4BPVA

Mouse cathepsin s with covalent ligand
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
219
structure length
219
Chain Sequence
TLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKAMDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cathepsin S Nitrile Inhibitors
rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords CATHEPSIN S
total genus 68
structure length 219
sequence length 219
chains with identical sequence B, C, D, E, K
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2013-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4bpvA00
3HHAA 2FT2A 1AU4A 3IOQA 4X6IA 1O0EA 1U5IA 4CDFB 3IHPA 3KKUA 1A6RA 6PADA 2NQGA 4AXLA 3K8UA 1CJLA 1MHWA 1PXVA 2B1NA 3HHIA 1DEUA 2AIMA 3B79A 1NB5A 1MDWA 1CQDA 1BGOA 2R9NA 3IV2A 4K7CA 4N79A 1F2BA 2FRQA 4XUIA 2FO5A 3USVA 1GMYA 5EF4A 2XU5A 3IEJA 3N3KA 5J94A 3ERVA 3WXEA 1MEMA 2Y6EA 4BS6A 2PNSA 3MHSA 1TLOA 5CVMA 2AYOA 1Y4HA 1SP4B 2XU3A 3TNXA 1NPZA 4CZWA 2R9MA 2YJ2A 2AS8A 4PP2E 3IUTA 3PBHA 1STFE 2DCAA 4W5BA 2G6DA 1CPJA 2VHFA 3P5UA 4CDEB 4YYSA 2GFOA 4DMXA 3P5VA 1QDQA 3H8BA 1Y08A 5CVNB 2CIOA 5CHVA 3KSEA 3KWZA 3V6CA 3KWBX 4PADA 4BQVA 4YYWA 2P7UA 4DMYA 5FPWA 1Q6KA 4FJCA 4ZUXU 4FK5A 2Y5BA 2DJFB 1DF0A 1JQPA 1M6DA 3NHEA 4QH6A 1GCBA 2OP3A 4Q8GA 2PREA 1NB3A 1NLJA 2O6XA 2YJ8A 4I07A 1F2CA 3S3QA 3BCNA 2G8EA 2E02A 1AU3A 1AECA 3BWKA 3N4CA 3BPFA 3H7DA 1NQCA 1K3BB 1PCIA 3RVWA 4Q8HA 2DZZA 2R9OA 2E00A 3O0UA 2G7YA 3H8CA 4CDDB 3S3RA 1EWMA 1EWLA 1QOLA 4YVAA 1PPNA 5K16A 3I3TA 3RVXA 4PI3A 3HWNA 1ZCMA 3H6SA 2AVWA 1BP4A 3AI8A 3IMAA 3P5XA 1KFUL 4CDCB 3OF9A 1U9XA 2HHNA 3F5VA 1PBHA 1F29A 4XR7A 3K24A 3V6EA 4QRVA 1EWPA 3CH2X 2G8JA 1PE6A 1KHQA 1KFXL 3O1GA 2F7DA 3BPMA 1CTEA 2GHUA 4QRXA 2FQ9A 3CH3X 2YJBA 2DC9A 1U9QX 1IWDA 2XU1A 4PP1A 1KXRA 1MEGA 2OZ2A 3CBJA 1VJVA 3LXSA 2HD5A 2HXZA 3MHHA 1PPOA 1CV8A 4AXMA 3H89A 4KLBA 4HWYA 7PCKA 2JQFR 1HUCB 1FH0A 4BSQA 1YK7A 3I06A 2VHSA 4W4UA 5CHTA 1YT7A 3K9MA 5A24A 3GCBA 3QSDA 1PPPA 1YK8A 5PADA 2BDZA 1YVBA 2C0YA 1GLOA 2XU4A 3PW3A 2R9CA 1PADA 4N8WA 1TL9A 1ME3A 3QJ3A 1TU6A 3PDFA 2P0RA 8PCHA 3OF8A 1X9YA 3KFQA 2PADA 1S4VA 4P6GA 1GECE 2FYEA 1XKGA 3MTNA 3U8EA 2ACTA 1YALA 3N3GA 2IBIA 1QMYA 2H7JA 1AU2A 3C9EA 4OEMA 4BS5A 3E1ZB 3M99A 2AUZA 3P5WA 2NQIA 1F2AA 1AYUA 4QBBA 2F1GA 2P86A 1AYWA 1AIMA 4YYVA 4YYQA 9PAPA 1CSBB 4W5CA 2DCDA 2FUDA 1ICFA 4P6EA 2PBHA 4YV8A 4I05A 3F75A 3MORA 1AYVA 3CBKA 3WXGA 1ITOA 4MZOA 2DJGB 2DCBA 1AU0A 4G54A 5JA7A 2DC7A 4QRGA 1EWOA 1PPDA 2YJ9A 3RVVA 2DCCA 2AYNA 5EGWA 3OISA 1QXPA 2DC8A 5F02A 3LFYA 1POPA 2HH5A 3OVZA 1ZIVA 2AU1A 3WXFA 1ATKA 4N4ZA 3QT4A 2FTDA 4YYRA 3HD3A 2OULA 4BPVA 1MIRA 3D6SA 2ATOA 4FIPA 1U9WA 4YYUA 4OELA 4X6JA 5JH3A 4X6HA 3BC3A 3KX1A 4MSXA 1BQIA 2WBFX 1CVZA 2YJCA 3BOWA 1U9VA 2R9FA 2FRAA 2NQAA 2DZYA 1EF7A 2B1MA 2IPPB 3PNRA 2E03A 1CB5A 2R6NA 5CVOB 2E01A 2NQDB 4RY2A 2AUXA 1CS8A 1MS6A 2ARYA 1ME4A 2BDLA 1SNKA 2CB5A 3OVXA 1NL6A 1KHPA 2JQGR 4WA6A 1VSNA 4I04A 1THEA 2DC6A 3ZUAA 3DF0A 3KW9A 4MZSA 1BY8A 1PIPA
chains in the Genus database with same CATH superfamily
3HHAA 2FT2A 1AU4A 3IOQA 4X6IA 1O0EA 1U5IA 4CDFB 4A5UA 2BTWA 3IHPA 3KKUA 1A6RA 6PADA 2NQGA 4AXLA 3K8UA 2FE8A 1CJLA 1MHWA 1PXVA 3B21A 2B1NA 3HHIA 1DEUA 4RKXA 2AIMA 3B79A 3MTVA 1NB5A 5KO3A 3PHXA 4R3DA 1MDWA 3OQCA 1CQDA 1BGOA 2R9NA 3IFUA 3IV2A 4K7CA 4N79A 1F2BA 2FRQA 4XUIA 2FO5A 3USVA 1GMYA 5EF4A 2XU5A 3IEJA 3N3KA 5J94A 3ERVA 3PSEA 3WXEA 1MEMA 2Y6EA 3PRMA 4BS6A 2PNSA 3MHSA 1TLOA 5CVMA 2AYOA 4HXDB 1Y4HA 1SP4B 2XU3A 3TNXA 1NPZA 4CZWA 2R9MA 2YJ2A 2AS8A 4PP2E 3IUTA 3PBHA 1STFE 2DCAA 4D8EA 4W5BA 2G6DA 1CPJA 2VHFA 3P5UA 4CDEB 4YYSA 2GFOA 4DMXA 3P5VA 1QDQA 3H8BA 1Y08A 5CVNB 2CIOA 5CHVA 3KSEA 3KWZA 3V6CA 3KWBX 4PADA 4P16A 4BQVA 1PVJA 4YYWA 2P7UA 4DMYA 5FPWA 1Q6KA 4FJCA 4ZUXU 4FK5A 2Y5BA 2DJFB 1DF0A 1JQPA 1M6DA 3NHEA 4QH6A 1GCBA 2OP3A 4Q8GA 2PREA 1NB3A 1NLJA 2O6XA 2YJ8A 3PHWA 4I07A 1F2CA 3S3QA 3BCNA 2G8EA 2E02A 1AU3A 1AECA 3RNVA 3BWKA 4D8IA 3N4CA 3BPFA 5E6JA 3H7DA 1NQCA 1K3BB 1PCIA 3PRPA 3RVWA 4Q8HA 2DZZA 3BBAA 4ZTBA 3O65A 2R9OA 2E00A 3O0UA 3PT2A 2G7YA 5JZEA 3H8CA 4CDDB 3S3RA 1EWMA 1EWLA 4MI7A 1QOLA 4YVAA 1PPNA 5K16A 3I3TA 3RVXA 4PI3A 3HWNA 1ZCMA 3H6SA 2AVWA 1BP4A 3AI8A 2BU3A 3IMAA 4RF0A 3P5XA 1KFUL 4CDCB 4BOUA 1UKFA 3OF9A 1U9XA 2HHNA 3F5VA 1PBHA 4PT5A 1F29A 4XR7A 3K24A 4QRVA 3V6EA 3ZNHA 1EWPA 4M0WA 3CH2X 2G8JA 1PIPA 5EZSA 4BOZA 1PE6A 1KHQA 1KFXL 5EZQA 3O1GA 2F7DA 3BPMA 1CTEA 2GHUA 4QRXA 1YZBA 2FQ9A 2BTWB 3CH3X 2DOSA 2DC9A 2YJBA 2AGAA 1U9QX 1IWDA 2XU1A 4PP1A 1KXRA 2J7QA 1MEGA 2OZ2A 3CBJA 1VJVA 3LXSA 2HD5A 2JRIA 2HXZA 3MHHA 3TRKA 1PPOA 1CV8A 4AXMA 3H89A 4D8BA 4KLBA 4HWYA 7PCKA 2JQFR 1HUCB 1FH0A 4BSQA 4RF1A 1YK7A 3I06A 2VHSA 4W4UA 5CHTA 1YT7A 3K9MA 5A24A 3GCBA 3QSDA 4BOPA 1PPPA 4WURA 1YK8A 5PADA 2BDZA 2Z84A 4OW0A 1YVBA 2C0YA 1GLOA 2XU4A 3PW3A 2R9CA 1PADA 4N8WA 1TL9A 1ME3A 3QJ3A 1TU6A 3BY4A 3PDFA 2P0RA 1DKIA 8PCHA 3OF8A 1X9YA 3KFQA 2PADA 3W30A 4BOQA 1S4VA 3MP2A 4P6GA 1GECE 2FYEA 3W31A 1XKGA 3MTNA 3U8EA 2ACTA 4OVZA 4RNAA 1YALA 2UZJA 3N3GA 2IBIA 1QMYA 2H7JA 1AU2A 3C9EA 4OEMA 4BS5A 3E1ZB 3M99A 2AUZA 3P5WA 2NQIA 1F2AA 1AYUA 4QBBA 2F1GA 2P86A 1AYWA 1AIMA 4YYVA 4YYQA 9PAPA 1CSBB 4W5CA 2DCDA 2JTCA 2FUDA 1ICFA 4P6EA 2PBHA 3E9SA 4YV8A 4I05A 3F75A 3MORA 4REZA 1AYVA 3CBKA 3WXGA 1ITOA 4MZOA 2DJGB 3PHUA 2DCBA 1AU0A 4G54A 5JA7A 2DC7A 4XZXA 4QRGA 1EWOA 1PPDA 2YJ9A 3RVVA 2DCCA 3TMPA 2AYNA 5EGWA 3OISA 1QXPA 2DC8A 5F02A 3LFYA 1POPA 2HH5A 3MJ5A 3OVZA 1ZIVA 3C0RA 2AU1A 4MM3B 4GUAA 3WXFA 1ATKA 4N4ZA 4IUMA 3QT4A 2FTDA 4YYRA 3HD3A 2OULA 4BPVA 1MIRA 3D6SA 2ATOA 4FIPA 1U9WA 4YYUA 4OELA 4X6JA 5JH3A 4X6HA 3BC3A 3KX1A 4MSXA 1BQIA 2WBFX 1CVZA 2YJCA 3BOWA 4OVZB 1U9VA 2R9FA 2FRAA 2NQAA 2DZYA 1EF7A 2B1MA 2IPPB 3PNRA 2E03A 1CB5A 2R6NA 5CVOB 2E01A 2NQDB 4RY2A 2AUXA 1CS8A 1MS6A 2ARYA 1ME4A 2BDLA 1SNKA 2CB5A 3OVXA 4BOSA 1NL6A 1KHPA 2JQGR 4WA6A 4IP3A 1VSNA 2HWKA 4I04A 1THEA 2DC6A 3ZUAA 2J7QC 3DF0A 3KW9A 4MZSA 1BY8A 3BB7A
chains in the Genus database with same CATH topology
3HHAA 2FT2A 1AU4A 3IOQA 4X6IA 1O0EA 1U5IA 4CDFB 3IHPA 3KKUA 1A6RA 6PADA 2NQGA 4AXLA 3K8UA 1CJLA 1MHWA 1PXVA 2B1NA 3HHIA 1DEUA 2AIMA 3B79A 1NB5A 1MDWA 1CQDA 1BGOA 4GUZA 2R9NA 3IV2A 4K7CA 4N79A 1F2BA 2FRQA 4XUIA 2FO5A 3USVA 1GMYA 5EF4A 2XU5A 3IEJA 2BSZA 3N3KA 5J94A 3ERVA 3WXEA 1MEMA 2Y6EA 4BS6A 2PNSA 3MHSA 1TLOA 5CVMA 4BGFA 2AYOA 1Y4HA 1SP4B 2XU3A 3TNXA 1NPZA 4CZWA 2R9MA 2YJ2A 2AS8A 4PP2E 3IUTA 3PBHA 1STFE 2DCAA 4W5BA 2G6DA 1CPJA 2VHFA 3P5UA 4CDEB 4YYSA 2GFOA 4DMXA 3P5VA 1QDQA 3H8BA 1Y08A 5CVNB 2CIOA 5CHVA 3KSEA 3KWZA 3V6CA 3KWBX 4PADA 4BQVA 4YYWA 2P7UA 4DMYA 5FPWA 1Q6KA 4FJCA 4NV8A 4ZUXU 4FK5A 2Y5BA 2DJFB 1DF0A 1JQPA 1M6DA 3NHEA 4QH6A 1GCBA 2OP3A 4Q8GA 2PREA 1NB3A 1NLJA 2O6XA 2YJ8A 4I07A 1F2CA 3S3QA 3BCNA 2G8EA 2E02A 1AU3A 1AECA 3BWKA 3N4CA 3BPFA 3H7DA 1NQCA 1K3BB 1PCIA 3RVWA 4Q8HA 2DZZA 2R9OA 2E00A 1E2TA 3O0UA 2G7YA 3H8CA 4CDDB 3S3RA 1EWMA 1EWLA 1QOLA 1W4TA 4YVAA 1PPNA 5K16A 3I3TA 3RVXA 4PI3A 3HWNA 1ZCMA 3H6SA 2AVWA 1BP4A 3AI8A 3IMAA 3P5XA 1KFUL 4B55A 4CDCB 3OF9A 1U9XA 2HHNA 3F5VA 1PBHA 1F29A 4XR7A 1GX3A 3K24A 4QRVA 3V6EA 1EWPA 3CH2X 2G8JA 1PE6A 1KHQA 1KFXL 4C5PA 3O1GA 2F7DA 3BPMA 1CTEA 2GHUA 4QRXA 2FQ9A 3CH3X 2YJBA 2DC9A 1U9QX 1IWDA 2XU1A 3LTWA 4PP1A 1KXRA 1MEGA 2OZ2A 3CBJA 1VJVA 3LXSA 2HD5A 2HXZA 3MHHA 1PPOA 1CV8A 4AXMA 3H89A 4KLBA 4HWYA 7PCKA 2JQFR 1HUCB 1FH0A 4BSQA 1YK7A 3I06A 2VHSA 4W4UA 5CHTA 1YT7A 3K9MA 5A24A 3GCBA 3QSDA 1PPPA 1YK8A 5PADA 2BDZA 2VFBA 3D9WA 1YVBA 2C0YA 1GLOA 2XU4A 3PW3A 2R9CA 1PADA 4N8WA 1TL9A 1ME3A 3QJ3A 1TU6A 3PDFA 2P0RA 8PCHA 3OF8A 1X9YA 3KFQA 2PADA 1S4VA 4P6GA 1GECE 2FYEA 1W6FA 1XKGA 3MTNA 3U8EA 2ACTA 1YALA 3N3GA 2IBIA 1QMYA 2H7JA 1AU2A 3C9EA 4OEMA 4BS5A 3E1ZB 3M99A 2AUZA 3P5WA 2NQIA 1F2AA 1AYUA 4QBBA 2F1GA 2P86A 1AYWA 1AIMA 4YYVA 4YYQA 9PAPA 1CSBB 4NV7A 4W5CA 2DCDA 2FUDA 1ICFA 4P6EA 2PBHA 4YV8A 4I05A 3F75A 3MORA 1AYVA 3CBKA 3WXGA 1ITOA 4MZOA 2DJGB 2DCBA 1AU0A 4G54A 5JA7A 2DC7A 4QRGA 2VFCA 1EWOA 1PPDA 2YJ9A 3RVVA 2DCCA 2AYNA 5EGWA 3OISA 1QXPA 2DC8A 5F02A 3LFYA 1POPA 2HH5A 3OVZA 1ZIVA 2AU1A 3WXFA 1ATKA 4N4ZA 3QT4A 2FTDA 4YYRA 3HD3A 2OULA 4BPVA 1MIRA 3D6SA 2ATOA 4FIPA 1U9WA 4YYUA 4OELA 4X6JA 5JH3A 4X6HA 3BC3A 3KX1A 4MSXA 1BQIA 2WBFX 1CVZA 2YJCA 3BOWA 1U9VA 2R9FA 2FRAA 2NQAA 2DZYA 1EF7A 2B1MA 1W5RA 2IPPB 3PNRA 2E03A 1CB5A 2R6NA 5CVOB 2E01A 2NQDB 4RY2A 2AUXA 1CS8A 1MS6A 2ARYA 1ME4A 2BDLA 1SNKA 2CB5A 3OVXA 1NL6A 1KHPA 2JQGR 4WA6A 1VSNA 4I04A 1THEA 2DC6A 3ZUAA 3DF0A 3KW9A 4MZSA 1BY8A 1PIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HHA A;  2FT2 A;  1AU4 A;  3IOQ A;  4X6I A;  1O0E A;  1U5I A;  4CDF B;  3IHP A;  3KKU A;  1A6R A;  6PAD A;  2NQG A;  4AXL A;  3K8U A;  1CJL A;  1MHW A;  1PXV A;  2B1N A;  3HHI A;  1DEU A;  2AIM A;  3B79 A;  1NB5 A;  1MDW A;  1CQD A;  1BGO A;  2R9N A;  3IV2 A;  4K7C A;  4N79 A;  1F2B A;  2FRQ A;  4XUI A;  2FO5 A;  3USV A;  1GMY A;  5EF4 A;  2XU5 A;  3IEJ A;  3N3K A;  5J94 A;  3ERV A;  3WXE A;  1MEM A;  2Y6E A;  4BS6 A;  2PNS A;  3MHS A;  1TLO A;  5CVM A;  2AYO A;  1Y4H A;  1SP4 B;  2XU3 A;  3TNX A;  1NPZ A;  4CZW A;  2R9M A;  2YJ2 A;  2AS8 A;  4PP2 E;  3IUT A;  3PBH A;  1STF E;  2DCA A;  4W5B A;  2G6D A;  1CPJ A;  2VHF A;  3P5U A;  4CDE B;  4YYS A;  2GFO A;  4DMX A;  3P5V A;  1QDQ A;  3H8B A;  1Y08 A;  5CVN B;  2CIO A;  5CHV A;  3KSE A;  3KWZ A;  3V6C A;  3KWB X;  4PAD A;  4BQV A;  4YYW A;  2P7U A;  4DMY A;  5FPW A;  1Q6K A;  4FJC A;  4ZUX U;  4FK5 A;  2Y5B A;  2DJF B;  1DF0 A;  1JQP A;  1M6D A;  3NHE A;  4QH6 A;  1GCB A;  2OP3 A;  4Q8G A;  2PRE A;  1NB3 A;  1NLJ A;  2O6X A;  2YJ8 A;  4I07 A;  1F2C A;  3S3Q A;  3BCN A;  2G8E A;  2E02 A;  1AU3 A;  1AEC A;  3BWK A;  3N4C A;  3BPF A;  3H7D A;  1NQC A;  1K3B B;  1PCI A;  3RVW A;  4Q8H A;  2DZZ A;  2R9O A;  2E00 A;  3O0U A;  2G7Y A;  3H8C A;  4CDD B;  3S3R A;  1EWM A;  1EWL A;  1QOL A;  4YVA A;  1PPN A;  5K16 A;  3I3T A;  3RVX A;  4PI3 A;  3HWN A;  1ZCM A;  3H6S A;  2AVW A;  1BP4 A;  3AI8 A;  3IMA A;  3P5X A;  1KFU L;  4CDC B;  3OF9 A;  1U9X A;  2HHN A;  3F5V A;  1PBH A;  1F29 A;  4XR7 A;  3K24 A;  3V6E A;  4QRV A;  1EWP A;  3CH2 X;  2G8J A;  1PE6 A;  1KHQ A;  1KFX L;  3O1G A;  2F7D A;  3BPM A;  1CTE A;  2GHU A;  4QRX A;  2FQ9 A;  3CH3 X;  2YJB A;  2DC9 A;  1U9Q X;  1IWD A;  2XU1 A;  4PP1 A;  1KXR A;  1MEG A;  2OZ2 A;  3CBJ A;  1VJV A;  3LXS A;  2HD5 A;  2HXZ A;  3MHH A;  1PPO A;  1CV8 A;  4AXM A;  3H89 A;  4KLB A;  4HWY A;  7PCK A;  2JQF R;  1HUC B;  1FH0 A;  4BSQ A;  1YK7 A;  3I06 A;  2VHS A;  4W4U A;  5CHT A;  1YT7 A;  3K9M A;  5A24 A;  3GCB A;  3QSD A;  1PPP A;  1YK8 A;  5PAD A;  2BDZ A;  1YVB A;  2C0Y A;  1GLO A;  2XU4 A;  3PW3 A;  2R9C A;  1PAD A;  4N8W A;  1TL9 A;  1ME3 A;  3QJ3 A;  1TU6 A;  3PDF A;  2P0R A;  8PCH A;  3OF8 A;  1X9Y A;  3KFQ A;  2PAD A;  1S4V A;  4P6G A;  1GEC E;  2FYE A;  1XKG A;  3MTN A;  3U8E A;  2ACT A;  1YAL A;  3N3G A;  2IBI A;  1QMY A;  2H7J A;  1AU2 A;  3C9E A;  4OEM A;  4BS5 A;  3E1Z B;  3M99 A;  2AUZ A;  3P5W A;  2NQI A;  1F2A A;  1AYU A;  4QBB A;  2F1G A;  2P86 A;  1AYW A;  1AIM A;  4YYV A;  4YYQ A;  9PAP A;  1CSB B;  4W5C A;  2DCD A;  2FUD A;  1ICF A;  4P6E A;  2PBH A;  4YV8 A;  4I05 A;  3F75 A;  3MOR A;  1AYV A;  3CBK A;  3WXG A;  1ITO A;  4MZO A;  2DJG B;  2DCB A;  1AU0 A;  4G54 A;  5JA7 A;  2DC7 A;  4QRG A;  1EWO A;  1PPD A;  2YJ9 A;  3RVV A;  2DCC A;  2AYN A;  5EGW A;  3OIS A;  1QXP A;  2DC8 A;  5F02 A;  3LFY A;  1POP A;  2HH5 A;  3OVZ A;  1ZIV A;  2AU1 A;  3WXF A;  1ATK A;  4N4Z A;  3QT4 A;  2FTD A;  4YYR A;  3HD3 A;  2OUL A;  4BPV A;  1MIR A;  3D6S A;  2ATO A;  4FIP A;  1U9W A;  4YYU A;  4OEL A;  4X6J A;  5JH3 A;  4X6H A;  3BC3 A;  3KX1 A;  4MSX A;  1BQI A;  2WBF X;  1CVZ A;  2YJC A;  3BOW A;  1U9V A;  2R9F A;  2FRA A;  2NQA A;  2DZY A;  1EF7 A;  2B1M A;  2IPP B;  3PNR A;  2E03 A;  1CB5 A;  2R6N A;  5CVO B;  2E01 A;  2NQD B;  4RY2 A;  2AUX A;  1CS8 A;  1MS6 A;  2ARY A;  1ME4 A;  2BDL A;  1SNK A;  2CB5 A;  3OVX A;  1NL6 A;  1KHP A;  2JQG R;  4WA6 A;  1VSN A;  4I04 A;  1THE A;  2DC6 A;  3ZUA A;  3DF0 A;  3KW9 A;  4MZS A;  1BY8 A;  1PIP A; 
#chains in the Genus database with same CATH topology
 3HHA A;  2FT2 A;  1AU4 A;  3IOQ A;  4X6I A;  1O0E A;  1U5I A;  4CDF B;  4A5U A;  2BTW A;  3IHP A;  3KKU A;  1A6R A;  6PAD A;  2NQG A;  4AXL A;  3K8U A;  2FE8 A;  1CJL A;  1MHW A;  1PXV A;  3B21 A;  2B1N A;  3HHI A;  1DEU A;  4RKX A;  2AIM A;  3B79 A;  3MTV A;  1NB5 A;  5KO3 A;  3PHX A;  4R3D A;  1MDW A;  3OQC A;  1CQD A;  1BGO A;  2R9N A;  3IFU A;  3IV2 A;  4K7C A;  4N79 A;  1F2B A;  2FRQ A;  4XUI A;  2FO5 A;  3USV A;  1GMY A;  5EF4 A;  2XU5 A;  3IEJ A;  3N3K A;  5J94 A;  3ERV A;  3PSE A;  3WXE A;  1MEM A;  2Y6E A;  3PRM A;  4BS6 A;  2PNS A;  3MHS A;  1TLO A;  5CVM A;  2AYO A;  4HXD B;  1Y4H A;  1SP4 B;  2XU3 A;  3TNX A;  1NPZ A;  4CZW A;  2R9M A;  2YJ2 A;  2AS8 A;  4PP2 E;  3IUT A;  3PBH A;  1STF E;  2DCA A;  4D8E A;  4W5B A;  2G6D A;  1CPJ A;  2VHF A;  3P5U A;  4CDE B;  4YYS A;  2GFO A;  4DMX A;  3P5V A;  1QDQ A;  3H8B A;  1Y08 A;  5CVN B;  2CIO A;  5CHV A;  3KSE A;  3KWZ A;  3V6C A;  3KWB X;  4PAD A;  4P16 A;  4BQV A;  1PVJ A;  4YYW A;  2P7U A;  4DMY A;  5FPW A;  1Q6K A;  4FJC A;  4ZUX U;  4FK5 A;  2Y5B A;  2DJF B;  1DF0 A;  1JQP A;  1M6D A;  3NHE A;  4QH6 A;  1GCB A;  2OP3 A;  4Q8G A;  2PRE A;  1NB3 A;  1NLJ A;  2O6X A;  2YJ8 A;  3PHW A;  4I07 A;  1F2C A;  3S3Q A;  3BCN A;  2G8E A;  2E02 A;  1AU3 A;  1AEC A;  3RNV A;  3BWK A;  4D8I A;  3N4C A;  3BPF A;  5E6J A;  3H7D A;  1NQC A;  1K3B B;  1PCI A;  3PRP A;  3RVW A;  4Q8H A;  2DZZ A;  3BBA A;  4ZTB A;  3O65 A;  2R9O A;  2E00 A;  3O0U A;  3PT2 A;  2G7Y A;  5JZE A;  3H8C A;  4CDD B;  3S3R A;  1EWM A;  1EWL A;  4MI7 A;  1QOL A;  4YVA A;  1PPN A;  5K16 A;  3I3T A;  3RVX A;  4PI3 A;  3HWN A;  1ZCM A;  3H6S A;  2AVW A;  1BP4 A;  3AI8 A;  2BU3 A;  3IMA A;  4RF0 A;  3P5X A;  1KFU L;  4CDC B;  4BOU A;  1UKF A;  3OF9 A;  1U9X A;  2HHN A;  3F5V A;  1PBH A;  4PT5 A;  1F29 A;  4XR7 A;  3K24 A;  4QRV A;  3V6E A;  3ZNH A;  1EWP A;  4M0W A;  3CH2 X;  2G8J A;  1PIP A;  5EZS A;  4BOZ A;  1PE6 A;  1KHQ A;  1KFX L;  5EZQ A;  3O1G A;  2F7D A;  3BPM A;  1CTE A;  2GHU A;  4QRX A;  1YZB A;  2FQ9 A;  2BTW B;  3CH3 X;  2DOS A;  2DC9 A;  2YJB A;  2AGA A;  1U9Q X;  1IWD A;  2XU1 A;  4PP1 A;  1KXR A;  2J7Q A;  1MEG A;  2OZ2 A;  3CBJ A;  1VJV A;  3LXS A;  2HD5 A;  2JRI A;  2HXZ A;  3MHH A;  3TRK A;  1PPO A;  1CV8 A;  4AXM A;  3H89 A;  4D8B A;  4KLB A;  4HWY A;  7PCK A;  2JQF R;  1HUC B;  1FH0 A;  4BSQ A;  4RF1 A;  1YK7 A;  3I06 A;  2VHS A;  4W4U A;  5CHT A;  1YT7 A;  3K9M A;  5A24 A;  3GCB A;  3QSD A;  4BOP A;  1PPP A;  4WUR A;  1YK8 A;  5PAD A;  2BDZ A;  2Z84 A;  4OW0 A;  1YVB A;  2C0Y A;  1GLO A;  2XU4 A;  3PW3 A;  2R9C A;  1PAD A;  4N8W A;  1TL9 A;  1ME3 A;  3QJ3 A;  1TU6 A;  3BY4 A;  3PDF A;  2P0R A;  1DKI A;  8PCH A;  3OF8 A;  1X9Y A;  3KFQ A;  2PAD A;  3W30 A;  4BOQ A;  1S4V A;  3MP2 A;  4P6G A;  1GEC E;  2FYE A;  3W31 A;  1XKG A;  3MTN A;  3U8E A;  2ACT A;  4OVZ A;  4RNA A;  1YAL A;  2UZJ A;  3N3G A;  2IBI A;  1QMY A;  2H7J A;  1AU2 A;  3C9E A;  4OEM A;  4BS5 A;  3E1Z B;  3M99 A;  2AUZ A;  3P5W A;  2NQI A;  1F2A A;  1AYU A;  4QBB A;  2F1G A;  2P86 A;  1AYW A;  1AIM A;  4YYV A;  4YYQ A;  9PAP A;  1CSB B;  4W5C A;  2DCD A;  2JTC A;  2FUD A;  1ICF A;  4P6E A;  2PBH A;  3E9S A;  4YV8 A;  4I05 A;  3F75 A;  3MOR A;  4REZ A;  1AYV A;  3CBK A;  3WXG A;  1ITO A;  4MZO A;  2DJG B;  3PHU A;  2DCB A;  1AU0 A;  4G54 A;  5JA7 A;  2DC7 A;  4XZX A;  4QRG A;  1EWO A;  1PPD A;  2YJ9 A;  3RVV A;  2DCC A;  3TMP A;  2AYN A;  5EGW A;  3OIS A;  1QXP A;  2DC8 A;  5F02 A;  3LFY A;  1POP A;  2HH5 A;  3MJ5 A;  3OVZ A;  1ZIV A;  3C0R A;  2AU1 A;  4MM3 B;  4GUA A;  3WXF A;  1ATK A;  4N4Z A;  4IUM A;  3QT4 A;  2FTD A;  4YYR A;  3HD3 A;  2OUL A;  4BPV A;  1MIR A;  3D6S A;  2ATO A;  4FIP A;  1U9W A;  4YYU A;  4OEL A;  4X6J A;  5JH3 A;  4X6H A;  3BC3 A;  3KX1 A;  4MSX A;  1BQI A;  2WBF X;  1CVZ A;  2YJC A;  3BOW A;  4OVZ B;  1U9V A;  2R9F A;  2FRA A;  2NQA A;  2DZY A;  1EF7 A;  2B1M A;  2IPP B;  3PNR A;  2E03 A;  1CB5 A;  2R6N A;  5CVO B;  2E01 A;  2NQD B;  4RY2 A;  2AUX A;  1CS8 A;  1MS6 A;  2ARY A;  1ME4 A;  2BDL A;  1SNK A;  2CB5 A;  3OVX A;  4BOS A;  1NL6 A;  1KHP A;  2JQG R;  4WA6 A;  4IP3 A;  1VSN A;  2HWK A;  4I04 A;  1THE A;  2DC6 A;  3ZUA A;  2J7Q C;  3DF0 A;  3KW9 A;  4MZS A;  1BY8 A;  3BB7 A; 
#chains in the Genus database with same CATH homology
 3HHA A;  2FT2 A;  1AU4 A;  3IOQ A;  4X6I A;  1O0E A;  1U5I A;  4CDF B;  3IHP A;  3KKU A;  1A6R A;  6PAD A;  2NQG A;  4AXL A;  3K8U A;  1CJL A;  1MHW A;  1PXV A;  2B1N A;  3HHI A;  1DEU A;  2AIM A;  3B79 A;  1NB5 A;  1MDW A;  1CQD A;  1BGO A;  4GUZ A;  2R9N A;  3IV2 A;  4K7C A;  4N79 A;  1F2B A;  2FRQ A;  4XUI A;  2FO5 A;  3USV A;  1GMY A;  5EF4 A;  2XU5 A;  3IEJ A;  2BSZ A;  3N3K A;  5J94 A;  3ERV A;  3WXE A;  1MEM A;  2Y6E A;  4BS6 A;  2PNS A;  3MHS A;  1TLO A;  5CVM A;  4BGF A;  2AYO A;  1Y4H A;  1SP4 B;  2XU3 A;  3TNX A;  1NPZ A;  4CZW A;  2R9M A;  2YJ2 A;  2AS8 A;  4PP2 E;  3IUT A;  3PBH A;  1STF E;  2DCA A;  4W5B A;  2G6D A;  1CPJ A;  2VHF A;  3P5U A;  4CDE B;  4YYS A;  2GFO A;  4DMX A;  3P5V A;  1QDQ A;  3H8B A;  1Y08 A;  5CVN B;  2CIO A;  5CHV A;  3KSE A;  3KWZ A;  3V6C A;  3KWB X;  4PAD A;  4BQV A;  4YYW A;  2P7U A;  4DMY A;  5FPW A;  1Q6K A;  4FJC A;  4NV8 A;  4ZUX U;  4FK5 A;  2Y5B A;  2DJF B;  1DF0 A;  1JQP A;  1M6D A;  3NHE A;  4QH6 A;  1GCB A;  2OP3 A;  4Q8G A;  2PRE A;  1NB3 A;  1NLJ A;  2O6X A;  2YJ8 A;  4I07 A;  1F2C A;  3S3Q A;  3BCN A;  2G8E A;  2E02 A;  1AU3 A;  1AEC A;  3BWK A;  3N4C A;  3BPF A;  3H7D A;  1NQC A;  1K3B B;  1PCI A;  3RVW A;  4Q8H A;  2DZZ A;  2R9O A;  2E00 A;  1E2T A;  3O0U A;  2G7Y A;  3H8C A;  4CDD B;  3S3R A;  1EWM A;  1EWL A;  1QOL A;  1W4T A;  4YVA A;  1PPN A;  5K16 A;  3I3T A;  3RVX A;  4PI3 A;  3HWN A;  1ZCM A;  3H6S A;  2AVW A;  1BP4 A;  3AI8 A;  3IMA A;  3P5X A;  1KFU L;  4B55 A;  4CDC B;  3OF9 A;  1U9X A;  2HHN A;  3F5V A;  1PBH A;  1F29 A;  4XR7 A;  1GX3 A;  3K24 A;  4QRV A;  3V6E A;  1EWP A;  3CH2 X;  2G8J A;  1PE6 A;  1KHQ A;  1KFX L;  4C5P A;  3O1G A;  2F7D A;  3BPM A;  1CTE A;  2GHU A;  4QRX A;  2FQ9 A;  3CH3 X;  2YJB A;  2DC9 A;  1U9Q X;  1IWD A;  2XU1 A;  3LTW A;  4PP1 A;  1KXR A;  1MEG A;  2OZ2 A;  3CBJ A;  1VJV A;  3LXS A;  2HD5 A;  2HXZ A;  3MHH A;  1PPO A;  1CV8 A;  4AXM A;  3H89 A;  4KLB A;  4HWY A;  7PCK A;  2JQF R;  1HUC B;  1FH0 A;  4BSQ A;  1YK7 A;  3I06 A;  2VHS A;  4W4U A;  5CHT A;  1YT7 A;  3K9M A;  5A24 A;  3GCB A;  3QSD A;  1PPP A;  1YK8 A;  5PAD A;  2BDZ A;  2VFB A;  3D9W A;  1YVB A;  2C0Y A;  1GLO A;  2XU4 A;  3PW3 A;  2R9C A;  1PAD A;  4N8W A;  1TL9 A;  1ME3 A;  3QJ3 A;  1TU6 A;  3PDF A;  2P0R A;  8PCH A;  3OF8 A;  1X9Y A;  3KFQ A;  2PAD A;  1S4V A;  4P6G A;  1GEC E;  2FYE A;  1W6F A;  1XKG A;  3MTN A;  3U8E A;  2ACT A;  1YAL A;  3N3G A;  2IBI A;  1QMY A;  2H7J A;  1AU2 A;  3C9E A;  4OEM A;  4BS5 A;  3E1Z B;  3M99 A;  2AUZ A;  3P5W A;  2NQI A;  1F2A A;  1AYU A;  4QBB A;  2F1G A;  2P86 A;  1AYW A;  1AIM A;  4YYV A;  4YYQ A;  9PAP A;  1CSB B;  4NV7 A;  4W5C A;  2DCD A;  2FUD A;  1ICF A;  4P6E A;  2PBH A;  4YV8 A;  4I05 A;  3F75 A;  3MOR A;  1AYV A;  3CBK A;  3WXG A;  1ITO A;  4MZO A;  2DJG B;  2DCB A;  1AU0 A;  4G54 A;  5JA7 A;  2DC7 A;  4QRG A;  2VFC A;  1EWO A;  1PPD A;  2YJ9 A;  3RVV A;  2DCC A;  2AYN A;  5EGW A;  3OIS A;  1QXP A;  2DC8 A;  5F02 A;  3LFY A;  1POP A;  2HH5 A;  3OVZ A;  1ZIV A;  2AU1 A;  3WXF A;  1ATK A;  4N4Z A;  3QT4 A;  2FTD A;  4YYR A;  3HD3 A;  2OUL A;  4BPV A;  1MIR A;  3D6S A;  2ATO A;  4FIP A;  1U9W A;  4YYU A;  4OEL A;  4X6J A;  5JH3 A;  4X6H A;  3BC3 A;  3KX1 A;  4MSX A;  1BQI A;  2WBF X;  1CVZ A;  2YJC A;  3BOW A;  1U9V A;  2R9F A;  2FRA A;  2NQA A;  2DZY A;  1EF7 A;  2B1M A;  1W5R A;  2IPP B;  3PNR A;  2E03 A;  1CB5 A;  2R6N A;  5CVO B;  2E01 A;  2NQD B;  4RY2 A;  2AUX A;  1CS8 A;  1MS6 A;  2ARY A;  1ME4 A;  2BDL A;  1SNK A;  2CB5 A;  3OVX A;  1NL6 A;  1KHP A;  2JQG R;  4WA6 A;  1VSN A;  4I04 A;  1THE A;  2DC6 A;  3ZUA A;  3DF0 A;  3KW9 A;  4MZS A;  1BY8 A;  1PIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...