5G5H A;  1D3Z A;  1R7S A;  2F5P A;  1MJD A;  3WXF A;  3FUT A;  3KUZ A;  2BYT A;  1OEY J;  2BYV E;  1KH0 A;  4LF9 M;  4D8B A;  3NVY A;  2A4Z A;  2HKJ A;  1NY5 A;  2TSS A;  5EP4 A;  2WXJ A;  1K53 A;  4LJ8 A;  3VTW A;  3OF8 A;  3LVW A;  1NV8 A;  1D6E C;  1P9D U;  3P4P B;  2W54 A;  3HWS A;  2WS3 B;  3APC A;  4GIP A;  1NVI D;  4W5C A;  3PZ7 A;  3TL4 X;  4QAY A;  3RGP A;  5E6N A;  2DC7 A;  1DGF A;  4XGI A;  2MJ5 B;  4FWH A;  2ICI A;  3EFC A;  4LZJ A;  5ITX E;  4GMQ A;  2KKC A;  1KLV A;  1NLJ A;  2F4V M;  2FRA A;  2CHX A;  1W5S A;  1F2R I;  1PDX A;  4GUA A;  4JGH B;  3BB7 A;  1YE9 A;  3DVN U;  4DUZ M;  3CMM B;  1Y56 A;  1WWT A;  2UUA M;  1E8X A;  5H8Y E;  2NQD B;  3JSV A;  5G55 A;  2APL A;  1X9Y A;  3P5X A;  3PRP A;  1GNU A;  1OAI A;  3QYB A;  4XE0 A;  4BFR A;  1Q02 A;  4YVA A;  1K3W A;  4YSX B;  1TKY A;  4ITQ A;  2MWS B;  1K52 A;  3HHM A;  1D5M C;  2RDG A;  1UBI A;  3RE8 A;  1SF0 A;  4XZX A;  1FCC C;  5EQT A;  4ITK A;  1GUA B;  5JHB A;  4RGT A;  2JRI A;  4GDK B;  1MN3 A;  1OFH A;  1XLQ A;  3H8B A;  1JRU A;  4CIZ A;  3GPU A;  1WJU A;  2DBY A;  3ZNI D;  4JI8 M;  1EWC A;  2M56 B;  4TSS A;  3TJP A;  3VTU A;  4B3S M;  1IBX B;  1OJL A;  2ZAO A;  2EO2 A;  1HJP A;  3K1J A;  3AV8 A;  3BVM A;  5C23 A;  1HQR D;  3B1L X;  1LFD A;  3IHP A;  2WDV B;  3HKP A;  1PM5 A;  3WXG A;  2F5O A;  4DR6 M;  3CBJ A;  2JNH A;  5EP3 A;  2V1C A;  4AW4 A;  4PCZ A;  1ZXH A;  2BTW B;  1WRD B;  2KT7 A;  2KXJ A;  3SFE B;  1V6E A;  3AB5 A;  1WH3 A;  4DHZ B;  1GLN A;  4JI7 M;  3C58 A;  3UI3 A;  1K3B B;  2WP9 B;  2AYN A;  3H6N A;  1BT0 A;  3FUU A;  1QQW A;  3N30 A;  4EEW A;  4HWI B;  4A90 A;  1AUA A;  2MJD A;  4TQ0 A;  1VD2 A;  4I05 A;  3N1Y C;  4DQO C;  2ZAN A;  1PGX A;  3GLH E;  4J6I A;  4NOO B;  4NJ7 A;  2JA2 A;  1FPY A;  3E56 A;  3GLG B;  4KVG B;  2K9D A;  2OQ4 A;  4UN2 B;  2IY1 B;  3MP2 A;  4IUM A;  2KWV B;  3KFU G;  3FKE A;  4KHP M;  3MJW A;  4G4Q A;  4K0K M;  2PE9 A;  4IP3 A;  2AHM A;  1EF5 A;  1R4M I;  1ZQ9 A;  1YUB A;  1R2Y A;  2GQF A;  2I7P A;  2LGX A;  3OG5 A;  4AI6 A;  4MT5 A;  1E8Z A;  3IUT A;  3IT4 B;  1C77 A;  3IEC A;  4OZC A;  2DZN B;  2C7N B;  1XXG A;  3CWI A;  2XF3 A;  2HHN A;  2VF7 A;  3RI7 C;  1GOZ A;  3FTC A;  2JY6 B;  5IN7 A;  3GPY A;  4RCO A;  1E94 E;  2MLB A;  1G71 A;  1NDD A;  2KZS A;  2L7R A;  2K0P A;  3V61 A;  1CJE A;  4CHT B;  4ZPX A;  4AG5 A;  4IDI A;  2PKO A;  2FTD A;  2FYE A;  2W55 A;  1L4Z B;  3QSD A;  1TJE A;  2ERC A;  2FNA A;  4HPL B;  1SIF A;  2Z0D B;  2EEL A;  4HRS A;  3QT4 A;  2XFT A;  1XQQ A;  2B1M A;  1JQJ C;  5ITX A;  2QEN A;  1KFY B;  3WAP A;  3ZUA A;  1WGG A;  2B76 B;  3EA6 A;  4RMA A;  3KOZ E;  3A98 B;  3QX1 A;  1XXH B;  4TMA B;  1T0R C;  1F4I A;  2PBH A;  2L09 A;  1HZ6 A;  1NYR A;  1VDV A;  1GJZ A;  3NHE A;  1TT5 B;  1UGM A;  1DO0 A;  1EFU B;  4IJF A;  2Z8Y M;  3ZC7 B;  3MTN A;  3DA1 A;  3DVG Y;  1MIR A;  5LMN M;  1KLG D;  4JI0 M;  3L29 A;  3P42 A;  4ZRI A;  4FLH A;  4ZRK A;  1JW9 D;  3AEB B;  3BZD B;  1STF E;  4LDT D;  2C5R A;  2BNK A;  1GCB A;  3O65 A;  3K92 A;  1D0K A;  1WGY A;  1V2Y A;  2LTU A;  1U9Q X;  2KHW B;  3OTO M;  3KSE A;  4NAM A;  4MZS A;  2UYZ B;  2V4L A;  3OQC A;  4GC9 A;  3HUI A;  2CWB A;  3Q14 C;  3VRB B;  5JI2 E;  4WUR A;  1Z59 A;  2QIL A;  4OVV A;  3DFZ A;  1WZ0 A;  1NEN B;  2PW9 A;  1VDL A;  2DAK A;  3KXE C;  3KSJ A;  4GIT A;  4ZYS A;  4RF1 A;  4C4V B;  4L8R C;  2IZV B;  5CHV A;  1N60 A;  2KRK A;  2K39 A;  2P7U A;  3U2S C;  2DHZ A;  1ZE3 D;  1KFV A;  4RM9 A;  4ZRJ A;  2CJO A;  4LCD E;  2KX0 A;  1PJI A;  2XU5 A;  4BKG A;  4HJK A;  3M0E A;  5AZG A;  4E74 A;  1V81 A;  2K47 A;  1D5Z C;  1H4R A;  5F3W A;  2JX5 A;  5EP2 A;  4HCP B;  1F9J A;  4BS6 A;  4L16 A;  2E02 A;  1IY1 A;  3GLH A;  1MHH E;  3GE8 C;  4MGH A;  3PHX B;  2PEA A;  2CR5 A;  3IAS 1;  2BDL A;  5CHT A;  3MHH A;  4F7Z A;  2WSF F;  2F5S A;  2DZI A;  4YSY B;  4DBG B;  4MJS A;  3PZ8 A;  3VUX A;  4JLC A;  4II7 A;  1R4N B;  4IWP A;  3URY A;  1S3S A;  4KIK B;  3Q8B A;  1SXJ E;  2R62 A;  1WYG A;  5FR3 A;  4AKG A;  4LG2 A;  2M5Z A;  2R6N A;  4P6E A;  3AN1 A;  3ZDT A;  4I5S A;  2LHD A;  1N62 A;  1QAO A;  2JY5 A;  3V6E A;  1H8C A;  4JPS A;  4OX9 M;  2IDY A;  3T3N A;  2L8J A;  1NQC A;  2K5P A;  3KQ4 A;  2BGF A;  1A70 A;  5C2T B;  4AXM A;  3RNF C;  2YQZ A;  1ZDX A;  3W1S C;  2AU1 A;  4BOZ A;  3HZJ A;  4GOC A;  4HRO A;  3W1Y A;  1IYF A;  4S0R A;  2LAS A;  1TDH A;  4MSM B;  3CF6 E;  3TL5 A;  3PLV A;  1C9F A;  2MBE A;  4IM0 A;  3QWZ B;  1HUC B;  4M02 A;  4BKS D;  2ZNV C;  3AEF B;  1OAO C;  3PS6 A;  4M9S A;  1WHC A;  2WWZ A;  4B7G A;  2JZ0 A;  5IZ7 D;  2F5Q A;  1T0Y A;  2WNM A;  3IHP C;  1UWX A;  2BT6 A;  1P3Q Q;  2DCC A;  2LVA A;  2BWB A;  2B3A A;  4IBF A;  1MDW A;  1OEY A;  3ZYY X;  5BYS A;  2JTC A;  2P0R A;  2M4N A;  1D0L A;  2REX A;  2MP2 A;  3M62 B;  1XO3 A;  1ORY B;  3O13 A;  4PAD A;  2ZPN A;  4E71 A;  5IT9 S;  2FBW B;  1IBL M;  1X37 A;  1Q3B A;  3HX3 A;  2A5U A;  3HD3 A;  1Q0W B;  1WM2 A;  3Q3J A;  2KN5 A;  3VUW A;  5BMI A;  1JWB D;  3TWM A;  2N1W A;  3GZN B;  3L16 A;  1YJI A;  3U52 E;  4LJP B;  1OQY A;  1RYJ A;  2YNM D;  3AU5 A;  1ZV1 A;  1NL6 A;  2CKH B;  1G6J A;  3C3E A;  1NEK B;  4YYR A;  4MM3 B;  3SAV A;  4JV5 M;  2K8B A;  4IBD A;  5D94 A;  1IN5 A;  2MA9 B;  2OOB A;  1C4C A;  3IT6 B;  4KSK C;  1UFZ A;  3VAW A;  3ZXR A;  2BWE S;  5CVM A;  1N75 A;  1J19 A;  1GJT A;  3L10 B;  4LFB M;  1I42 A;  3APD A;  4FAD A;  3KUC B;  4B6W A;  4GSW A;  2PE6 B;  3KH0 A;  4B3M M;  1QIL A;  1H6U A;  1UNS A;  1UD7 A;  2Z8L A;  2P86 A;  1F2B A;  4G4N A;  1Z2M A;  1CVZ A;  3IOQ A;  1SNK A;  2LVQ A;  3VUY A;  3ENE A;  1TGU A;  3KP1 E;  4WA6 A;  3B9J A;  1ZIV A;  4JE3 B;  5EXP A;  4FHK A;  4M9X A;  1WR1 B;  2BVC A;  2WDT B;  2AIM A;  3LCV B;  2KJ6 A;  2V4I B;  2R9F A;  2R45 A;  4M8N A;  2LRW A;  1FXT B;  1FXI A;  1YMH E;  3J9C A;  2QBY B;  3H8C A;  3EIH A;  1SXJ A;  4GRI A;  2N9L A;  3A9J B;  1PUT A;  2GOW A;  3TEY A;  2CUZ A;  3C0R B;  2DKL A;  3DWG C;  2NVU I;  3VK7 A;  3ZGZ A;  1LO5 D;  3RYT A;  4LJA A;  4N58 A;  3THG A;  1HA5 A;  1YJ1 A;  3L17 A;  3QK0 A;  5HI1 A;  5ITU A;  3PDF A;  3MC0 B;  4FWD A;  2MJE A;  3AEG B;  4GGQ A;  3BOS A;  3FD9 A;  2RPV A;  1XD3 B;  4ICU A;  2JZP A;  2G8L A;  3U6D A;  1A6R A;  5J94 A;  4G50 A;  4NSO B;  5FKA C;  2C9C A;  4DV0 M;  3BXW A;  5G2N A;  4CJ6 A;  1YSY A;  3P4S B;  4NNJ B;  1IGD A;  2DYO A;  1SE3 A;  2OJW A;  2WHI A;  4Q8H A;  3BIN A;  5FTN A;  1F2C A;  2R44 A;  2KDL A;  3MFG A;  2C7M B;  3AMZ A;  3UIP B;  2M17 A;  3EHV A;  2WBF X;  3NVV A;  3V62 A;  2RDB C;  5JZE B;  4ICV A;  4NQK E;  3AFH A;  2IO3 B;  4L78 A;  3WAM A;  1PPN A;  1CJL A;  2JZZ A;  5CHV C;  4G3O A;  3UZU A;  3RCZ A;  1MVK A;  1R4G A;  2JYT A;  4I8O A;  2BB5 A;  1AU4 A;  3L2A A;  4NXN M;  3MP9 A;  4XYC A;  2PVO D;  3NRZ A;  3TMP B;  2FRQ A;  2YEP B;  1F29 A;  2Z59 B;  4KKI A;  4GEW A;  2X8X X;  1I4H A;  4YT0 B;  2LHG A;  3N3K B;  1V92 A;  4YXD B;  1QMY A;  4BB9 A;  1TYG B;  2ZJD A;  3B9P A;  1PVJ A;  1ESF A;  2YEP F;  3Q8F A;  1HNX M;  1U4A A;  4IKG A;  4F1I A;  2HL7 A;  1IY0 A;  3PSE A;  4AWJ A;  4NAW B;  1VCB A;  4HXD A;  6PAD A;  2O25 A;  1YQ4 B;  2Y5B B;  4BOS A;  4AKH A;  4BBN F;  4LFC M;  1G4A E;  3ABV B;  3A46 A;  2DJG B;  2N1V A;  3SHQ A;  4AKI A;  3SFD B;  2L3Z A;  4L2Y A;  1L2N A;  3AE9 B;  4AZF A;  3U5Z A;  2N9X A;  5KPZ A;  1WMH B;  4A3V B;  1ZOY B;  3GOE A;  4X6I A;  1HE8 A;  5DFL A;  3I51 A;  1L4D B;  2J0M A;  4LF6 M;  2KFK A;  2GBN A;  2ATO A;  2RMM A;  2J42 A;  2M0X A;  3HU2 A;  3QCA A;  4GDL A;  1N61 A;  2HD5 A;  2AUX A;  1JQP A;  4MGZ E;  2JXX A;  4TV3 A;  1SB3 C;  2KA6 B;  3PNY A;  3VH4 B;  2ZZP B;  3FKY A;  1NV9 A;  2FCQ A;  4HPM B;  3IFW B;  1ZUD 2;  3APF A;  2Y3A A;  1Y8R C;  3ZO5 B;  3VQI A;  2IND C;  4FUL A;  1G8P A;  2UZJ A;  5CHF A;  3O0U A;  2O6V A;  3Q3O C;  4K81 A;  2R0I A;  3TSS A;  3F5V A;  2HDE A;  1BQI A;  3DBH I;  3M7G A;  2WU2 B;  3EFU A;  4RKX A;  4YHH M;  1ZKH A;  1GMY A;  4QH6 A;  1DF0 A;  2C99 A;  1L0X B;  1L0Y B;  2LJ5 A;  4ZTB A;  3J80 S;  3F92 A;  1WM3 A;  3TE6 A;  2JPH A;  3HHX A;  2QP9 X;  1P1A A;  2YJC A;  2IO1 B;  4YYQ A;  1FRR A;  3KKU A;  3GRV A;  3JVZ X;  2XZU A;  4P7I A;  4ZHP A;  3EC8 A;  1IM2 A;  3P5V A;  4RFB A;  1WXV A;  2M19 A;  2MCN B;  2DVW B;  2W9N A;  3PT2 B;  3GZN I;  1C79 A;  4DHZ E;  5FSW A;  1HR0 M;  1V97 A;  3KYC D;  1J7B A;  2CJN A;  4FJY A;  4I07 A;  1J7C A;  1ZAE A;  4QNM A;  4DV2 M;  2GNO A;  3ZNH B;  3JAM S;  3I3T A;  4LNO A;  3H7P B;  1OFI A;  3S2A A;  4TQ1 A;  1FM0 D;  1VDD A;  3AOE A;  4IBG A;  1GL7 A;  4BQV A;  4G0N B;  2O2V B;  5D7G A;  3NWL A;  2N7J A;  3GLG E;  2NPT A;  3IXS A;  2J7Q A;  1VEJ A;  4GH9 A;  4EIW A;  3VK8 A;  2XEP A;  4BOP A;  4N6E B;  2OOA A;  2UUC M;  2R4J A;  4W9L A;  2WXM A;  3K9P A;  2LBC A;  2FUD A;  1QUS A;  3UIO B;  4AJY B;  3QJZ A;  5IA7 A;  2G4D B;  1PJT A;  1YIW A;  1EU4 A;  2CHW A;  1IN4 A;  1RRB A;  2YJB A;  2JP7 A;  2VHF A;  1ZW7 A;  3GLI B;  1L8Q A;  5C1Z A;  4CQN A;  3SBJ A;  3IAM 1;  4KDI C;  4NC6 A;  3SYL A;  2Z4S A;  1N77 A;  3HVD A;  1XLN A;  1IXS B;  2B3T A;  4H2A A;  3CSF A;  2HHH M;  3LJ3 A;  2D2Q A;  2KLG A;  3RFW A;  2DC9 A;  2KFJ A;  5E6P A;  3FTD A;  1AYV A;  2DAI A;  4AQ7 A;  3AE6 B;  2BB6 A;  5FK9 C;  1DGJ A;  1YN5 A;  2LHC A;  2CB5 A;  4IG7 B;  4PYU A;  4IC7 B;  1W5T A;  3L08 A;  2Z0E B;  1DEU A;  4WW0 A;  4L15 A;  4JWU C;  3M3J A;  1JCK B;  3ZRF A;  1TS5 A;  2KMM A;  3ZTD A;  3FYD A;  2Z4R A;  2YJ8 A;  1R5L A;  2L4E A;  4X65 M;  5EE0 A;  2WDR B;  3FUX A;  2OO9 A;  1CMX B;  1XXH E;  1IFY A;  1IBK M;  2G4S A;  2D3B A;  1V5T A;  2LMC A;  3KOY E;  5JHA A;  5E6O A;  3HHI A;  4OEL A;  3A9K B;  1VEG A;  3AL0 C;  2Y6E A;  1C78 A;  4MGI E;  2BDZ A;  4WWM A;  1TH2 A;  2MR9 A;  2VH1 A;  4NY0 A;  1KJT A;  3LFY A;  4QRG A;  2E6X A;  3GP7 A;  4NRW A;  2BTE A;  3BY4 B;  1QOF A;  2N35 A;  4LNK A;  1I4X A;  2WQY B;  2RSU A;  3R3M A;  4EZL A;  4PP1 A;  5G5G A;  2GHU A;  5IAA C;  4GDK A;  3LQQ A;  4GN1 A;  5HHD G;  2INC C;  2HTM E;  1DGH B;  1N78 A;  1IBX A;  2LVO C;  2H89 B;  1NO1 A;  4DMX A;  3HHZ A;  1OQQ A;  3V3X A;  2DEN B;  2G1E A;  1SIJ A;  5IP4 D;  2GBR A;  2KAC A;  3K9O B;  2DZZ A;  2C9W B;  3O1G A;  1GLO A;  2K9X A;  2BTW A;  1V9J A;  1T0S C;  1Q10 A;  1MX0 A;  1KHP A;  4OEM A;  4P17 A;  1YAL A;  4GKK M;  2K1F A;  3ZCB B;  4JWS C;  2HE7 A;  3QC8 B;  4LTU A;  3W0F A;  5AUK A;  1WSP A;  4PD2 A;  2BWF A;  1C76 A;  1MFW A;  3P63 A;  1K51 A;  2CE7 A;  1SBB B;  2HWJ A;  3FRH A;  1Q5W B;  2C96 A;  4KV2 A;  2IPP B;  4OVZ B;  1F2A A;  2KEB A;  1KTK A;  2V3P A;  1GB4 A;  1AEC A;  1A5T A;  1I4R A;  1AYU A;  4RY2 A;  2D7H A;  4LK0 M;  2N7D A;  1XT9 B;  3DZD A;  3GLG A;  4BOS C;  4FCT A;  4W9H A;  3R9X B;  1T3T A;  1FO4 A;  3HHA A;  2RR9 A;  4DHJ B;  3JR5 A;  2L32 A;  1Z6T A;  3NUH B;  1D2N A;  3GRY A;  2XU3 A;  1CQD A;  1ATK A;  1ROE A;  2DNF A;  3MC8 A;  2IGG A;  2CS4 A;  2IO0 B;  2KAJ A;  3DF0 A;  2L1A A;  2Y20 A;  3E46 A;  1CUK A;  4N9F 4;  1T3Q A;  1L1Z A;  3IG5 A;  3V60 A;  3VKH A;  2LEK A;  3BPF A;  3GQ4 A;  2L52 A;  1E0Z A;  5KHO A;  2JY6 A;  2F7D A;  3SAU A;  3HM3 A;  2DC8 A;  1WR6 E;  1N5W A;  4CYE A;  3KYD D;  2X38 A;  1WGD A;  1WIA A;  2AL6 A;  2ON8 A;  2FIF A;  5I4D A;  3DHH C;  1N34 M;  3WHL A;  4LJO B;  1YQ3 B;  4BAX A;  3B7Q A;  1P3Q U;  2J53 A;  4AJW A;  3JR4 A;  2CEA A;  2KC1 A;  2LVQ D;  1Q3C A;  3RZF A;  1WIV A;  3AE7 B;  1O0E A;  3ZNZ B;  5FLX S;  1XXH A;  4M0D A;  3IEJ A;  1SXT A;  2G8J A;  1FJG M;  3OVZ A;  3TEW A;  1IBM M;  3TWK A;  1KF6 B;  4RGO S;  2GBJ A;  1KYI A;  4LNN A;  8CAT A;  5D3D A;  1V1O A;  1SXJ D;  2KQ7 A;  1GPX A;  1TU6 A;  3GRU A;  1QQR A;  2MSE D;  3ZTC A;  1KFU L;  2LH0 A;  1QT9 A;  4PDI A;  1I4Q A;  4GKJ M;  3PGE A;  3BK2 A;  2KNV A;  3IV2 A;  1BVS A;  1V5O A;  4D8E A;  1TKG A;  1FNN A;  2KDM A;  2QC8 A;  5CX3 A;  2I2Y A;  2ZNV B;  2CFO A;  4CHK A;  4N79 A;  2CRU A;  4A20 A;  3SAS A;  3TBL D;  4FJV B;  3GPX A;  5KO3 A;  5ITR A;  5GXG B;  3HJQ A;  2VZK B;  2J7Q C;  2J7O A;  2G3Q B;  3HVZ A;  1Z5A A;  3HIZ A;  3VXW A;  1CTE A;  3LDZ E;  1TBE A;  3USV A;  1SJH D;  3VHT C;  2Y0T A;  4C4V A;  1DOY A;  1UF0 A;  1OKS A;  2CV1 A;  2KK8 A;  1E5W A;  5EXT A;  1YT7 A;  4K1R B;  1MU5 A;  4ZRQ A;  2DWM A;  2W3S A;  4NJ6 A;  3T3O A;  1JRP A;  3SHF A;  1ET9 A;  2LVP C;  3VR8 B;  3TQS A;  4N8W A;  4A3P A;  2RPQ A;  2VF8 A;  1CQV A;  1I35 A;  3B2F A;  1K3X A;  2D7E A;  2D3C A;  2R9M A;  1QZM A;  4K3C A;  2J5Y A;  1GB1 A;  3PHX A;  2WXK A;  5FTJ A;  4B95 A;  3BOW A;  1NI2 A;  1SEB D;  2KDF B;  4NQL B;  2OP3 A;  4XUI A;  4DBG A;  1ME3 A;  1QAM A;  2SAK A;  2BF8 B;  3E1Z B;  1E90 A;  1XLP A;  2K6D B;  4KLB A;  7PCK A;  2PTL A;  4KIK A;  3N9Y C;  1BGO A;  1ITO A;  4WWN A;  2L76 A;  1TL9 A;  3GQ3 A;  4ARI A;  5FTL A;  3RUL A;  1XLO A;  1AN8 A;  1E7P B;  4Q7J A;  1FFU A;  3MJ5 A;  1L6V A;  2WGS A;  4K7C A;  2OJR A;  1NHW C;  3UJN A;  3U60 B;  2AYO B;  4W9I A;  2LXA A;  2E3T A;  3CF2 A;  1Q1O A;  1HNW M;  2MEK A;  1WJ7 A;  1ZMU A;  1QDQ A;  2JQR B;  2INP E;  1KSF X;  4IBB A;  3HK0 A;  3A33 B;  4P1B C;  2PNS A;  4BS5 A;  4WAF A;  1ZP0 B;  3AE3 B;  1E10 A;  2DWL A;  2JY8 A;  2IJ0 A;  2BU3 A;  1QKZ A;  2N9K A;  4USA A;  2J52 A;  2D07 B;  4G54 A;  3NJT A;  1SSN A;  3UMM A;  5JI3 E;  1L2C A;  1ENF A;  1HT1 E;  4B7F A;  5ITT A;  4ZOH C;  3TCA A;  1PGB A;  1RFA A;  3MOR A;  2QEJ C;  2HXZ A;  2R6F A;  2C7H A;  1S4V A;  2BKR B;  1JWA D;  2EMS A;  3OJ4 B;  3B21 A;  2O6V D;  2AWT A;  2WXL A;  2ZEQ A;  1WXA A;  1TKE A;  4W9G A;  5HFY A;  2JUJ A;  4DR1 M;  3DBR B;  1J5E M;  5EJC A;  4WQM A;  3J81 S;  1BUI C;  1E8Y A;  4IOI E;  3WXE A;  1P98 A;  1EWL A;  5KPR A;  2VH2 A;  4JIO U;  1LM8 B;  2IGD A;  2PRE A;  3U61 B;  1MHW A;  3T9L A;  1VJV A;  2NQG A;  2MRO B;  1Q39 A;  4B3T M;  2KQ4 X;  3BK1 A;  2GBM A;  2KQS A;  3BC3 A;  4XR7 A;  2K3U A;  1LTM A;  1GJS A;  4N59 A;  1YZB A;  3PBH A;  1WGL A;  1QOB A;  4FCW A;  1M6D A;  1MEG A;  2FE8 A;  3Q2A C;  3QAQ A;  2QDF A;  1WGH A;  2D3G A;  1I4W A;  2ZVO A;  5MPO A;  1GEC E;  4TUW A;  4CDF B;  4QOS A;  3RT3 B;  3PXG A;  1P7E A;  2MX2 A;  3NVZ A;  1NHG C;  4KKJ A;  4W9J A;  1SGH A;  5DCN A;  1SP4 B;  4WAA A;  1WE6 A;  4ZRP A;  2XSZ A;  1YNT E;  4WJQ A;  3SAW A;  2AX5 A;  4MM3 A;  2CHZ A;  1YVB A;  2HCB A;  2QZ4 A;  3NS1 A;  3A42 A;  1VRA B;  3DBH B;  1YN3 A;  4JX1 C;  1POP A;  3RNE C;  1EWP A;  4DMY A;  1HQY E;  1S3S G;  4DXG A;  2LJI A;  1PRB A;  2KJH B;  1Z5S B;  1E7V A;  1XEE A;  1Z5B A;  3KW9 A;  2DYM A;  1QDR A;  1ACC A;  1V34 A;  1GVN A;  3FAH A;  2DAJ A;  2D7G A;  1ICF A;  3H4M A;  1RLF A;  4ACF A;  5DPS A;  1WRI A;  2MH7 A;  3B89 A;  3NZU A;  2JF5 A;  3DVN V;  2G9H D;  1PPD A;  4HWY A;  3T38 A;  1VR9 A;  4F1S A;  3LXS A;  3Q69 A;  1WGK A;  2VDB B;  3GPP A;  4NSR A;  1G3I A;  5JXV A;  3L54 A;  1YK7 A;  2JQF R;  4XBO A;  1OQR A;  4A8X C;  2Q2E B;  5KHQ A;  1WR1 A;  3I4V A;  2UXC M;  4LJ9 A;  4ANU A;  1RM6 C;  2P5T A;  2NCN A;  1JR3 E;  1NY6 A;  5FTM A;  3KWL A;  5FR6 A;  3Q3M C;  3AE5 B;  2H7J A;  5CVN B;  1EM7 A;  2J0J A;  3K9M A;  2QBY A;  3DPD A;  3GLF B;  3LXF A;  3W5U B;  5EGW A;  3AUL A;  2J0K A;  3U6Q A;  3A9J A;  4LY6 A;  3H1U A;  4PYZ A;  3PVL A;  3C0R A;  2QPA A;  3AV0 A;  3B7N A;  1RFK A;  1SG9 A;  3NBX X;  3HU1 A;  1V86 A;  1VSN A;  2I38 A;  2KLC A;  2G7Y A;  4B9K A;  2X8A A;  3AE2 B;  3NVW A;  4JI1 M;  1X1M A;  4FK5 A;  1GC6 A;  2JSV X;  2KZU A;  2GFO A;  2RGF A;  1MEM A;  4M8M A;  2N4F A;  1EF1 A;  5KQD A;  2KTF A;  4I4L A;  3Q8C A;  2W82 A;  2GI9 A;  4LLG M;  4B3R M;  2JVC A;  4X6H A;  4JI2 M;  2JWZ A;  3P4R B;  1G41 A;  2AQ2 B;  5K16 A;  2DLB A;  3KW6 A;  5BYQ A;  3H7S A;  2Y21 A;  1QXP A;  1JRO A;  2NBV B;  5JZE A;  2L05 A;  5F02 A;  1HXY D;  2LRU A;  3JW0 X;  3ONS A;  3RN9 C;  1WGR A;  3VLF B;  2KTR B;  9PAP A;  3LMM A;  1FNU A;  2CP8 A;  4G11 A;  2KVR A;  4Z6Y A;  4DK5 A;  5JH3 A;  1U9V A;  2D11 A;  5HKH A;  3ZQJ A;  3RGS A;  2FCS A;  2UU7 A;  2F5N A;  3MC9 A;  3M63 B;  1WGN A;  4CZW A;  1N6Z A;  2QHO B;  3R66 C;  1N36 M;  5CHW A;  3ZIM A;  4A3O A;  3DWM A;  1PXV A;  1AYW A;  1I94 M;  1YLA A;  1WX9 A;  3GLI E;  5LNK 1;  3A45 A;  1XHB A;  2QNJ A;  3PV1 A;  3N3K A;  1NPZ A;  1DO2 A;  1IQP A;  2GMI C;  1QOG A;  4FJC A;  2C9O A;  5D3I B;  2MBO A;  3J7A S;  4AOF A;  2OOB B;  4RGM A;  3AED B;  4NAW A;  2NQI A;  4QRX A;  1F77 A;  1WFY A;  3Q8X A;  2Y5B A;  1J09 A;  3AEC B;  2ASQ A;  2JXT A;  4EFO A;  3I01 M;  3PRM B;  4WJO A;  3SD5 A;  2K6B A;  2N7E A;  2ZBK B;  1CV8 A;  2G6D A;  2LWP A;  2KDI A;  4C7Z A;  1UWM A;  1DGG A;  3U6S A;  1EWO A;  3HWN A;  3K8U A;  1HQC A;  1WMH A;  2EKI A;  2QMT A;  4XK8 F;  4IBJ A;  3J2P B;  2VRR B;  1V8C A;  5H37 D;  1V80 A;  2AQ1 B;  1UUP A;  1PGA A;  4D8I A;  1QLB B;  4Q2J A;  2YR0 A;  4D80 A;  1GAB A;  1FFV A;  4I6N B;  3KFQ A;  1S1Q B;  3T15 A;  2MQJ A;  4E3C A;  4NJC A;  4QRV A;  2AGA A;  4G4R A;  3TUO A;  2C60 A;  3J27 B;  4X57 B;  2OED A;  3RZW C;  2JT4 B;  4X6J A;  2PJH A;  1OGW A;  3VDP A;  1IUE A;  1SJE D;  3S3Q A;  1JR3 A;  5BYR A;  4US9 A;  4EOY A;  1C7Y A;  2K25 A;  4W9K A;  1T0Q C;  3PNR A;  2HTH A;  4GMV A;  5IKC M;  3LQR A;  1RWS A;  1IN8 A;  4G4O A;  4QHT A;  4DR5 M;  3DBR I;  1MI0 A;  2D5G A;  2VZK D;  2XNA C;  4QOZ C;  2C98 A;  2DZM A;  4US8 A;  1I4P A;  2EKK A;  4KDL B;  4FBJ B;  3DBL I;  1M94 A;  2YFQ A;  4CDE B;  5DYI A;  4KT0 F;  1P0R A;  1FH0 A;  3TPZ A;  3PT2 A;  4ZDV A;  2WDQ B;  1T6B X;  3NOB A;  3U6P A;  1PBH A;  1D0M A;  3KS4 A;  1K82 A;  3SDL C;  2N9P C;  1EWY C;  4YYU A;  3ZNH A;  3H7P A;  4K7W A;  3T1H M;  3KUD B;  5DPT A;  2PLP A;  1J0G A;  1D5X C;  2PMV A;  3H8H A;  2V6Z M;  4DDG D;  3H9D A;  4NXM M;  4IBC A;  2O2V A;  3F75 A;  2K8H A;  4MSQ B;  3OLM D;  4LDT B;  2AVW A;  1IN7 A;  3D8B A;  1YOV B;  3V05 A;  1AAR A;  4DWF A;  2LNH C;  3BWK A;  3RVW A;  1EO6 A;  3C3D A;  2RKO A;  3GO8 A;  3ML9 A;  3FUV A;  2HJ8 A;  3NZ3 A;  2DZJ A;  3N20 C;  2HWK A;  2QCU A;  3VDU A;  4KX6 B;  5EE9 A;  5LMU M;  2NQ8 C;  4CGY B;  2L00 B;  1MHX A;  5LLI A;  4DV6 M;  5IOI A;  3MHS A;  4R71 A;  2IBI B;  3AOG A;  4KZC A;  2R61 A;  3UF8 A;  3GLI A;  4DR2 M;  4YV8 A;  1I4G A;  2YVC A;  2MBB B;  2FOI C;  2XU4 A;  1IXS A;  2UXD M;  3I63 C;  4W4U A;  3ZDM C;  3UK6 A;  2GBK A;  3QAR A;  3T1Y M;  3VTV A;  1AU2 A;  2LUE A;  3Q8G A;  4ZUX U;  1WZ3 A;  4HDO A;  3QAU A;  1ZMV A;  1QF6 A;  2RRU A;  5A24 A;  2CU3 A;  1PJQ A;  2CHG A;  3U5Z B;  5TSS A;  2LVN C;  1V33 A;  4MB7 A;  2VHS A;  3WCQ A;  2DNA A;  2UUB M;  1WE7 A;  4LF4 M;  1TZO A;  4AQY M;  1VQ1 A;  1PFD A;  1AW7 A;  1OTR B;  3X23 A;  1WXQ A;  3BWU D;  4LF8 M;  3AM9 A;  1FD6 A;  4WP2 A;  4KGS A;  4BKT A;  3E21 A;  1IXZ A;  3VR9 B;  1A5R A;  1WX8 A;  1IXR C;  4NRV A;  3LW5 F;  1UBQ A;  3PO0 A;  3ZJU A;  3OIS A;  3RNV A;  3M6A A;  5IWA M;  2XGN A;  5E26 A;  3A9K A;  4ZHO A;  1Y4H A;  2DWQ A;  2WLB A;  1JML A;  4DR3 M;  4N4Z A;  2JY7 A;  2MGW A;  3EGR A;  1V1P B;  1WXS A;  4P16 A;  3A1Q B;  3TEX A;  1QVR A;  3VFD A;  3V6C B;  3V76 A;  3BY4 A;  2C5L C;  3MMP A;  3RNB C;  4C80 A;  1PIP A;  3DHI C;  3NBI A;  4MI7 A;  1DV0 A;  4OU7 A;  1HTO A;  1L6U A;  2W3R A;  2HH5 A;  1TR8 A;  1VEK A;  4BLC A;  1XC8 A;  1NJG A;  4JQW C;  2XK5 B;  2ZVN A;  4OVU A;  1OIP A;  1LQB A;  1ET6 A;  1E9S A;  2IO2 B;  3WAN A;  3D8L A;  2JRH A;  8PCH A;  1DGH A;  1FIQ A;  2KMA A;  3VDZ A;  1AU3 A;  1B1Z A;  2ZW1 A;  2Y5C A; 
#chains in the Genus database with same CATH homology
 1I7H A;  1SXJ C;  4GC5 A;  4YWG G;  1XWI A;  4R7G A;  3U6O A;  4DXF A;  3FIL B;  3U7Z A;  1F2R C;  2M60 A;  5E6J A;  5H92 C;  3W5V B;  3E4R A;  3BYY B;  4HL4 A;  3FUW A;  3AJI B;  3BVG A;  4FCV A;  4MH8 A;  3W31 A;  1XNR M;  2E5L M;  1TH4 A;  4OVZ A;  1DYQ A;  1B9R A;  1GKI A;  3PFI A;  2L83 A;  4XWW A;  4MGK E;  3R8F A;  1N5X A;  4PDG A;  4JI5 M;  2UXB M;  1QYR A;  4MH0 E;  3TEZ A;  3MHZ A;  2X4A A;  3K8Z A;  3VKG A;  3GQ5 A;  1QAN A;  2XZF A;  3UGJ A;  1L2B A;  2XSZ D;  2BBC A;  1XCT L;  1AWD A;  1BML C;  4IBI A;  2OPF A;  4QHS A;  3KVW A;  2CV2 A;  3BVZ A;  4GLS C;  1UKF A;  3BYT B;  4FXC A;  4LGM A;  4S12 A;  1E32 A;  3GRR A;  4L4U A;  4B7H A;  2IGH A;  4WIP A;  4LF5 M;  2WXQ A;  1GAQ B;  2R4E A;  2ZM6 M;  2PVG C;  3FTF A;  2BS4 B;  4RGN A;  3W1S A;  2IPK D;  1JAL A;  4OHJ A;  3I4Y A;  4HEA 1;  3C8Y A;  1TH3 A;  4QNR A;  4WH4 A;  2Q5W D;  1K50 A;  4IBK A;  4HKQ A;  3MTV A;  3R2I A;  1TS3 A;  5FTK A;  4DV4 M;  4MGY E;  4LGY A;  2XLJ A;  3PVS A;  2XH9 A;  1HEZ E;  3SFZ A;  3Q8E A;  3U6M A;  2BS2 B;  1L5P A;  4A5U A;  1NJF A;  5ITQ A;  3U4E G;  2BW2 A;  5C3J B;  2GB1 A;  3K2L A;  3U6C A;  2M0A A;  1VZ6 A;  2V3N A;  2G5G X;  4JI3 M;  1N32 M;  1FMA D;  3AH7 A;  3AOE C;  2R46 A;  4KGR A;  1E9R A;  3KDS E;  1HNZ M;  2KWD A;  3ILK A;  2L6O A;  4LJ4 A;  3J7B A;  3ZQ4 A;  4XDD A;  3RPF C;  3WHK A;  4AG6 A;  1STE A;  3W30 A;  2X49 A;  3SEB A;  1ZXI A;  3BII D;  3U60 A;  3E9S A;  2LXE A;  4B0E A;  2R18 A;  3W2D A;  1HT2 E;  4LF7 M;  4JI4 M;  3U6L A;  1PJJ A;  2DHR A;  4GHL A;  1KRH A;  4G6Z A;  2EUC A;  3W0L B;  1L0V B;  3CTW B;  2SEB D;  5EXS A;  1XF5 L;  1JR3 D;  2R65 A;  3HHY A;  2NMQ A;  3I57 A;  3KSX A;  2WXF A;  3KLS X;  4YY3 M;  3AE1 B;  3PHU A;  2H88 B;  1D4B A;  3U61 A;  1L2D A;  5GKN A;  4HLQ A;  1AYF A;  2RDH A;  3RFZ B;  3SAR A;  1FXA A;  3P1M A;  1EE8 A;  3ZJT A;  3R8B A;  3AE4 B;  3U6E A;  5ITY A;  2BJV A;  3SR6 A;  2V0G A;  4YTM B;  2ACZ B;  4X66 M;  4LJ6 A;  2WXG A;  4XWT A;  2JU6 X;  2Z3X A;  1OFF A;  5EE1 A;  1FNW A;  1TS4 A;  1C4P A;  2ONQ A;  3HJ8 A;  2V1U A;  2OHF A;  1F0Z A;  2DOS A;  3EUB 2;  2Y0Q A;  4JN6 A;  4LCB A;  2N0S B;  2LFI A;  4W5W A;  2GRI A;  1JWU D;  5EZS A;  2WXI A;  2Y5P A;  2WU5 B;  4BOU A;  5BMH A;  2Z84 A;  3SHG B;  1NVM A;  2CHV A;  4KOD A;  3L4P A;  1NNU C;  1R2Z A;  1TY2 A;  4AS1 A;  4FWG A;  1XNQ M;  4UDU C;  4D81 A;  3LB8 C;  3GLF A;  4HJG E;  4D82 A;  1NNJ A;  3OWE B;  1NSF A;  5KPT A;  1ZPS A;  1KLU D;  2VII A;  1CK1 A;  1C1K A;  2QIE B;  1DKI A;  1VZ8 A;  4R3D A;  3ZH9 B;  3GLH B;  1T5X D;  4DR4 M;  2WXR A;  1VLB A;  2UU9 M;  3R2T A;  2K22 A;  1TY0 A;  2DZO B;  1UM8 A;  4P6V F;  4M9Z A;  4FVM A;  5BPV A;  3P4Q B;  1NI3 A;  2LHE A;  4DV7 M;  5EXX A;  4REZ A;  5C18 A;  1XCQ L;  7CAT A;  1CZP A;  2FFJ A;  4RNA A;  4YSZ B;  1N63 A;  1PYW D;  4O1N A;  4B0M A;  3HRD D;  1SE4 A;  4KLN A;  3W9C B;  4LRS A;  4X64 M;  4OW0 A;  5T8I A;  2RGH A;  2L7I A;  4IBE A;  3IG8 A;  3EIE A;  2VQF M;  1QAQ A;  5EE3 A;  4RF0 A;  1JQ4 A;  2AQ3 B;  3CF0 A;  3PRM A;  1EU3 A;  3KP0 E;  1DOX A;  1IY2 A;  1FEH A;  1P7F A;  2WXP A;  4Z8X A;  2LUM A;  4LJ7 A;  1G59 A;  3IFU A;  5HG2 A;  3SC3 A;  2BJW A;  1TS2 A;  4OZB A;  3TMP A;  5EZQ A;  1VJK A;  2ZW0 A;  2VQE M;  4RH6 A;  2I7N A;  3KS8 A;  1DGB A;  5KQ8 A;  5BMG A;  2QJL A;  4L1B A;  3SYK A;  3SAT A;  2KW0 A;  3GP1 A;  4C7Y A;  4CIS A;  3SMP A;  1E6E B;  2KRU A;  3TWL A;  1SE2 A;  4OZA A;  3KOX E;  4J3O D;  3AEE B;  3GS2 A;  3TRK A;  2WXN A;  2LGI A;  2CV0 A;  4IJE A;  4LJ5 A;  4FW9 A;  3KWV A;  4DV3 M;  3LVV A;  4DUY M;  2ZAM A;  2EA0 A;  1J7K A;  2PIA A;  1Z5C A;  1UGJ A;  1SXJ B;  3FC4 A;  2LWX A;  4A55 A;  2KN4 A;  2KXE A;  3I9V 1;  2RGO A;  2FUG 1;  4DV5 M;  4NZL B;  3L25 A;  3HJS A;  4FD2 A;  3ZJV A;  1ZDV A;  3BBA A;  4JXJ A;  4A6Q A;  4ARC A;  3AEA B;  1JWM D;  1J7A A;  2WXO A;  1L1T A;  5C1B A;  3MK6 A;  3AE8 B;  1R6B X;  2NTT A;  2XN9 C;  3HU3 A;  1IN6 A;  4NL4 H;  3SMS A;  3L26 A;  1FCL A;  3KOW E;  3ETR A;  5IRE B;  4BBA A;  3HHW A;  1BXT A;  1FNV A;  3PNV A;  1MPE A;  4A9A A;  1M4V A;  3HGI A;  4I81 A;  1V1P A;  3B2G A;  1E9M A;  4HKZ E;  4HXD B;  5DYG A;  4DR7 M;  4KO8 A;  2WXH A;  4YTP B;  3L27 A;  1FRD A;  4GHA A;  2L7H A;  2INN E;  3VRA B;  1C4A A;  3MHV C;  1JWS D;  1QOA A;  4MAC A;  3PHW A;  3L28 A;  3FYC A;  3LYY A;  4GDL B;  5BR8 M;  2A5Y B;  1NYQ A;  3FIL A;  4B08 A;  2O5R A;  2J4X A;  3FTE A;  2Z7J A;  2XFS A;  2BS3 B;  1XMQ M;  2MJ3 A;  2DXI A;  1LV7 A;  3AKZ A;  4IIW A;  2J7N A;  1VZ7 A;  3GB1 A;  4D2K A;  2CHQ A;  4L23 A;  1YJJ A;  4LFA M;  2DWZ B;  4XDC A;  5AUI A;  4YTN B;  1GL6 A;  5A2Q S;  1R7R A;  1DOI A;  2NTS A;  4LZZ A;  4DV1 M;  3DOA A;  4EE2 A;  2JWU A;  4M0W A;  2JYE A;  2DWN A;  4PT5 A;  4JYA M;  1HZ5 A;  2QSD A;  4KGT A;  1XMO M;  2H1R A;  4X62 M;  3Q8A A;  5DNY A;  1N33 M;  1TDZ A;  4LRT A;  1IGC A;  5EP1 A;  3QWL A;  4C56 C;  4JI6 M;  3CIR B;  5G5H A;  1YN4 A;  1R7S A;  2F5P A;  3FUT A;  2BYT A;  1KH0 A;  4LF9 M;  4D8B A;  3NVY A;  2HKJ A;  1NY5 A;  2TSS A;  5EP4 A;  2WXJ A;  1K53 A;  4LJ8 A;  3LVW A;  1D6E C;  3P4P B;  2W54 A;  3HWS A;  2WS3 B;  4GIP A;  1NVI D;  3PZ7 A;  3TL4 X;  3RGP A;  1DGF A;  4XGI A;  4FWH A;  2ICI A;  4LZJ A;  5ITX E;  4GMQ A;  2F4V M;  1W5S A;  1F2R I;  1PDX A;  4GUA A;  3BB7 A;  1YE9 A;  4DUZ M;  1Y56 A;  1WWT A;  2UUA M;  5H8Y E;  3PRP A;  4XE0 A;  1K3W A;  4YSX B;  1TKY A;  4ITQ A;  1K52 A;  1D5M C;  2RDG A;  3RE8 A;  1SF0 A;  4XZX A;  1FCC C;  5EQT A;  4ITK A;  4RGT A;  2JRI A;  4GDK B;  1OFH A;  1XLQ A;  3GPU A;  2DBY A;  4JI8 M;  1EWC A;  2M56 B;  4TSS A;  1IBX B;  4B3S M;  1OJL A;  2ZAO A;  2EO2 A;  3K1J A;  3AV8 A;  3BVM A;  1HQR D;  2WDV B;  3HKP A;  1PM5 A;  2F5O A;  4DR6 M;  5EP3 A;  4AW4 A;  2V1C A;  4PCZ A;  1ZXH A;  2BTW B;  3SFE B;  3AB5 A;  1GLN A;  4JI7 M;  3C58 A;  3UI3 A;  2WP9 B;  3FUU A;  1QQW A;  4A90 A;  2MJD A;  4TQ0 A;  4DQO C;  2ZAN A;  1PGX A;  4NOO B;  2JA2 A;  4IUM A;  3E56 A;  3GLG B;  2OQ4 A;  3MP2 A;  3KFU G;  3FKE A;  4KHP M;  4G4Q A;  4K0K M;  4IP3 A;  2AHM A;  1ZQ9 A;  1YUB A;  1R2Y A;  2I7P A;  4MT5 A;  4AI6 A;  3IT4 B;  1C77 A;  4OZC A;  2DZN B;  1XXG A;  3CWI A;  2XF3 A;  1GOZ A;  3FTC A;  3GPY A;  4RCO A;  1E94 E;  2KZS A;  2K0P A;  1CJE A;  4CHT B;  4ZPX A;  4AG5 A;  4IDI A;  2PKO A;  2W55 A;  1L4Z B;  1TJE A;  2ERC A;  2FNA A;  2EEL A;  4HRS A;  2XFT A;  1JQJ C;  5ITX A;  2QEN A;  1KFY B;  2B76 B;  3EA6 A;  3KOZ E;  3A98 B;  1XXH B;  4TMA B;  2L09 A;  1HZ6 A;  1NYR A;  1VDV A;  1DO0 A;  4IJF A;  3ZC7 B;  3DA1 A;  5LMN M;  1KLG D;  4JI0 M;  3L29 A;  3P42 A;  1JW9 D;  3AEB B;  3BZD B;  2C5R A;  2BNK A;  3O65 A;  3K92 A;  3OTO M;  4NAM A;  3OQC A;  4GC9 A;  3HUI A;  3VRB B;  5JI2 E;  4WUR A;  1Z59 A;  2QIL A;  3DFZ A;  1NEN B;  2PW9 A;  3KXE C;  3KSJ A;  4GIT A;  4ZYS A;  4RF1 A;  4L8R C;  1N60 A;  2KRK A;  3U2S C;  1ZE3 D;  1KFV A;  2CJO A;  1PJI A;  3M0E A;  2K47 A;  1D5Z C;  5F3W A;  2JX5 A;  5EP2 A;  4L16 A;  1IY1 A;  3GLH A;  1MHH E;  4MGH A;  3IAS 1;  2F5S A;  4YSY B;  3PZ8 A;  4II7 A;  3URY A;  1S3S A;  3Q8B A;  1SXJ E;  2R62 A;  1WYG A;  5FR3 A;  4AKG A;  4LG2 A;  2M5Z A;  3AN1 A;  4I5S A;  2LHD A;  1N62 A;  1QAO A;  4JPS A;  4OX9 M;  2IDY A;  3T3N A;  2K5P A;  3KQ4 A;  1A70 A;  5C2T B;  2YQZ A;  1ZDX A;  4BOZ A;  4HRO A;  1TDH A;  3CF6 E;  1C9F A;  3AEF B;  4M9S A;  4B7G A;  5IZ7 D;  2F5Q A;  2WNM A;  1UWX A;  2BT6 A;  4IBF A;  3ZYY X;  5BYS A;  2JTC A;  1XO3 A;  1ORY B;  3O13 A;  5IT9 S;  2FBW B;  1IBL M;  1X37 A;  1Q3B A;  5BMI A;  1JWB D;  3TWM A;  1YJI A;  3U52 E;  1RYJ A;  2YNM D;  1NEK B;  4MM3 B;  3SAV A;  4JV5 M;  4IBD A;  1IN5 A;  1C4C A;  3IT6 B;  1N75 A;  4LFB M;  4B3M M;  1QIL A;  1H6U A;  1UNS A;  2Z8L A;  4G4N A;  1TGU A;  3KP1 E;  3B9J A;  4JE3 B;  5EXP A;  4M9X A;  2V4I B;  2R45 A;  1FXI A;  1YMH E;  3J9C A;  2QBY B;  3EIH A;  1SXJ A;  4GRI A;  2N9L A;  1PUT A;  3TEY A;  2CUZ A;  3DWG C;  3VK7 A;  3ZGZ A;  1LO5 D;  4LJA A;  4N58 A;  3THG A;  1HA5 A;  5HI1 A;  5ITU A;  3MC0 B;  4FWD A;  2MJE A;  3AEG B;  3BOS A;  3FD9 A;  2RPV A;  2JZP A;  2G8L A;  3U6D A;  4NSO B;  5FKA C;  2C9C A;  4DV0 M;  1YSY A;  3P4S B;  1IGD A;  2DYO A;  1SE3 A;  5FTN A;  3MFG A;  3AMZ A;  3NVV A;  3AFH A;  4L78 A;  3UZU A;  1MVK A;  2JYT A;  4I8O A;  2BB5 A;  3L2A A;  4NXN M;  3MP9 A;  2PVO D;  3NRZ A;  2YEP B;  4KKI A;  4YT0 B;  1I4H A;  4YXD B;  4BB9 A;  1TYG B;  3B9P A;  1PVJ A;  1ESF A;  2YEP F;  3Q8F A;  1HNX M;  4IKG A;  2HL7 A;  1IY0 A;  3PSE A;  4NAW B;  1YQ4 B;  4BOS A;  4AKH A;  4LFC M;  1G4A E;  3ABV B;  3A46 A;  4AKI A;  3SFD B;  4L2Y A;  3AE9 B;  4AZF A;  3U5Z A;  5KPZ A;  4A3V B;  1ZOY B;  1L4D B;  3I51 A;  4LF6 M;  2RMM A;  2J42 A;  3HU2 A;  1N61 A;  4MGZ E;  1SB3 C;  2KA6 B;  3PNY A;  1ZUD 2;  2Y3A A;  3VQI A;  2UZJ A;  1G8P A;  3TSS A;  2HDE A;  3M7G A;  2WU2 B;  4RKX A;  4YHH M;  2C99 A;  1L0X B;  1L0Y B;  4ZTB A;  3J80 S;  3TE6 A;  3HHX A;  2QP9 X;  1FRR A;  3GRV A;  2XZU A;  4ZHP A;  1IM2 A;  4RFB A;  2M19 A;  2DVW B;  1C79 A;  5FSW A;  1HR0 M;  1V97 A;  1J7B A;  2CJN A;  1J7C A;  1ZAE A;  4QNM A;  4DV2 M;  3JAM S;  1OFI A;  4TQ1 A;  1FM0 D;  1VDD A;  3AOE A;  4IBG A;  1GL7 A;  5D7G A;  3NWL A;  2N7J A;  3IXS A;  2J7Q A;  4GH9 A;  4EIW A;  3VK8 A;  2XEP A;  4BOP A;  4N6E B;  2UUC M;  2R4J A;  2WXM A;  1EU4 A;  1IN4 A;  3GLI B;  1L8Q A;  4CQN A;  3SBJ A;  3IAM 1;  3SYL A;  3HVD A;  2Z4S A;  1N77 A;  1XLN A;  1IXS B;  4H2A A;  2HHH M;  3RFW A;  3FTD A;  4AQ7 A;  3AE6 B;  2BB6 A;  5FK9 C;  1DGJ A;  1YN5 A;  1W5T A;  4WW0 A;  4L15 A;  4JWU C;  1JCK B;  1TS5 A;  2KMM A;  3FYD A;  2Z4R A;  4X65 M;  5EE0 A;  2WDR B;  3FUX A;  1IBK M;  2LMC A;  3KOY E;  3AL0 C;  1C78 A;  4MGI E;  4WWM A;  1TH2 A;  2E6X A;  3GP7 A;  4NRW A;  2BTE A;  1QOF A;  1I4X A;  2WQY B;  5G5G A;  3LQQ A;  5HHD G;  2HTM E;  1DGH B;  1N78 A;  1IBX A;  2H89 B;  3HHZ A;  1OQQ A;  3V3X A;  2G1E A;  1SIJ A;  2KAC A;  2K9X A;  2BTW A;  1Q10 A;  1MX0 A;  4GKK M;  3ZCB B;  4JWS C;  4LTU A;  3W0F A;  5AUK A;  1WSP A;  4PD2 A;  1C76 A;  3P63 A;  1K51 A;  2CE7 A;  1SBB B;  2C96 A;  4OVZ B;  2KEB A;  1KTK A;  2V3P A;  1GB4 A;  1I4R A;  2D7H A;  4LK0 M;  3DZD A;  3GLG A;  4FCT A;  3R9X B;  1T3T A;  1FO4 A;  3JR5 A;  2L32 A;  1Z6T A;  3NUH B;  1D2N A;  3GRY A;  1ROE A;  2IGG A;  2KAJ A;  2L1A A;  2Y20 A;  1T3Q A;  1L1Z A;  3IG5 A;  3VKH A;  2LEK A;  3GQ4 A;  2L52 A;  1E0Z A;  3SAU A;  1N5W A;  2X38 A;  2ON8 A;  5I4D A;  1N34 M;  3WHL A;  1YQ3 B;  2J53 A;  3JR4 A;  2CEA A;  1Q3C A;  3AE7 B;  5FLX S;  1XXH A;  4M0D A;  1SXT A;  1FJG M;  3TEW A;  1IBM M;  3TWK A;  1KF6 B;  4RGO S;  1KYI A;  8CAT A;  5D3D A;  1V1O A;  1SXJ D;  1GPX A;  3GRU A;  1QQR A;  2LH0 A;  1QT9 A;  4PDI A;  1I4Q A;  4GKJ M;  3BK2 A;  4D8E A;  1TKG A;  1FNN A;  2KDM A;  2I2Y A;  2CFO A;  3SAS A;  3GPX A;  5KO3 A;  5ITR A;  5GXG B;  3HJQ A;  2VZK B;  2J7Q C;  2J7O A;  3HVZ A;  1Z5A A;  1SJH D;  2Y0T A;  1DOY A;  2CV1 A;  5EXT A;  1MU5 A;  4ZRQ A;  2DWM A;  2W3S A;  3T3O A;  1JRP A;  3SHF A;  1ET9 A;  3VR8 B;  3TQS A;  1CQV A;  3B2F A;  1K3X A;  2D7E A;  1QZM A;  1GB1 A;  3PHX A;  2WXK A;  5FTJ A;  1SEB D;  1QAM A;  2SAK A;  1XLP A;  2PTL A;  3N9Y C;  3GQ3 A;  4ARI A;  5FTL A;  1XLO A;  1AN8 A;  1E7P B;  1FFU A;  3MJ5 A;  1L6V A;  1NHW C;  3UJN A;  3U60 B;  2E3T A;  3CF2 A;  1HNW M;  2MEK A;  2JQR B;  2INP E;  1KSF X;  4IBB A;  4WAF A;  1ZP0 B;  3AE3 B;  1E10 A;  2DWL A;  2IJ0 A;  2BU3 A;  1QKZ A;  2N9K A;  4USA A;  2J52 A;  1SSN A;  3UMM A;  5JI3 E;  1L2C A;  1ENF A;  1HT1 E;  4B7F A;  5ITT A;  4ZOH C;  1PGB A;  2QEJ C;  1JWA D;  3B21 A;  2WXL A;  1TKE A;  5HFY A;  4DR1 M;  1J5E M;  5EJC A;  4WQM A;  3J81 S;  1BUI C;  4IOI E;  5KPR A;  2IGD A;  3U61 B;  4B3T M;  1Q39 A;  2KQ4 X;  3BK1 A;  2K3U A;  4N59 A;  1YZB A;  1QOB A;  4FCW A;  2FE8 A;  1I4W A;  5MPO A;  4TUW A;  4QOS A;  3PXG A;  1P7E A;  4KKJ A;  3NVZ A;  1NHG C;  4BOQ A;  4ZRP A;  2XSZ A;  1YNT E;  3SAW A;  2AX5 A;  2HCB A;  2QZ4 A;  3NS1 A;  3A42 A;  1VRA B;  1YN3 A;  4JX1 C;  1HQY E;  4DXG A;  2LJI A;  1XEE A;  1Z5B A;  2DYM A;  1ACC A;  1GVN A;  3FAH A;  2D7G A;  3H4M A;  1WRI A;  2MH7 A;  2G9H D;  3T38 A;  1VR9 A;  3Q69 A;  1WGK A;  3GPP A;  4NSR A;  1G3I A;  5JXV A;  4XBO A;  1OQR A;  4A8X C;  2Q2E B;  3I4V A;  2UXC M;  4LJ9 A;  1RM6 C;  2P5T A;  1NY6 A;  5FTM A;  3KWL A;  3AE5 B;  1EM7 A;  2QBY A;  3LXF A;  3GLF B;  3W5U B;  3U6Q A;  4LY6 A;  3C0R A;  2QPA A;  3AV0 A;  1RFK A;  3HU1 A;  2I38 A;  2X8A A;  3AE2 B;  3NVW A;  4JI1 M;  2JSV X;  2KZU A;  5KQD A;  4I4L A;  3Q8C A;  2W82 A;  2GI9 A;  4LLG M;  4B3R M;  4JI2 M;  3P4R B;  1G41 A;  2AQ2 B;  2DLB A;  3KW6 A;  5BYQ A;  2Y21 A;  1JRO A;  5JZE A;  1HXY D;  3VLF B;  3LMM A;  1FNU A;  4Z6Y A;  3RGS A;  2F5N A;  1N36 M;  3DWM A;  1I94 M;  5LNK 1;  3A45 A;  1XHB A;  1DO2 A;  1IQP A;  1QOG A;  2C9O A;  5D3I B;  3J7A S;  4RGM A;  3AED B;  1F77 A;  3Q8X A;  1J09 A;  3AEC B;  2JXT A;  2ZBK B;  4C7Z A;  1UWM A;  1DGG A;  3U6S A;  1HQC A;  2QMT A;  2EKI A;  4IBJ A;  3J2P B;  1V8C A;  5H37 D;  2AQ1 B;  1UUP A;  1PGA A;  4D8I A;  1QLB B;  4Q2J A;  2YR0 A;  4D80 A;  1FFV A;  3T15 A;  4NJC A;  2AGA A;  4G4R A;  3TUO A;  3J27 B;  2OED A;  3VDP A;  1IUE A;  1SJE D;  1JR3 A;  5BYR A;  4US9 A;  3LQR A;  1RWS A;  1IN8 A;  4G4O A;  4QHT A;  4DR5 M;  1MI0 A;  2D5G A;  2VZK D;  2XNA C;  4QOZ C;  2C98 A;  4US8 A;  1I4P A;  2YFQ A;  5DYI A;  3TPZ A;  3PT2 A;  2WDQ B;  1T6B X;  3U6P A;  3KS4 A;  1K82 A;  1EWY C;  3ZNH A;  3T1H M;  2PLP A;  1D5X C;  2PMV A;  3H8H A;  2V6Z M;  4NXM M;  4IBC A;  1IN7 A;  3D8B A;  3V05 A;  2LNH C;  2RKO A;  3GO8 A;  3FUV A;  3NZ3 A;  2HWK A;  2QCU A;  3VDU A;  4KX6 B;  5EE9 A;  5LMU M;  2NQ8 C;  4CGY B;  1MHX A;  4DV6 M;  3AOG A;  2R61 A;  3GLI A;  4DR2 M;  1I4G A;  2FOI C;  2UXD M;  3UK6 A;  3T1Y M;  3QAU A;  1QF6 A;  2CU3 A;  2CHG A;  3U5Z B;  5TSS A;  4MB7 A;  3WCQ A;  2UUB M;  4LF4 M;  1TZO A;  4AQY M;  1PFD A;  1AW7 A;  1WXQ A;  3BWU D;  4LF8 M;  3AM9 A;  1FD6 A;  4KGS A;  1IXZ A;  3VR9 B;  1IXR C;  4NRV A;  3PO0 A;  3ZJU A;  3RNV A;  3M6A A;  5IWA M;  2XGN A;  5E26 A;  4ZHO A;  2DWQ A;  2WLB A;  1JML A;  4DR3 M;  3EGR A;  1V1P B;  4P16 A;  3TEX A;  1QVR A;  3VFD A;  3BY4 A;  4C80 A;  3NBI A;  4MI7 A;  2W3R A;  4OU7 A;  1L6U A;  4BLC A;  1XC8 A;  1NJG A;  1ET6 A;  1E9S A;  3D8L A;  1DGH A;  1FIQ A;  1B1Z A;  2ZW1 A;  2Y5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...