1HUCB

The refined 2.15 angstroms x-ray crystal structure of human liver cathepsin b: the structural basis for its specificity
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
205
structure length
205
Chain Sequence
VSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Thiol protease
molecule keywords CATHEPSIN B
publication title The refined 2.15 A X-ray crystal structure of human liver cathepsin B: the structural basis for its specificity.
pubmed rcsb
source organism Homo sapiens
total genus 49
structure length 205
sequence length 205
chains with identical sequence D
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 1993-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1hucB00
1PXVA 3BCNA 3KSEA 2DC8A 3E1ZB 4BPVA 2HD5A 1MEGA 4P6EA 4HWYA 3S3QA 1QMYA 2R9MA 4X6HA 4CDFB 2IPPB 3KW9A 2DCAA 2B1NA 4N79A 2FQ9A 3U8EA 3CH3X 3PBHA 3IUTA 2ATOA 1F2CA 2H7JA 3ERVA 3KWZA 1YT7A 3K24A 2G6DA 2WBFX 2OP3A 4DMYA 1HUCB 2ACTA 2E01A 1U9XA 4I07A 2XU3A 3TNXA 1NB5A 1NLJA 1U9WA 2FRQA 2DCCA 2JQFR 3NHEA 4QRGA 5CVOB 5CVMA 1CQDA 2HXZA 1QXPA 3V6CA 3MTNA 1ME4A 3N3KA 4N4ZA 3K8UA 1Y08A 3QSDA 1EWPA 3V6EA 1CSBB 4CDDB 1PIPA 2IBIA 1TU6A 2G8JA 3QJ3A 1S4VA 1SNKA 4BS5A 6PADA 4PADA 3USVA 2E02A 4CDCB 2AUXA 1CVZA 4YYRA 2R9CA 4MZOA 1NB3A 4K7CA 3K9MA 2P0RA 1KFUL 1MEMA 2YJ9A 4X6JA 2F7DA 3PW3A 3IOQA 1ME3A 2CB5A 3H8BA 3HHIA 3CBJA 2PREA 3OVZA 2P7UA 5J94A 3BPFA 3MORA 3S3RA 1KFXL 2DCBA 1U9QX 5CVNB 3P5WA 1ICFA 3LXSA 1AYVA 5JA7A 5FPWA 3F75A 3I3TA 4X6IA 1STFE 2DJGB 4FJCA 3N4CA 2HHNA 1PPPA 8PCHA 4PI3A 3MHHA 1MHWA 1F2AA 1YK7A 3IHPA 2PBHA 1EWMA 4DMXA 4ZUXU 2GFOA 1NL6A 3C9EA 1GLOA 3O0UA 1PBHA 1VJVA 2BDZA 3I06A 2AU1A 4W4UA 3ZUAA 4QRVA 4BQVA 1AECA 2NQDB 4Q8GA 2FT2A 4FK5A 1CPJA 1O0EA 1QOLA 2P86A 1AIMA 3OF9A 1THEA 1POPA 2F1GA 5A24A 3DF0A 3AI8A 1Y4HA 3BOWA 2DCDA 4FIPA 4YYWA 2XU1A 3F5VA 4YYSA 2XU5A 1PPOA 2AVWA 1SP4B 4XUIA 4W5CA 1FH0A 3OF8A 1QDQA 3CBKA 2JQGR 2FO5A 1EWOA 5JH3A 2FRAA 2PNSA 3H89A 3P5VA 2BDLA 2FYEA 2NQGA 3BPMA 2R9OA 2YJ2A 1MIRA 4W5BA 2B1MA 5EGWA 1IWDA 1CTEA 3N3GA 3B79A 2Y6EA 1GCBA 4Q8HA 3QT4A 1BP4A 3P5UA 4YVAA 1NPZA 3M99A 1XKGA 1ATKA 4KLBA 1KHQA 2AYNA 2E03A 4AXMA 1U5IA 1X9YA 1PE6A 1DEUA 3GCBA 1PPNA 3BWKA 3WXGA 1AU3A 2FTDA 2AS8A 4YV8A 2DZYA 4P6GA 2DC7A 2G8EA 2Y5BA 9PAPA 1F2BA 4YYQA 5CHTA 3KX1A 1NQCA 2YJ8A 1CV8A 1YVBA 4QRXA 3WXFA 1ITOA 3KFQA 3H8CA 3RVXA 3LFYA 4PP2E 1ZCMA 2E00A 1CB5A 2VHSA 2R9NA 2FUDA 1GMYA 3O1GA 3IMAA 3KWBX 2DC9A 2VHFA 2R9FA 1AU2A 4QBBA 1DF0A 3OVXA 3HD3A 4OEMA 3BC3A 3IEJA 1MDWA 3RVVA 1TL9A 4I04A 1VSNA 2C0YA 4N8WA 2R6NA 1KHPA 3OISA 4CZWA 5F02A 1PADA 2YJBA 3H7DA 2G7YA 7PCKA 4AXLA 1Q6KA 1K3BB 4I05A 3D6SA 2XU4A 5CHVA 1EF7A 2AIMA 2DZZA 1PPDA 1YK8A 2YJCA 3RVWA 1GECE 2HH5A 4G54A 3H6SA 3KKUA 3HWNA 3P5XA 3PNRA 4CDEB 1YALA 1MS6A 2CIOA 3HHAA 3PDFA 4RY2A 2O6XA 1AU0A 4MZSA 5PADA 4OELA 1TLOA 1AYWA 4XR7A 2DC6A 2OULA 4BSQA 3IV2A 2AUZA 1A6RA 4YYUA 3WXEA 2GHUA 1KXRA 2AYOA 4QH6A 2DJFB 3MHSA 5K16A 1M6DA 2PADA 1BGOA 4PP1A 3CH2X 4WA6A 1CS8A 1ZIVA 1PCIA 1F29A 1BQIA 5EF4A 2ARYA 1AU4A 2NQIA 4MSXA 4BS6A 2OZ2A 1AYUA 1JQPA 1BY8A 1EWLA 4YYVA 1CJLA 1U9VA 2NQAA
chains in the Genus database with same CATH superfamily
1PXVA 3BCNA 3KSEA 2DC8A 3E1ZB 4BPVA 2HD5A 1MEGA 4P6EA 4HWYA 3S3QA 1QMYA 2R9MA 4X6HA 4CDFB 2IPPB 3KW9A 2DCAA 4D8EA 2BTWA 2B1NA 4BOPA 4N79A 2FQ9A 3U8EA 3CH3X 3PBHA 3MTVA 3IUTA 2ATOA 1F2CA 2H7JA 3ERVA 3KWZA 1YT7A 3K24A 2G6DA 2WBFX 2OP3A 4DMYA 1HUCB 4IP3A 2ACTA 2E01A 1U9XA 4I07A 2XU3A 3TNXA 1NB5A 1NLJA 1U9WA 2FRQA 2DCCA 3MJ5A 4M0WA 2JQFR 3NHEA 4QRGA 5CVOB 5CVMA 4P16A 1CQDA 2HXZA 3MP2A 4BOQA 1QXPA 4XZXA 4MI7A 5EZSA 3V6CA 3MTNA 3PT2A 1ME4A 3N3KA 4PT5A 4N4ZA 2Z84A 3K8UA 1Y08A 3QSDA 1EWPA 3V6EA 1CSBB 4CDDB 1PIPA 2IBIA 1TU6A 2G8JA 3QJ3A 1S4VA 1SNKA 4BS5A 6PADA 4PADA 3USVA 2E02A 4CDCB 4HXDB 2AUXA 1CVZA 2JTCA 4YYRA 2R9CA 4MZOA 1NB3A 4K7CA 3K9MA 2P0RA 1KFUL 3C0RA 1MEMA 2BTWB 2YJ9A 4X6JA 2F7DA 3E9SA 3PW3A 3IOQA 3PRPA 1ME3A 4RNAA 2CB5A 3H8BA 3HHIA 3CBJA 2PREA 3OVZA 2P7UA 5J94A 3BPFA 3MORA 3BY4A 3S3RA 1KFXL 2DCBA 1U9QX 5CVNB 3P5WA 1ICFA 3LXSA 4D8BA 1AYVA 5JA7A 4A5UA 3W30A 4RF1A 5FPWA 3F75A 2BU3A 3I3TA 4X6IA 1STFE 2DJGB 4FJCA 3N4CA 2HHNA 1PPPA 4BOZA 8PCHA 3PHXA 4PI3A 3MHHA 1MHWA 1F2AA 1YK7A 3IHPA 2PBHA 1EWMA 4DMXA 4OW0A 4ZUXU 2GFOA 1NL6A 4BOSA 3C9EA 1GLOA 3O0UA 1PBHA 1VJVA 2BDZA 3I06A 2AU1A 4W4UA 3ZUAA 4WURA 4QRVA 5JZEA 2DOSA 4BQVA 1AECA 2NQDB 4Q8GA 2FT2A 4FK5A 1CPJA 4RKXA 1O0EA 1QOLA 2P86A 1AIMA 2AGAA 3TRKA 3OF9A 1THEA 3BBAA 1POPA 2F1GA 2JRIA 5A24A 3DF0A 3AI8A 1UKFA 1Y4HA 4GUAA 3B21A 3O65A 3BOWA 4OVZA 2DCDA 1YZBA 4FIPA 4YYWA 2XU1A 3F5VA 4YYSA 2XU5A 1PPOA 2AVWA 1SP4B 4XUIA 4W5CA 1FH0A 2J7QC 3OF8A 1QDQA 3CBKA 2JQGR 2FO5A 1EWOA 5JH3A 2FRAA 2PNSA 3H89A 3P5VA 2BDLA 2FYEA 3W31A 2NQGA 3BPMA 2R9OA 2YJ2A 4ZTBA 3PRMA 1MIRA 3PSEA 4W5BA 2B1MA 5EGWA 1IWDA 1CTEA 3N3GA 3B79A 2Y6EA 1GCBA 5EZQA 3OQCA 4RF0A 4Q8HA 3QT4A 1BP4A 3P5UA 4YVAA 1NPZA 3M99A 1XKGA 1ATKA 4KLBA 1KHQA 2AYNA 2E03A 4AXMA 1U5IA 1PVJA 1X9YA 1PE6A 1DEUA 3GCBA 1PPNA 3BWKA 3WXGA 1AU3A 2FTDA 2AS8A 4R3DA 4YV8A 2DZYA 4P6GA 2DC7A 4BOUA 2G8EA 2Y5BA 4OVZB 9PAPA 1F2BA 4YYQA 5CHTA 3KX1A 1NQCA 2YJ8A 1CV8A 1YVBA 4QRXA 3WXFA 1ITOA 3KFQA 3H8CA 3RVXA 3LFYA 4PP2E 1ZCMA 2E00A 5KO3A 1CB5A 2VHSA 2R9NA 2FUDA 1GMYA 3O1GA 3IMAA 3KWBX 4IUMA 2DC9A 2VHFA 2R9FA 1AU2A 4QBBA 1DF0A 3OVXA 3HD3A 4OEMA 3BC3A 3IEJA 1MDWA 3RVVA 1TL9A 4I04A 1VSNA 5E6JA 2C0YA 4N8WA 3RNVA 2R6NA 1KHPA 3OISA 4CZWA 5F02A 1PADA 2YJBA 3H7DA 2G7YA 7PCKA 4AXLA 3PHWA 1Q6KA 1K3BB 4I05A 3D6SA 2XU4A 5CHVA 1EF7A 2AIMA 2DZZA 4MM3B 1PPDA 1YK8A 2FE8A 2YJCA 3RVWA 1GECE 2HH5A 4G54A 3H6SA 3KKUA 3HWNA 3P5XA 3PNRA 4CDEB 1YALA 1MS6A 2CIOA 3HHAA 3PDFA 4RY2A 2O6XA 1AU0A 2UZJA 4MZSA 5PADA 4OELA 1TLOA 1AYWA 4XR7A 2DC6A 2OULA 4BSQA 3IV2A 2AUZA 3ZNHA 1A6RA 4YYUA 3WXEA 2GHUA 1KXRA 2AYOA 4QH6A 2DJFB 3MHSA 5K16A 1M6DA 2PADA 1BGOA 1DKIA 4PP1A 3CH2X 3TMPA 4REZA 2HWKA 4WA6A 1CS8A 2J7QA 4D8IA 1ZIVA 1PCIA 1F29A 1BQIA 5EF4A 2ARYA 1AU4A 2NQIA 4MSXA 4BS6A 3IFUA 3PHUA 2OZ2A 1AYUA 1JQPA 1BY8A 1EWLA 4YYVA 1CJLA 3BB7A 1U9VA 2NQAA
chains in the Genus database with same CATH topology
1PXVA 3BCNA 3KSEA 2DC8A 3E1ZB 4BPVA 2HD5A 1MEGA 4P6EA 4HWYA 3S3QA 1QMYA 2R9MA 4X6HA 3D9WA 4CDFB 2IPPB 3KW9A 2DCAA 2B1NA 4N79A 2FQ9A 3U8EA 3CH3X 3PBHA 3IUTA 2ATOA 1F2CA 2H7JA 3ERVA 3KWZA 1YT7A 3K24A 2G6DA 2WBFX 2OP3A 4DMYA 1HUCB 2ACTA 2E01A 1U9XA 4I07A 2XU3A 3TNXA 1NB5A 1NLJA 1U9WA 2FRQA 2DCCA 2JQFR 4GUZA 3NHEA 4QRGA 5CVOB 5CVMA 1CQDA 2HXZA 1W5RA 1QXPA 3V6CA 3MTNA 1ME4A 3N3KA 4N4ZA 3K8UA 1Y08A 3QSDA 1EWPA 3V6EA 1CSBB 4CDDB 1PIPA 2IBIA 1TU6A 2G8JA 3QJ3A 1S4VA 1SNKA 4BS5A 6PADA 4PADA 3USVA 2E02A 4CDCB 2AUXA 3LTWA 1CVZA 4YYRA 2R9CA 4MZOA 1NB3A 4K7CA 3K9MA 2P0RA 1KFUL 1MEMA 2YJ9A 4X6JA 2F7DA 3PW3A 3IOQA 1ME3A 2CB5A 2VFCA 3H8BA 3HHIA 3CBJA 2PREA 3OVZA 2P7UA 5J94A 3BPFA 3MORA 3S3RA 1KFXL 2DCBA 1U9QX 5CVNB 3P5WA 1ICFA 3LXSA 1AYVA 5JA7A 5FPWA 3F75A 3I3TA 4X6IA 1STFE 2DJGB 4FJCA 3N4CA 2HHNA 1PPPA 8PCHA 4PI3A 3MHHA 1MHWA 1F2AA 4BGFA 1YK7A 3IHPA 2PBHA 1EWMA 4DMXA 4ZUXU 2GFOA 1NL6A 3C9EA 1GLOA 3O0UA 1PBHA 1VJVA 2BDZA 3I06A 2AU1A 4W4UA 3ZUAA 4QRVA 4BQVA 1AECA 2NQDB 4Q8GA 2FT2A 4FK5A 1CPJA 1O0EA 1QOLA 2P86A 1AIMA 3OF9A 1THEA 1POPA 2F1GA 5A24A 3DF0A 3AI8A 1Y4HA 3BOWA 2DCDA 4FIPA 4YYWA 2XU1A 3F5VA 4YYSA 2XU5A 1PPOA 2AVWA 1SP4B 4XUIA 4W5CA 1FH0A 3OF8A 1QDQA 3CBKA 2JQGR 2FO5A 1EWOA 5JH3A 2FRAA 2PNSA 3H89A 3P5VA 2BDLA 2FYEA 2NQGA 3BPMA 2R9OA 2YJ2A 1MIRA 4W5BA 2B1MA 5EGWA 1IWDA 1CTEA 3N3GA 3B79A 2Y6EA 1GCBA 4Q8HA 3QT4A 1BP4A 3P5UA 4YVAA 1NPZA 3M99A 1XKGA 1ATKA 4KLBA 1KHQA 2AYNA 2E03A 4AXMA 1U5IA 1X9YA 1PE6A 1DEUA 3GCBA 1PPNA 3BWKA 3WXGA 1AU3A 1GX3A 2FTDA 2AS8A 4NV8A 4YV8A 2DZYA 4P6GA 2DC7A 2G8EA 2Y5BA 9PAPA 1F2BA 4YYQA 5CHTA 3KX1A 1NQCA 2YJ8A 1CV8A 1YVBA 4QRXA 3WXFA 1ITOA 3KFQA 3H8CA 3RVXA 3LFYA 4PP2E 1W6FA 1ZCMA 2E00A 1CB5A 2VHSA 2R9NA 2FUDA 1GMYA 3O1GA 3IMAA 3KWBX 2DC9A 4B55A 2VHFA 2R9FA 1AU2A 4QBBA 1DF0A 3OVXA 3HD3A 4OEMA 2BSZA 3BC3A 3IEJA 1MDWA 3RVVA 1TL9A 4I04A 1VSNA 2C0YA 4N8WA 4NV7A 2R6NA 1KHPA 3OISA 4CZWA 5F02A 1PADA 2YJBA 3H7DA 2G7YA 7PCKA 4AXLA 1Q6KA 1K3BB 4I05A 3D6SA 2XU4A 5CHVA 1EF7A 2AIMA 2DZZA 1W4TA 4C5PA 1PPDA 1YK8A 2YJCA 3RVWA 1GECE 2HH5A 4G54A 1E2TA 3H6SA 3KKUA 3HWNA 3P5XA 3PNRA 4CDEB 1YALA 1MS6A 2CIOA 3HHAA 3PDFA 4RY2A 2O6XA 1AU0A 4MZSA 5PADA 4OELA 1TLOA 1AYWA 4XR7A 2DC6A 2OULA 4BSQA 2VFBA 3IV2A 2AUZA 1A6RA 4YYUA 3WXEA 2GHUA 1KXRA 2AYOA 4QH6A 2DJFB 3MHSA 5K16A 1M6DA 2PADA 1BGOA 4PP1A 3CH2X 4WA6A 1CS8A 1ZIVA 1PCIA 1F29A 1BQIA 5EF4A 2ARYA 1AU4A 2NQIA 4MSXA 4BS6A 2OZ2A 1AYUA 1JQPA 1BY8A 1EWLA 4YYVA 1CJLA 1U9VA 2NQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PXV A;  3BCN A;  3KSE A;  2DC8 A;  3E1Z B;  4BPV A;  2HD5 A;  1MEG A;  4P6E A;  4HWY A;  3S3Q A;  1QMY A;  2R9M A;  4X6H A;  4CDF B;  2IPP B;  3KW9 A;  2DCA A;  2B1N A;  4N79 A;  2FQ9 A;  3U8E A;  3CH3 X;  3PBH A;  3IUT A;  2ATO A;  1F2C A;  2H7J A;  3ERV A;  3KWZ A;  1YT7 A;  3K24 A;  2G6D A;  2WBF X;  2OP3 A;  4DMY A;  1HUC B;  2ACT A;  2E01 A;  1U9X A;  4I07 A;  2XU3 A;  3TNX A;  1NB5 A;  1NLJ A;  1U9W A;  2FRQ A;  2DCC A;  2JQF R;  3NHE A;  4QRG A;  5CVO B;  5CVM A;  1CQD A;  2HXZ A;  1QXP A;  3V6C A;  3MTN A;  1ME4 A;  3N3K A;  4N4Z A;  3K8U A;  1Y08 A;  3QSD A;  1EWP A;  3V6E A;  1CSB B;  4CDD B;  1PIP A;  2IBI A;  1TU6 A;  2G8J A;  3QJ3 A;  1S4V A;  1SNK A;  4BS5 A;  6PAD A;  4PAD A;  3USV A;  2E02 A;  4CDC B;  2AUX A;  1CVZ A;  4YYR A;  2R9C A;  4MZO A;  1NB3 A;  4K7C A;  3K9M A;  2P0R A;  1KFU L;  1MEM A;  2YJ9 A;  4X6J A;  2F7D A;  3PW3 A;  3IOQ A;  1ME3 A;  2CB5 A;  3H8B A;  3HHI A;  3CBJ A;  2PRE A;  3OVZ A;  2P7U A;  5J94 A;  3BPF A;  3MOR A;  3S3R A;  1KFX L;  2DCB A;  1U9Q X;  5CVN B;  3P5W A;  1ICF A;  3LXS A;  1AYV A;  5JA7 A;  5FPW A;  3F75 A;  3I3T A;  4X6I A;  1STF E;  2DJG B;  4FJC A;  3N4C A;  2HHN A;  1PPP A;  8PCH A;  4PI3 A;  3MHH A;  1MHW A;  1F2A A;  1YK7 A;  3IHP A;  2PBH A;  1EWM A;  4DMX A;  4ZUX U;  2GFO A;  1NL6 A;  3C9E A;  1GLO A;  3O0U A;  1PBH A;  1VJV A;  2BDZ A;  3I06 A;  2AU1 A;  4W4U A;  3ZUA A;  4QRV A;  4BQV A;  1AEC A;  2NQD B;  4Q8G A;  2FT2 A;  4FK5 A;  1CPJ A;  1O0E A;  1QOL A;  2P86 A;  1AIM A;  3OF9 A;  1THE A;  1POP A;  2F1G A;  5A24 A;  3DF0 A;  3AI8 A;  1Y4H A;  3BOW A;  2DCD A;  4FIP A;  4YYW A;  2XU1 A;  3F5V A;  4YYS A;  2XU5 A;  1PPO A;  2AVW A;  1SP4 B;  4XUI A;  4W5C A;  1FH0 A;  3OF8 A;  1QDQ A;  3CBK A;  2JQG R;  2FO5 A;  1EWO A;  5JH3 A;  2FRA A;  2PNS A;  3H89 A;  3P5V A;  2BDL A;  2FYE A;  2NQG A;  3BPM A;  2R9O A;  2YJ2 A;  1MIR A;  4W5B A;  2B1M A;  5EGW A;  1IWD A;  1CTE A;  3N3G A;  3B79 A;  2Y6E A;  1GCB A;  4Q8H A;  3QT4 A;  1BP4 A;  3P5U A;  4YVA A;  1NPZ A;  3M99 A;  1XKG A;  1ATK A;  4KLB A;  1KHQ A;  2AYN A;  2E03 A;  4AXM A;  1U5I A;  1X9Y A;  1PE6 A;  1DEU A;  3GCB A;  1PPN A;  3BWK A;  3WXG A;  1AU3 A;  2FTD A;  2AS8 A;  4YV8 A;  2DZY A;  4P6G A;  2DC7 A;  2G8E A;  2Y5B A;  9PAP A;  1F2B A;  4YYQ A;  5CHT A;  3KX1 A;  1NQC A;  2YJ8 A;  1CV8 A;  1YVB A;  4QRX A;  3WXF A;  1ITO A;  3KFQ A;  3H8C A;  3RVX A;  3LFY A;  4PP2 E;  1ZCM A;  2E00 A;  1CB5 A;  2VHS A;  2R9N A;  2FUD A;  1GMY A;  3O1G A;  3IMA A;  3KWB X;  2DC9 A;  2VHF A;  2R9F A;  1AU2 A;  4QBB A;  1DF0 A;  3OVX A;  3HD3 A;  4OEM A;  3BC3 A;  3IEJ A;  1MDW A;  3RVV A;  1TL9 A;  4I04 A;  1VSN A;  2C0Y A;  4N8W A;  2R6N A;  1KHP A;  3OIS A;  4CZW A;  5F02 A;  1PAD A;  2YJB A;  3H7D A;  2G7Y A;  7PCK A;  4AXL A;  1Q6K A;  1K3B B;  4I05 A;  3D6S A;  2XU4 A;  5CHV A;  1EF7 A;  2AIM A;  2DZZ A;  1PPD A;  1YK8 A;  2YJC A;  3RVW A;  1GEC E;  2HH5 A;  4G54 A;  3H6S A;  3KKU A;  3HWN A;  3P5X A;  3PNR A;  4CDE B;  1YAL A;  1MS6 A;  2CIO A;  3HHA A;  3PDF A;  4RY2 A;  2O6X A;  1AU0 A;  4MZS A;  5PAD A;  4OEL A;  1TLO A;  1AYW A;  4XR7 A;  2DC6 A;  2OUL A;  4BSQ A;  3IV2 A;  2AUZ A;  1A6R A;  4YYU A;  3WXE A;  2GHU A;  1KXR A;  2AYO A;  4QH6 A;  2DJF B;  3MHS A;  5K16 A;  1M6D A;  2PAD A;  1BGO A;  4PP1 A;  3CH2 X;  4WA6 A;  1CS8 A;  1ZIV A;  1PCI A;  1F29 A;  1BQI A;  5EF4 A;  2ARY A;  1AU4 A;  2NQI A;  4MSX A;  4BS6 A;  2OZ2 A;  1AYU A;  1JQP A;  1BY8 A;  1EWL A;  4YYV A;  1CJL A;  1U9V A;  2NQA A; 
#chains in the Genus database with same CATH topology
 1PXV A;  3BCN A;  3KSE A;  2DC8 A;  3E1Z B;  4BPV A;  2HD5 A;  1MEG A;  4P6E A;  4HWY A;  3S3Q A;  1QMY A;  2R9M A;  4X6H A;  4CDF B;  2IPP B;  3KW9 A;  2DCA A;  4D8E A;  2BTW A;  2B1N A;  4BOP A;  4N79 A;  2FQ9 A;  3U8E A;  3CH3 X;  3PBH A;  3MTV A;  3IUT A;  2ATO A;  1F2C A;  2H7J A;  3ERV A;  3KWZ A;  1YT7 A;  3K24 A;  2G6D A;  2WBF X;  2OP3 A;  4DMY A;  1HUC B;  4IP3 A;  2ACT A;  2E01 A;  1U9X A;  4I07 A;  2XU3 A;  3TNX A;  1NB5 A;  1NLJ A;  1U9W A;  2FRQ A;  2DCC A;  3MJ5 A;  4M0W A;  2JQF R;  3NHE A;  4QRG A;  5CVO B;  5CVM A;  4P16 A;  1CQD A;  2HXZ A;  3MP2 A;  4BOQ A;  1QXP A;  4XZX A;  4MI7 A;  5EZS A;  3V6C A;  3MTN A;  3PT2 A;  1ME4 A;  3N3K A;  4PT5 A;  4N4Z A;  2Z84 A;  3K8U A;  1Y08 A;  3QSD A;  1EWP A;  3V6E A;  1CSB B;  4CDD B;  1PIP A;  2IBI A;  1TU6 A;  2G8J A;  3QJ3 A;  1S4V A;  1SNK A;  4BS5 A;  6PAD A;  4PAD A;  3USV A;  2E02 A;  4CDC B;  4HXD B;  2AUX A;  1CVZ A;  2JTC A;  4YYR A;  2R9C A;  4MZO A;  1NB3 A;  4K7C A;  3K9M A;  2P0R A;  1KFU L;  3C0R A;  1MEM A;  2BTW B;  2YJ9 A;  4X6J A;  2F7D A;  3E9S A;  3PW3 A;  3IOQ A;  3PRP A;  1ME3 A;  4RNA A;  2CB5 A;  3H8B A;  3HHI A;  3CBJ A;  2PRE A;  3OVZ A;  2P7U A;  5J94 A;  3BPF A;  3MOR A;  3BY4 A;  3S3R A;  1KFX L;  2DCB A;  1U9Q X;  5CVN B;  3P5W A;  1ICF A;  3LXS A;  4D8B A;  1AYV A;  5JA7 A;  4A5U A;  3W30 A;  4RF1 A;  5FPW A;  3F75 A;  2BU3 A;  3I3T A;  4X6I A;  1STF E;  2DJG B;  4FJC A;  3N4C A;  2HHN A;  1PPP A;  4BOZ A;  8PCH A;  3PHX A;  4PI3 A;  3MHH A;  1MHW A;  1F2A A;  1YK7 A;  3IHP A;  2PBH A;  1EWM A;  4DMX A;  4OW0 A;  4ZUX U;  2GFO A;  1NL6 A;  4BOS A;  3C9E A;  1GLO A;  3O0U A;  1PBH A;  1VJV A;  2BDZ A;  3I06 A;  2AU1 A;  4W4U A;  3ZUA A;  4WUR A;  4QRV A;  5JZE A;  2DOS A;  4BQV A;  1AEC A;  2NQD B;  4Q8G A;  2FT2 A;  4FK5 A;  1CPJ A;  4RKX A;  1O0E A;  1QOL A;  2P86 A;  1AIM A;  2AGA A;  3TRK A;  3OF9 A;  1THE A;  3BBA A;  1POP A;  2F1G A;  2JRI A;  5A24 A;  3DF0 A;  3AI8 A;  1UKF A;  1Y4H A;  4GUA A;  3B21 A;  3O65 A;  3BOW A;  4OVZ A;  2DCD A;  1YZB A;  4FIP A;  4YYW A;  2XU1 A;  3F5V A;  4YYS A;  2XU5 A;  1PPO A;  2AVW A;  1SP4 B;  4XUI A;  4W5C A;  1FH0 A;  2J7Q C;  3OF8 A;  1QDQ A;  3CBK A;  2JQG R;  2FO5 A;  1EWO A;  5JH3 A;  2FRA A;  2PNS A;  3H89 A;  3P5V A;  2BDL A;  2FYE A;  3W31 A;  2NQG A;  3BPM A;  2R9O A;  2YJ2 A;  4ZTB A;  3PRM A;  1MIR A;  3PSE A;  4W5B A;  2B1M A;  5EGW A;  1IWD A;  1CTE A;  3N3G A;  3B79 A;  2Y6E A;  1GCB A;  5EZQ A;  3OQC A;  4RF0 A;  4Q8H A;  3QT4 A;  1BP4 A;  3P5U A;  4YVA A;  1NPZ A;  3M99 A;  1XKG A;  1ATK A;  4KLB A;  1KHQ A;  2AYN A;  2E03 A;  4AXM A;  1U5I A;  1PVJ A;  1X9Y A;  1PE6 A;  1DEU A;  3GCB A;  1PPN A;  3BWK A;  3WXG A;  1AU3 A;  2FTD A;  2AS8 A;  4R3D A;  4YV8 A;  2DZY A;  4P6G A;  2DC7 A;  4BOU A;  2G8E A;  2Y5B A;  4OVZ B;  9PAP A;  1F2B A;  4YYQ A;  5CHT A;  3KX1 A;  1NQC A;  2YJ8 A;  1CV8 A;  1YVB A;  4QRX A;  3WXF A;  1ITO A;  3KFQ A;  3H8C A;  3RVX A;  3LFY A;  4PP2 E;  1ZCM A;  2E00 A;  5KO3 A;  1CB5 A;  2VHS A;  2R9N A;  2FUD A;  1GMY A;  3O1G A;  3IMA A;  3KWB X;  4IUM A;  2DC9 A;  2VHF A;  2R9F A;  1AU2 A;  4QBB A;  1DF0 A;  3OVX A;  3HD3 A;  4OEM A;  3BC3 A;  3IEJ A;  1MDW A;  3RVV A;  1TL9 A;  4I04 A;  1VSN A;  5E6J A;  2C0Y A;  4N8W A;  3RNV A;  2R6N A;  1KHP A;  3OIS A;  4CZW A;  5F02 A;  1PAD A;  2YJB A;  3H7D A;  2G7Y A;  7PCK A;  4AXL A;  3PHW A;  1Q6K A;  1K3B B;  4I05 A;  3D6S A;  2XU4 A;  5CHV A;  1EF7 A;  2AIM A;  2DZZ A;  4MM3 B;  1PPD A;  1YK8 A;  2FE8 A;  2YJC A;  3RVW A;  1GEC E;  2HH5 A;  4G54 A;  3H6S A;  3KKU A;  3HWN A;  3P5X A;  3PNR A;  4CDE B;  1YAL A;  1MS6 A;  2CIO A;  3HHA A;  3PDF A;  4RY2 A;  2O6X A;  1AU0 A;  2UZJ A;  4MZS A;  5PAD A;  4OEL A;  1TLO A;  1AYW A;  4XR7 A;  2DC6 A;  2OUL A;  4BSQ A;  3IV2 A;  2AUZ A;  3ZNH A;  1A6R A;  4YYU A;  3WXE A;  2GHU A;  1KXR A;  2AYO A;  4QH6 A;  2DJF B;  3MHS A;  5K16 A;  1M6D A;  2PAD A;  1BGO A;  1DKI A;  4PP1 A;  3CH2 X;  3TMP A;  4REZ A;  2HWK A;  4WA6 A;  1CS8 A;  2J7Q A;  4D8I A;  1ZIV A;  1PCI A;  1F29 A;  1BQI A;  5EF4 A;  2ARY A;  1AU4 A;  2NQI A;  4MSX A;  4BS6 A;  3IFU A;  3PHU A;  2OZ2 A;  1AYU A;  1JQP A;  1BY8 A;  1EWL A;  4YYV A;  1CJL A;  3BB7 A;  1U9V A;  2NQA A; 
#chains in the Genus database with same CATH homology
 1PXV A;  3BCN A;  3KSE A;  2DC8 A;  3E1Z B;  4BPV A;  2HD5 A;  1MEG A;  4P6E A;  4HWY A;  3S3Q A;  1QMY A;  2R9M A;  4X6H A;  3D9W A;  4CDF B;  2IPP B;  3KW9 A;  2DCA A;  2B1N A;  4N79 A;  2FQ9 A;  3U8E A;  3CH3 X;  3PBH A;  3IUT A;  2ATO A;  1F2C A;  2H7J A;  3ERV A;  3KWZ A;  1YT7 A;  3K24 A;  2G6D A;  2WBF X;  2OP3 A;  4DMY A;  1HUC B;  2ACT A;  2E01 A;  1U9X A;  4I07 A;  2XU3 A;  3TNX A;  1NB5 A;  1NLJ A;  1U9W A;  2FRQ A;  2DCC A;  2JQF R;  4GUZ A;  3NHE A;  4QRG A;  5CVO B;  5CVM A;  1CQD A;  2HXZ A;  1W5R A;  1QXP A;  3V6C A;  3MTN A;  1ME4 A;  3N3K A;  4N4Z A;  3K8U A;  1Y08 A;  3QSD A;  1EWP A;  3V6E A;  1CSB B;  4CDD B;  1PIP A;  2IBI A;  1TU6 A;  2G8J A;  3QJ3 A;  1S4V A;  1SNK A;  4BS5 A;  6PAD A;  4PAD A;  3USV A;  2E02 A;  4CDC B;  2AUX A;  3LTW A;  1CVZ A;  4YYR A;  2R9C A;  4MZO A;  1NB3 A;  4K7C A;  3K9M A;  2P0R A;  1KFU L;  1MEM A;  2YJ9 A;  4X6J A;  2F7D A;  3PW3 A;  3IOQ A;  1ME3 A;  2CB5 A;  2VFC A;  3H8B A;  3HHI A;  3CBJ A;  2PRE A;  3OVZ A;  2P7U A;  5J94 A;  3BPF A;  3MOR A;  3S3R A;  1KFX L;  2DCB A;  1U9Q X;  5CVN B;  3P5W A;  1ICF A;  3LXS A;  1AYV A;  5JA7 A;  5FPW A;  3F75 A;  3I3T A;  4X6I A;  1STF E;  2DJG B;  4FJC A;  3N4C A;  2HHN A;  1PPP A;  8PCH A;  4PI3 A;  3MHH A;  1MHW A;  1F2A A;  4BGF A;  1YK7 A;  3IHP A;  2PBH A;  1EWM A;  4DMX A;  4ZUX U;  2GFO A;  1NL6 A;  3C9E A;  1GLO A;  3O0U A;  1PBH A;  1VJV A;  2BDZ A;  3I06 A;  2AU1 A;  4W4U A;  3ZUA A;  4QRV A;  4BQV A;  1AEC A;  2NQD B;  4Q8G A;  2FT2 A;  4FK5 A;  1CPJ A;  1O0E A;  1QOL A;  2P86 A;  1AIM A;  3OF9 A;  1THE A;  1POP A;  2F1G A;  5A24 A;  3DF0 A;  3AI8 A;  1Y4H A;  3BOW A;  2DCD A;  4FIP A;  4YYW A;  2XU1 A;  3F5V A;  4YYS A;  2XU5 A;  1PPO A;  2AVW A;  1SP4 B;  4XUI A;  4W5C A;  1FH0 A;  3OF8 A;  1QDQ A;  3CBK A;  2JQG R;  2FO5 A;  1EWO A;  5JH3 A;  2FRA A;  2PNS A;  3H89 A;  3P5V A;  2BDL A;  2FYE A;  2NQG A;  3BPM A;  2R9O A;  2YJ2 A;  1MIR A;  4W5B A;  2B1M A;  5EGW A;  1IWD A;  1CTE A;  3N3G A;  3B79 A;  2Y6E A;  1GCB A;  4Q8H A;  3QT4 A;  1BP4 A;  3P5U A;  4YVA A;  1NPZ A;  3M99 A;  1XKG A;  1ATK A;  4KLB A;  1KHQ A;  2AYN A;  2E03 A;  4AXM A;  1U5I A;  1X9Y A;  1PE6 A;  1DEU A;  3GCB A;  1PPN A;  3BWK A;  3WXG A;  1AU3 A;  1GX3 A;  2FTD A;  2AS8 A;  4NV8 A;  4YV8 A;  2DZY A;  4P6G A;  2DC7 A;  2G8E A;  2Y5B A;  9PAP A;  1F2B A;  4YYQ A;  5CHT A;  3KX1 A;  1NQC A;  2YJ8 A;  1CV8 A;  1YVB A;  4QRX A;  3WXF A;  1ITO A;  3KFQ A;  3H8C A;  3RVX A;  3LFY A;  4PP2 E;  1W6F A;  1ZCM A;  2E00 A;  1CB5 A;  2VHS A;  2R9N A;  2FUD A;  1GMY A;  3O1G A;  3IMA A;  3KWB X;  2DC9 A;  4B55 A;  2VHF A;  2R9F A;  1AU2 A;  4QBB A;  1DF0 A;  3OVX A;  3HD3 A;  4OEM A;  2BSZ A;  3BC3 A;  3IEJ A;  1MDW A;  3RVV A;  1TL9 A;  4I04 A;  1VSN A;  2C0Y A;  4N8W A;  4NV7 A;  2R6N A;  1KHP A;  3OIS A;  4CZW A;  5F02 A;  1PAD A;  2YJB A;  3H7D A;  2G7Y A;  7PCK A;  4AXL A;  1Q6K A;  1K3B B;  4I05 A;  3D6S A;  2XU4 A;  5CHV A;  1EF7 A;  2AIM A;  2DZZ A;  1W4T A;  4C5P A;  1PPD A;  1YK8 A;  2YJC A;  3RVW A;  1GEC E;  2HH5 A;  4G54 A;  1E2T A;  3H6S A;  3KKU A;  3HWN A;  3P5X A;  3PNR A;  4CDE B;  1YAL A;  1MS6 A;  2CIO A;  3HHA A;  3PDF A;  4RY2 A;  2O6X A;  1AU0 A;  4MZS A;  5PAD A;  4OEL A;  1TLO A;  1AYW A;  4XR7 A;  2DC6 A;  2OUL A;  4BSQ A;  2VFB A;  3IV2 A;  2AUZ A;  1A6R A;  4YYU A;  3WXE A;  2GHU A;  1KXR A;  2AYO A;  4QH6 A;  2DJF B;  3MHS A;  5K16 A;  1M6D A;  2PAD A;  1BGO A;  4PP1 A;  3CH2 X;  4WA6 A;  1CS8 A;  1ZIV A;  1PCI A;  1F29 A;  1BQI A;  5EF4 A;  2ARY A;  1AU4 A;  2NQI A;  4MSX A;  4BS6 A;  2OZ2 A;  1AYU A;  1JQP A;  1BY8 A;  1EWL A;  4YYV A;  1CJL A;  1U9V A;  2NQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...