4BPVA

Mouse cathepsin s with covalent ligand
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
219
structure length
219
Chain Sequence
b'TLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKAMDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN S
publication title Cathepsin S Nitrile Inhibitors
rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 68
structure length 219
sequence length 219
chains with identical sequence B, C, D, E, K
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2013-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4bpvA00
3IV2A 4QRXA 3I3TA 1GECE 1CQDA 4YYRA 3BPFA 3IHPA 2P7UA 2AYNA 4N8WA 3ERVA 1KFXL 3H8BA 1CTEA 2HHNA 2HD5A 3IEJA 2AUXA 4X6HA 1MDWA 2ATOA 1VJVA 4AXLA 4CDDB 4YYQA 2O6XA 2DJGB 3H89A 1F29A 4BPVA 3M99A 2FRAA 1CB5A 3OF9A 4OELA 3V6CA 1XKGA 1EWLA 1KXRA 2DZYA 3PDFA 3PBHA 3CBJA 2P86A 4BS6A 1PPOA 3MORA 1MEGA 3B79A 3CH3X 8PCHA 3K8UA 2P0RA 2G7YA 3RVXA 3RVWA 3U8EA 1U9XA 4CDCB 2E03A 2OP3A 1GLOA 3OVXA 3WXEA 4ZUXU 2FQ9A 3QJ3A 2AS8A 2ACTA 2AU1A 2R9FA 4BQVA 1KFUL 3WXGA 1ZIVA 4WA6A 4CZWA 4N4ZA 2GFOA 3F5VA 2XU5A 1O0EA 1M6DA 2B1MA 1PADA 3GCBA 3HHIA 1FH0A 3O1GA 2Y5BA 2E01A 1ITOA 5A24A 2YJCA 2PADA 2IPPB 4PADA 4P6EA 1VSNA 1CJLA 1NL6A 4QRGA 3P5XA 1K3BB 1X9YA 4P6GA 2FRQA 3MHHA 1GMYA 3PNRA 4DMXA 4BSQA 1YK7A 1BGOA 5JH3A 4YYWA 1PE6A 4XR7A 1PIPA 1GCBA 1F2AA 1THEA 1IWDA 4YYSA 4YYUA 1YALA 2PNSA 2G6DA 1U5IA 1ZCMA 3KFQA 3O0UA 1AU2A 1MHWA 3USVA 2F1GA 1AECA 1DF0A 4I05A 1PPDA 1EWPA 3BOWA 1BP4A 5JA7A 2CB5A 3NHEA 4W4UA 2DC8A 1ME3A 3KKUA 4PP1A 3OF8A 6PADA 4N79A 4QH6A 4QBBA 2GHUA 2VHSA 2XU4A 4YV8A 1YK8A 1MIRA 3V6EA 5EGWA 1ME4A 4Q8HA 3IOQA 4X6JA 4OEMA 1BY8A 2FUDA 1POPA 4HWYA 2C0YA 3LXSA 2NQDB 1EWOA 1QMYA 4PI3A 1A6RA 3DF0A 4I07A 3K9MA 1QXPA 3QT4A 4YVAA 3K24A 3I06A 3RVVA 3HD3A 4I04A 1NPZA 2JQGR 2DC9A 4G54A 2DCCA 4X6IA 2R9NA 5FPWA 2VHFA 3BPMA 3AI8A 1NB3A 1CPJA 2AYOA 1CS8A 3BC3A 3HWNA 3P5UA 2JQFR 3KWBX 2BDZA 3KSEA 3P5VA 2DC7A 3H6SA 3OVZA 5CHVA 1JQPA 3OISA 4FJCA 4YYVA 2BDLA 3HHAA 2NQIA 1YVBA 2G8JA 1DEUA 1PCIA 3IMAA 2DCDA 1SNKA 5CHTA 1U9VA 4MSXA 3KX1A 4FIPA 2NQGA 1MEMA 3S3RA 1F2CA 1SP4B 4BS5A 3LFYA 1AYWA 2FYEA 3D6SA 3WXFA 2DZZA 2WBFX 3E1ZB 1CVZA 2FO5A 4RY2A 4DMYA 4CDEB 1BQIA 3CH2X 1U9QX 2DJFB 2YJBA 3CBKA 2AIMA 1AU3A 7PCKA 2AVWA 3N4CA 5EF4A 3C9EA 3H8CA 3N3GA 4Q8GA 1KHQA 2HXZA 5J94A 1HUCB 3KWZA 2DCBA 2YJ8A 1CV8A 5CVNB 1S4VA 2E00A 3BCNA 4W5CA 1AU4A 2OZ2A 1ICFA 5F02A 2HH5A 1ATKA 2R9MA 4XUIA 2AUZA 2Y6EA 2IBIA 2CIOA 4KLBA 5K16A 1AIMA 1TL9A 1U9WA 1QOLA 5PADA 2PREA 3QSDA 3ZUAA 2R9CA 4FK5A 1AYUA 3PW3A 1PPPA 2DC6A 9PAPA 5CVMA 1AYVA 2NQAA 3TNXA 1EF7A 2DCAA 1Q6KA 2F7DA 2H7JA 1F2BA 2YJ2A 1MS6A 3H7DA 1AU0A 3N3KA 1KHPA 1EWMA 2XU1A 2PBHA 4MZSA 2YJ9A 4PP2E 2R9OA 3BWKA 1QDQA 4W5BA 3IUTA 3MHSA 3S3QA 2FTDA 3F75A 2OULA 4CDFB 4AXMA 1Y08A 1NQCA 3P5WA 1STFE 1TLOA 2B1NA 1YT7A 2G8EA 1NB5A 1PXVA 2R6NA 1PBHA 1Y4HA 5CVOB 1PPNA 3MTNA 4K7CA 1CSBB 1TU6A 3KW9A 2ARYA 1NLJA 2E02A 2XU3A 4QRVA 4MZOA 2FT2A
chains in the Genus database with same CATH superfamily
3IV2A 4QRXA 3I3TA 1GECE 1CQDA 4P16A 3E9SA 4YYRA 3BPFA 3IHPA 2P7UA 2AYNA 4D8IA 4N8WA 4A5UA 3ERVA 1KFXL 3H8BA 1CTEA 2HHNA 2HD5A 3IEJA 2AUXA 1PVJA 4D8BA 4X6HA 1MDWA 2ATOA 1VJVA 4AXLA 4CDDB 4YYQA 2O6XA 2DJGB 3H89A 1F29A 4BPVA 3M99A 2FRAA 4OVZB 1CB5A 3OF9A 4OELA 3V6CA 1XKGA 3ZNHA 5JZEA 1EWLA 1KXRA 2DZYA 3PDFA 4RF0A 3PBHA 3CBJA 2P86A 4BS6A 3PHUA 1PPOA 3MORA 4BOUA 1MEGA 3B79A 3CH3X 8PCHA 3K8UA 2P0RA 5KO3A 2G7YA 3RVXA 3RVWA 3U8EA 1U9XA 4CDCB 2E03A 2OP3A 1GLOA 3OVXA 3WXEA 4ZUXU 4BOPA 2AGAA 2FQ9A 3QJ3A 2AS8A 2ACTA 2AU1A 2R9FA 4BQVA 1KFUL 3WXGA 1ZIVA 4WA6A 4CZWA 3OQCA 4N4ZA 4WURA 2GFOA 3F5VA 2XU5A 1O0EA 1M6DA 2DOSA 2B1MA 1PADA 3GCBA 3HHIA 1FH0A 3O1GA 2Y5BA 2E01A 1ITOA 5A24A 2YJCA 2PADA 3C0RA 2IPPB 4PADA 4P6EA 1VSNA 1CJLA 1NL6A 4QRGA 4XZXA 3P5XA 1K3BB 1X9YA 4P6GA 2FRQA 3MHHA 1GMYA 3PNRA 4DMXA 4BSQA 1YK7A 1BGOA 5JH3A 4YYWA 1PE6A 4XR7A 1PIPA 1GCBA 1F2AA 1THEA 1IWDA 4YYSA 4YYUA 1YALA 2PNSA 2G6DA 1U5IA 1ZCMA 3KFQA 3O0UA 1AU2A 3TMPA 1MHWA 3USVA 2F1GA 1AECA 1DF0A 4I05A 1PPDA 1EWPA 2BTWB 3BOWA 1BP4A 5JA7A 2CB5A 3NHEA 4W4UA 2J7QC 2DC8A 1ME3A 3KKUA 4PP1A 3OF8A 6PADA 4N79A 4QH6A 4QBBA 2GHUA 2VHSA 4OVZA 2XU4A 4HXDB 4YV8A 1YK8A 4OW0A 1MIRA 2FE8A 3V6EA 5EGWA 1ME4A 4Q8HA 3IOQA 4X6JA 4IUMA 4RNAA 3PRPA 4OEMA 1BY8A 3MP2A 2FUDA 3W31A 1POPA 4HWYA 2C0YA 3LXSA 2NQDB 1EWOA 1QMYA 4PI3A 4RF1A 1A6RA 3PT2A 3DF0A 4I07A 4REZA 3K9MA 1QXPA 2UZJA 3QT4A 4BOZA 4YVAA 3K24A 3I06A 3BBAA 3RVVA 3HD3A 4I04A 1NPZA 2JQGR 2DC9A 4G54A 2DCCA 4X6IA 2HWKA 2R9NA 5FPWA 2VHFA 3BPMA 3AI8A 1NB3A 1CPJA 2AYOA 5EZQA 1CS8A 3BC3A 4R3DA 3HWNA 3RNVA 3P5UA 2JQFR 3KWBX 2BDZA 3KSEA 3P5VA 3TRKA 2DC7A 3H6SA 3OVZA 4PT5A 4M0WA 5CHVA 1DKIA 1JQPA 3OISA 4FJCA 4YYVA 2BDLA 3HHAA 2NQIA 1YVBA 2G8JA 1DEUA 1PCIA 3W30A 3IMAA 2J7QA 2DCDA 3PSEA 1SNKA 5CHTA 3PHWA 1U9VA 4MSXA 3KX1A 4FIPA 2NQGA 1MEMA 3S3RA 1F2CA 1SP4B 4BS5A 3LFYA 3MTVA 1AYWA 2FYEA 3PHXA 3D6SA 3WXFA 5E6JA 4RKXA 2DZZA 2WBFX 3E1ZB 1CVZA 2FO5A 3IFUA 4RY2A 4DMYA 4CDEB 1BQIA 3CH2X 1U9QX 2DJFB 4D8EA 2YJBA 3CBKA 2AIMA 4IP3A 1AU3A 4BOSA 7PCKA 2AVWA 3N4CA 5EF4A 3C9EA 4BOQA 3H8CA 3N3GA 4Q8GA 1KHQA 2HXZA 5J94A 1HUCB 3KWZA 2DCBA 2YJ8A 1CV8A 5CVNB 1S4VA 2E00A 3BCNA 4W5CA 1AU4A 2OZ2A 1ICFA 5F02A 2HH5A 1ATKA 2R9MA 4XUIA 2AUZA 2JTCA 2Y6EA 3B21A 2IBIA 2CIOA 1UKFA 4KLBA 5K16A 1AIMA 2BU3A 1TL9A 1U9WA 1QOLA 5PADA 2PREA 4MI7A 3QSDA 3ZUAA 2R9CA 4FK5A 1AYUA 3PW3A 1PPPA 2DC6A 9PAPA 5CVMA 1AYVA 4ZTBA 3O65A 2NQAA 3TNXA 1EF7A 2DCAA 1Q6KA 2F7DA 2H7JA 1F2BA 2YJ2A 1MS6A 3H7DA 1AU0A 3N3KA 1KHPA 1EWMA 2XU1A 2PBHA 4MZSA 2YJ9A 4PP2E 2R9OA 3BWKA 1QDQA 4W5BA 3IUTA 3MHSA 3BY4A 3S3QA 2FTDA 3F75A 2OULA 4CDFB 2JRIA 1YZBA 4AXMA 5EZSA 1Y08A 1NQCA 3P5WA 1STFE 1TLOA 2BTWA 2B1NA 4MM3B 3PRMA 1YT7A 2G8EA 1NB5A 1PXVA 3MJ5A 2R6NA 2Z84A 1PBHA 3BB7A 1Y4HA 5CVOB 1PPNA 3MTNA 4GUAA 4K7CA 1CSBB 1TU6A 3KW9A 2ARYA 1NLJA 2E02A 2XU3A 4QRVA 4MZOA 2FT2A
chains in the Genus database with same CATH topology
3IV2A 4QRXA 4NV7A 3I3TA 1GECE 1CQDA 4YYRA 3BPFA 3IHPA 2P7UA 2AYNA 4N8WA 3ERVA 1KFXL 3H8BA 1CTEA 2HHNA 2HD5A 3IEJA 2AUXA 4B55A 4X6HA 1MDWA 2ATOA 1VJVA 4AXLA 4CDDB 4YYQA 2O6XA 2DJGB 3H89A 1F29A 4BPVA 3M99A 2FRAA 1CB5A 3OF9A 4OELA 3V6CA 1XKGA 1EWLA 1KXRA 2DZYA 3PDFA 3PBHA 3CBJA 2P86A 4BS6A 1PPOA 3MORA 1MEGA 3B79A 3CH3X 8PCHA 3K8UA 2P0RA 2G7YA 3RVXA 3RVWA 2VFBA 3U8EA 1U9XA 4CDCB 2E03A 2OP3A 1GLOA 3OVXA 3WXEA 4ZUXU 2FQ9A 3QJ3A 2AS8A 2ACTA 2AU1A 2R9FA 4BQVA 1KFUL 3WXGA 1ZIVA 4WA6A 4CZWA 4N4ZA 2GFOA 3F5VA 2XU5A 1O0EA 1M6DA 2B1MA 1PADA 3GCBA 3HHIA 1FH0A 4GUZA 3O1GA 2Y5BA 2E01A 1ITOA 5A24A 2YJCA 2PADA 2IPPB 4PADA 4P6EA 1VSNA 1CJLA 1NL6A 4QRGA 3P5XA 1K3BB 1X9YA 4P6GA 2FRQA 3MHHA 1GMYA 3PNRA 4DMXA 4BSQA 2VFCA 1YK7A 1BGOA 5JH3A 4YYWA 1PE6A 4XR7A 1PIPA 1GCBA 1F2AA 1THEA 1IWDA 4YYSA 4YYUA 1YALA 2PNSA 2G6DA 1U5IA 1ZCMA 3KFQA 3O0UA 1AU2A 1MHWA 3USVA 2F1GA 1AECA 1DF0A 4I05A 1PPDA 1EWPA 3BOWA 1BP4A 5JA7A 2CB5A 3NHEA 4W4UA 2DC8A 1ME3A 3KKUA 4PP1A 3OF8A 6PADA 4N79A 4QH6A 4QBBA 2GHUA 2VHSA 2XU4A 4YV8A 1YK8A 1MIRA 3V6EA 5EGWA 1ME4A 4Q8HA 3IOQA 4X6JA 4OEMA 1BY8A 2FUDA 1POPA 4HWYA 2C0YA 3LXSA 2NQDB 1EWOA 1QMYA 4PI3A 1A6RA 3LTWA 3DF0A 4I07A 3K9MA 1QXPA 3QT4A 3D9WA 4YVAA 3K24A 3I06A 3RVVA 3HD3A 4I04A 1NPZA 2JQGR 2DC9A 4G54A 2DCCA 4X6IA 2R9NA 5FPWA 2VHFA 3BPMA 3AI8A 1NB3A 1CPJA 4C5PA 2AYOA 1CS8A 3BC3A 3HWNA 3P5UA 2JQFR 3KWBX 2BDZA 3KSEA 3P5VA 2DC7A 3H6SA 3OVZA 5CHVA 1JQPA 3OISA 4FJCA 4NV8A 4YYVA 2BDLA 3HHAA 2NQIA 1YVBA 2G8JA 1DEUA 1PCIA 3IMAA 2DCDA 1SNKA 5CHTA 1U9VA 4MSXA 3KX1A 4FIPA 2NQGA 1MEMA 3S3RA 1F2CA 1SP4B 4BS5A 3LFYA 1E2TA 1AYWA 2FYEA 3D6SA 3WXFA 2DZZA 2WBFX 3E1ZB 1CVZA 2FO5A 4RY2A 4DMYA 4CDEB 1BQIA 3CH2X 1U9QX 2DJFB 2YJBA 3CBKA 2AIMA 1AU3A 7PCKA 2AVWA 3N4CA 5EF4A 3C9EA 3H8CA 3N3GA 4Q8GA 1KHQA 2HXZA 5J94A 1HUCB 3KWZA 2DCBA 2YJ8A 1CV8A 5CVNB 1S4VA 2E00A 3BCNA 4W5CA 1AU4A 2OZ2A 1ICFA 5F02A 1W4TA 2HH5A 1ATKA 2R9MA 4XUIA 2AUZA 2Y6EA 2IBIA 2CIOA 4KLBA 1GX3A 5K16A 1AIMA 1TL9A 1U9WA 1QOLA 5PADA 2PREA 3QSDA 3ZUAA 2R9CA 4FK5A 1AYUA 3PW3A 1PPPA 1W5RA 2DC6A 9PAPA 5CVMA 1AYVA 2BSZA 2NQAA 3TNXA 1EF7A 2DCAA 1Q6KA 2F7DA 2H7JA 1F2BA 2YJ2A 1MS6A 3H7DA 1AU0A 3N3KA 1KHPA 1EWMA 2XU1A 1W6FA 2PBHA 4MZSA 2YJ9A 4PP2E 2R9OA 3BWKA 1QDQA 4W5BA 3IUTA 3MHSA 3S3QA 2FTDA 3F75A 2OULA 4CDFB 4AXMA 1Y08A 1NQCA 3P5WA 1STFE 1TLOA 2B1NA 1YT7A 2G8EA 1NB5A 1PXVA 2R6NA 1PBHA 1Y4HA 5CVOB 1PPNA 3MTNA 4K7CA 1CSBB 1TU6A 3KW9A 2ARYA 1NLJA 2E02A 2XU3A 4BGFA 4QRVA 4MZOA 2FT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IV2 A;  4QRX A;  3I3T A;  1GEC E;  1CQD A;  4YYR A;  3BPF A;  3IHP A;  2P7U A;  2AYN A;  4N8W A;  3ERV A;  1KFX L;  3H8B A;  1CTE A;  2HHN A;  2HD5 A;  3IEJ A;  2AUX A;  4X6H A;  1MDW A;  2ATO A;  1VJV A;  4AXL A;  4CDD B;  4YYQ A;  2O6X A;  2DJG B;  3H89 A;  1F29 A;  4BPV A;  3M99 A;  2FRA A;  1CB5 A;  3OF9 A;  4OEL A;  3V6C A;  1XKG A;  1EWL A;  1KXR A;  2DZY A;  3PDF A;  3PBH A;  3CBJ A;  2P86 A;  4BS6 A;  1PPO A;  3MOR A;  1MEG A;  3B79 A;  3CH3 X;  8PCH A;  3K8U A;  2P0R A;  2G7Y A;  3RVX A;  3RVW A;  3U8E A;  1U9X A;  4CDC B;  2E03 A;  2OP3 A;  1GLO A;  3OVX A;  3WXE A;  4ZUX U;  2FQ9 A;  3QJ3 A;  2AS8 A;  2ACT A;  2AU1 A;  2R9F A;  4BQV A;  1KFU L;  3WXG A;  1ZIV A;  4WA6 A;  4CZW A;  4N4Z A;  2GFO A;  3F5V A;  2XU5 A;  1O0E A;  1M6D A;  2B1M A;  1PAD A;  3GCB A;  3HHI A;  1FH0 A;  3O1G A;  2Y5B A;  2E01 A;  1ITO A;  5A24 A;  2YJC A;  2PAD A;  2IPP B;  4PAD A;  4P6E A;  1VSN A;  1CJL A;  1NL6 A;  4QRG A;  3P5X A;  1K3B B;  1X9Y A;  4P6G A;  2FRQ A;  3MHH A;  1GMY A;  3PNR A;  4DMX A;  4BSQ A;  1YK7 A;  1BGO A;  5JH3 A;  4YYW A;  1PE6 A;  4XR7 A;  1PIP A;  1GCB A;  1F2A A;  1THE A;  1IWD A;  4YYS A;  4YYU A;  1YAL A;  2PNS A;  2G6D A;  1U5I A;  1ZCM A;  3KFQ A;  3O0U A;  1AU2 A;  1MHW A;  3USV A;  2F1G A;  1AEC A;  1DF0 A;  4I05 A;  1PPD A;  1EWP A;  3BOW A;  1BP4 A;  5JA7 A;  2CB5 A;  3NHE A;  4W4U A;  2DC8 A;  1ME3 A;  3KKU A;  4PP1 A;  3OF8 A;  6PAD A;  4N79 A;  4QH6 A;  4QBB A;  2GHU A;  2VHS A;  2XU4 A;  4YV8 A;  1YK8 A;  1MIR A;  3V6E A;  5EGW A;  1ME4 A;  4Q8H A;  3IOQ A;  4X6J A;  4OEM A;  1BY8 A;  2FUD A;  1POP A;  4HWY A;  2C0Y A;  3LXS A;  2NQD B;  1EWO A;  1QMY A;  4PI3 A;  1A6R A;  3DF0 A;  4I07 A;  3K9M A;  1QXP A;  3QT4 A;  4YVA A;  3K24 A;  3I06 A;  3RVV A;  3HD3 A;  4I04 A;  1NPZ A;  2JQG R;  2DC9 A;  4G54 A;  2DCC A;  4X6I A;  2R9N A;  5FPW A;  2VHF A;  3BPM A;  3AI8 A;  1NB3 A;  1CPJ A;  2AYO A;  1CS8 A;  3BC3 A;  3HWN A;  3P5U A;  2JQF R;  3KWB X;  2BDZ A;  3KSE A;  3P5V A;  2DC7 A;  3H6S A;  3OVZ A;  5CHV A;  1JQP A;  3OIS A;  4FJC A;  4YYV A;  2BDL A;  3HHA A;  2NQI A;  1YVB A;  2G8J A;  1DEU A;  1PCI A;  3IMA A;  2DCD A;  1SNK A;  5CHT A;  1U9V A;  4MSX A;  3KX1 A;  4FIP A;  2NQG A;  1MEM A;  3S3R A;  1F2C A;  1SP4 B;  4BS5 A;  3LFY A;  1AYW A;  2FYE A;  3D6S A;  3WXF A;  2DZZ A;  2WBF X;  3E1Z B;  1CVZ A;  2FO5 A;  4RY2 A;  4DMY A;  4CDE B;  1BQI A;  3CH2 X;  1U9Q X;  2DJF B;  2YJB A;  3CBK A;  2AIM A;  1AU3 A;  7PCK A;  2AVW A;  3N4C A;  5EF4 A;  3C9E A;  3H8C A;  3N3G A;  4Q8G A;  1KHQ A;  2HXZ A;  5J94 A;  1HUC B;  3KWZ A;  2DCB A;  2YJ8 A;  1CV8 A;  5CVN B;  1S4V A;  2E00 A;  3BCN A;  4W5C A;  1AU4 A;  2OZ2 A;  1ICF A;  5F02 A;  2HH5 A;  1ATK A;  2R9M A;  4XUI A;  2AUZ A;  2Y6E A;  2IBI A;  2CIO A;  4KLB A;  5K16 A;  1AIM A;  1TL9 A;  1U9W A;  1QOL A;  5PAD A;  2PRE A;  3QSD A;  3ZUA A;  2R9C A;  4FK5 A;  1AYU A;  3PW3 A;  1PPP A;  2DC6 A;  9PAP A;  5CVM A;  1AYV A;  2NQA A;  3TNX A;  1EF7 A;  2DCA A;  1Q6K A;  2F7D A;  2H7J A;  1F2B A;  2YJ2 A;  1MS6 A;  3H7D A;  1AU0 A;  3N3K A;  1KHP A;  1EWM A;  2XU1 A;  2PBH A;  4MZS A;  2YJ9 A;  4PP2 E;  2R9O A;  3BWK A;  1QDQ A;  4W5B A;  3IUT A;  3MHS A;  3S3Q A;  2FTD A;  3F75 A;  2OUL A;  4CDF B;  4AXM A;  1Y08 A;  1NQC A;  3P5W A;  1STF E;  1TLO A;  2B1N A;  1YT7 A;  2G8E A;  1NB5 A;  1PXV A;  2R6N A;  1PBH A;  1Y4H A;  5CVO B;  1PPN A;  3MTN A;  4K7C A;  1CSB B;  1TU6 A;  3KW9 A;  2ARY A;  1NLJ A;  2E02 A;  2XU3 A;  4QRV A;  4MZO A;  2FT2 A; 
#chains in the Genus database with same CATH topology
 3IV2 A;  4QRX A;  3I3T A;  1GEC E;  1CQD A;  4P16 A;  3E9S A;  4YYR A;  3BPF A;  3IHP A;  2P7U A;  2AYN A;  4D8I A;  4N8W A;  4A5U A;  3ERV A;  1KFX L;  3H8B A;  1CTE A;  2HHN A;  2HD5 A;  3IEJ A;  2AUX A;  1PVJ A;  4D8B A;  4X6H A;  1MDW A;  2ATO A;  1VJV A;  4AXL A;  4CDD B;  4YYQ A;  2O6X A;  2DJG B;  3H89 A;  1F29 A;  4BPV A;  3M99 A;  2FRA A;  4OVZ B;  1CB5 A;  3OF9 A;  4OEL A;  3V6C A;  1XKG A;  3ZNH A;  5JZE A;  1EWL A;  1KXR A;  2DZY A;  3PDF A;  4RF0 A;  3PBH A;  3CBJ A;  2P86 A;  4BS6 A;  3PHU A;  1PPO A;  3MOR A;  4BOU A;  1MEG A;  3B79 A;  3CH3 X;  8PCH A;  3K8U A;  2P0R A;  5KO3 A;  2G7Y A;  3RVX A;  3RVW A;  3U8E A;  1U9X A;  4CDC B;  2E03 A;  2OP3 A;  1GLO A;  3OVX A;  3WXE A;  4ZUX U;  4BOP A;  2AGA A;  2FQ9 A;  3QJ3 A;  2AS8 A;  2ACT A;  2AU1 A;  2R9F A;  4BQV A;  1KFU L;  3WXG A;  1ZIV A;  4WA6 A;  4CZW A;  3OQC A;  4N4Z A;  4WUR A;  2GFO A;  3F5V A;  2XU5 A;  1O0E A;  1M6D A;  2DOS A;  2B1M A;  1PAD A;  3GCB A;  3HHI A;  1FH0 A;  3O1G A;  2Y5B A;  2E01 A;  1ITO A;  5A24 A;  2YJC A;  2PAD A;  3C0R A;  2IPP B;  4PAD A;  4P6E A;  1VSN A;  1CJL A;  1NL6 A;  4QRG A;  4XZX A;  3P5X A;  1K3B B;  1X9Y A;  4P6G A;  2FRQ A;  3MHH A;  1GMY A;  3PNR A;  4DMX A;  4BSQ A;  1YK7 A;  1BGO A;  5JH3 A;  4YYW A;  1PE6 A;  4XR7 A;  1PIP A;  1GCB A;  1F2A A;  1THE A;  1IWD A;  4YYS A;  4YYU A;  1YAL A;  2PNS A;  2G6D A;  1U5I A;  1ZCM A;  3KFQ A;  3O0U A;  1AU2 A;  3TMP A;  1MHW A;  3USV A;  2F1G A;  1AEC A;  1DF0 A;  4I05 A;  1PPD A;  1EWP A;  2BTW B;  3BOW A;  1BP4 A;  5JA7 A;  2CB5 A;  3NHE A;  4W4U A;  2J7Q C;  2DC8 A;  1ME3 A;  3KKU A;  4PP1 A;  3OF8 A;  6PAD A;  4N79 A;  4QH6 A;  4QBB A;  2GHU A;  2VHS A;  4OVZ A;  2XU4 A;  4HXD B;  4YV8 A;  1YK8 A;  4OW0 A;  1MIR A;  2FE8 A;  3V6E A;  5EGW A;  1ME4 A;  4Q8H A;  3IOQ A;  4X6J A;  4IUM A;  4RNA A;  3PRP A;  4OEM A;  1BY8 A;  3MP2 A;  2FUD A;  3W31 A;  1POP A;  4HWY A;  2C0Y A;  3LXS A;  2NQD B;  1EWO A;  1QMY A;  4PI3 A;  4RF1 A;  1A6R A;  3PT2 A;  3DF0 A;  4I07 A;  4REZ A;  3K9M A;  1QXP A;  2UZJ A;  3QT4 A;  4BOZ A;  4YVA A;  3K24 A;  3I06 A;  3BBA A;  3RVV A;  3HD3 A;  4I04 A;  1NPZ A;  2JQG R;  2DC9 A;  4G54 A;  2DCC A;  4X6I A;  2HWK A;  2R9N A;  5FPW A;  2VHF A;  3BPM A;  3AI8 A;  1NB3 A;  1CPJ A;  2AYO A;  5EZQ A;  1CS8 A;  3BC3 A;  4R3D A;  3HWN A;  3RNV A;  3P5U A;  2JQF R;  3KWB X;  2BDZ A;  3KSE A;  3P5V A;  3TRK A;  2DC7 A;  3H6S A;  3OVZ A;  4PT5 A;  4M0W A;  5CHV A;  1DKI A;  1JQP A;  3OIS A;  4FJC A;  4YYV A;  2BDL A;  3HHA A;  2NQI A;  1YVB A;  2G8J A;  1DEU A;  1PCI A;  3W30 A;  3IMA A;  2J7Q A;  2DCD A;  3PSE A;  1SNK A;  5CHT A;  3PHW A;  1U9V A;  4MSX A;  3KX1 A;  4FIP A;  2NQG A;  1MEM A;  3S3R A;  1F2C A;  1SP4 B;  4BS5 A;  3LFY A;  3MTV A;  1AYW A;  2FYE A;  3PHX A;  3D6S A;  3WXF A;  5E6J A;  4RKX A;  2DZZ A;  2WBF X;  3E1Z B;  1CVZ A;  2FO5 A;  3IFU A;  4RY2 A;  4DMY A;  4CDE B;  1BQI A;  3CH2 X;  1U9Q X;  2DJF B;  4D8E A;  2YJB A;  3CBK A;  2AIM A;  4IP3 A;  1AU3 A;  4BOS A;  7PCK A;  2AVW A;  3N4C A;  5EF4 A;  3C9E A;  4BOQ A;  3H8C A;  3N3G A;  4Q8G A;  1KHQ A;  2HXZ A;  5J94 A;  1HUC B;  3KWZ A;  2DCB A;  2YJ8 A;  1CV8 A;  5CVN B;  1S4V A;  2E00 A;  3BCN A;  4W5C A;  1AU4 A;  2OZ2 A;  1ICF A;  5F02 A;  2HH5 A;  1ATK A;  2R9M A;  4XUI A;  2AUZ A;  2JTC A;  2Y6E A;  3B21 A;  2IBI A;  2CIO A;  1UKF A;  4KLB A;  5K16 A;  1AIM A;  2BU3 A;  1TL9 A;  1U9W A;  1QOL A;  5PAD A;  2PRE A;  4MI7 A;  3QSD A;  3ZUA A;  2R9C A;  4FK5 A;  1AYU A;  3PW3 A;  1PPP A;  2DC6 A;  9PAP A;  5CVM A;  1AYV A;  4ZTB A;  3O65 A;  2NQA A;  3TNX A;  1EF7 A;  2DCA A;  1Q6K A;  2F7D A;  2H7J A;  1F2B A;  2YJ2 A;  1MS6 A;  3H7D A;  1AU0 A;  3N3K A;  1KHP A;  1EWM A;  2XU1 A;  2PBH A;  4MZS A;  2YJ9 A;  4PP2 E;  2R9O A;  3BWK A;  1QDQ A;  4W5B A;  3IUT A;  3MHS A;  3BY4 A;  3S3Q A;  2FTD A;  3F75 A;  2OUL A;  4CDF B;  2JRI A;  1YZB A;  4AXM A;  5EZS A;  1Y08 A;  1NQC A;  3P5W A;  1STF E;  1TLO A;  2BTW A;  2B1N A;  4MM3 B;  3PRM A;  1YT7 A;  2G8E A;  1NB5 A;  1PXV A;  3MJ5 A;  2R6N A;  2Z84 A;  1PBH A;  3BB7 A;  1Y4H A;  5CVO B;  1PPN A;  3MTN A;  4GUA A;  4K7C A;  1CSB B;  1TU6 A;  3KW9 A;  2ARY A;  1NLJ A;  2E02 A;  2XU3 A;  4QRV A;  4MZO A;  2FT2 A; 
#chains in the Genus database with same CATH homology
 3IV2 A;  4QRX A;  4NV7 A;  3I3T A;  1GEC E;  1CQD A;  4YYR A;  3BPF A;  3IHP A;  2P7U A;  2AYN A;  4N8W A;  3ERV A;  1KFX L;  3H8B A;  1CTE A;  2HHN A;  2HD5 A;  3IEJ A;  2AUX A;  4B55 A;  4X6H A;  1MDW A;  2ATO A;  1VJV A;  4AXL A;  4CDD B;  4YYQ A;  2O6X A;  2DJG B;  3H89 A;  1F29 A;  4BPV A;  3M99 A;  2FRA A;  1CB5 A;  3OF9 A;  4OEL A;  3V6C A;  1XKG A;  1EWL A;  1KXR A;  2DZY A;  3PDF A;  3PBH A;  3CBJ A;  2P86 A;  4BS6 A;  1PPO A;  3MOR A;  1MEG A;  3B79 A;  3CH3 X;  8PCH A;  3K8U A;  2P0R A;  2G7Y A;  3RVX A;  3RVW A;  2VFB A;  3U8E A;  1U9X A;  4CDC B;  2E03 A;  2OP3 A;  1GLO A;  3OVX A;  3WXE A;  4ZUX U;  2FQ9 A;  3QJ3 A;  2AS8 A;  2ACT A;  2AU1 A;  2R9F A;  4BQV A;  1KFU L;  3WXG A;  1ZIV A;  4WA6 A;  4CZW A;  4N4Z A;  2GFO A;  3F5V A;  2XU5 A;  1O0E A;  1M6D A;  2B1M A;  1PAD A;  3GCB A;  3HHI A;  1FH0 A;  4GUZ A;  3O1G A;  2Y5B A;  2E01 A;  1ITO A;  5A24 A;  2YJC A;  2PAD A;  2IPP B;  4PAD A;  4P6E A;  1VSN A;  1CJL A;  1NL6 A;  4QRG A;  3P5X A;  1K3B B;  1X9Y A;  4P6G A;  2FRQ A;  3MHH A;  1GMY A;  3PNR A;  4DMX A;  4BSQ A;  2VFC A;  1YK7 A;  1BGO A;  5JH3 A;  4YYW A;  1PE6 A;  4XR7 A;  1PIP A;  1GCB A;  1F2A A;  1THE A;  1IWD A;  4YYS A;  4YYU A;  1YAL A;  2PNS A;  2G6D A;  1U5I A;  1ZCM A;  3KFQ A;  3O0U A;  1AU2 A;  1MHW A;  3USV A;  2F1G A;  1AEC A;  1DF0 A;  4I05 A;  1PPD A;  1EWP A;  3BOW A;  1BP4 A;  5JA7 A;  2CB5 A;  3NHE A;  4W4U A;  2DC8 A;  1ME3 A;  3KKU A;  4PP1 A;  3OF8 A;  6PAD A;  4N79 A;  4QH6 A;  4QBB A;  2GHU A;  2VHS A;  2XU4 A;  4YV8 A;  1YK8 A;  1MIR A;  3V6E A;  5EGW A;  1ME4 A;  4Q8H A;  3IOQ A;  4X6J A;  4OEM A;  1BY8 A;  2FUD A;  1POP A;  4HWY A;  2C0Y A;  3LXS A;  2NQD B;  1EWO A;  1QMY A;  4PI3 A;  1A6R A;  3LTW A;  3DF0 A;  4I07 A;  3K9M A;  1QXP A;  3QT4 A;  3D9W A;  4YVA A;  3K24 A;  3I06 A;  3RVV A;  3HD3 A;  4I04 A;  1NPZ A;  2JQG R;  2DC9 A;  4G54 A;  2DCC A;  4X6I A;  2R9N A;  5FPW A;  2VHF A;  3BPM A;  3AI8 A;  1NB3 A;  1CPJ A;  4C5P A;  2AYO A;  1CS8 A;  3BC3 A;  3HWN A;  3P5U A;  2JQF R;  3KWB X;  2BDZ A;  3KSE A;  3P5V A;  2DC7 A;  3H6S A;  3OVZ A;  5CHV A;  1JQP A;  3OIS A;  4FJC A;  4NV8 A;  4YYV A;  2BDL A;  3HHA A;  2NQI A;  1YVB A;  2G8J A;  1DEU A;  1PCI A;  3IMA A;  2DCD A;  1SNK A;  5CHT A;  1U9V A;  4MSX A;  3KX1 A;  4FIP A;  2NQG A;  1MEM A;  3S3R A;  1F2C A;  1SP4 B;  4BS5 A;  3LFY A;  1E2T A;  1AYW A;  2FYE A;  3D6S A;  3WXF A;  2DZZ A;  2WBF X;  3E1Z B;  1CVZ A;  2FO5 A;  4RY2 A;  4DMY A;  4CDE B;  1BQI A;  3CH2 X;  1U9Q X;  2DJF B;  2YJB A;  3CBK A;  2AIM A;  1AU3 A;  7PCK A;  2AVW A;  3N4C A;  5EF4 A;  3C9E A;  3H8C A;  3N3G A;  4Q8G A;  1KHQ A;  2HXZ A;  5J94 A;  1HUC B;  3KWZ A;  2DCB A;  2YJ8 A;  1CV8 A;  5CVN B;  1S4V A;  2E00 A;  3BCN A;  4W5C A;  1AU4 A;  2OZ2 A;  1ICF A;  5F02 A;  1W4T A;  2HH5 A;  1ATK A;  2R9M A;  4XUI A;  2AUZ A;  2Y6E A;  2IBI A;  2CIO A;  4KLB A;  1GX3 A;  5K16 A;  1AIM A;  1TL9 A;  1U9W A;  1QOL A;  5PAD A;  2PRE A;  3QSD A;  3ZUA A;  2R9C A;  4FK5 A;  1AYU A;  3PW3 A;  1PPP A;  1W5R A;  2DC6 A;  9PAP A;  5CVM A;  1AYV A;  2BSZ A;  2NQA A;  3TNX A;  1EF7 A;  2DCA A;  1Q6K A;  2F7D A;  2H7J A;  1F2B A;  2YJ2 A;  1MS6 A;  3H7D A;  1AU0 A;  3N3K A;  1KHP A;  1EWM A;  2XU1 A;  1W6F A;  2PBH A;  4MZS A;  2YJ9 A;  4PP2 E;  2R9O A;  3BWK A;  1QDQ A;  4W5B A;  3IUT A;  3MHS A;  3S3Q A;  2FTD A;  3F75 A;  2OUL A;  4CDF B;  4AXM A;  1Y08 A;  1NQC A;  3P5W A;  1STF E;  1TLO A;  2B1N A;  1YT7 A;  2G8E A;  1NB5 A;  1PXV A;  2R6N A;  1PBH A;  1Y4H A;  5CVO B;  1PPN A;  3MTN A;  4K7C A;  1CSB B;  1TU6 A;  3KW9 A;  2ARY A;  1NLJ A;  2E02 A;  2XU3 A;  4BGF A;  4QRV A;  4MZO A;  2FT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...