4BPVA

Mouse cathepsin s with covalent ligand
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
219
structure length
219
Chain Sequence
TLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKAMDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN S
publication title Cathepsin S Nitrile Inhibitors
rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 68
structure length 219
sequence length 219
chains with identical sequence B, C, D, E, K
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2013-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4bpvA00
3PW3A 4BSQA 1ZCMA 1CS8A 1Y4HA 3BCNA 3KWBX 3IUTA 4MZOA 1PPOA 1CJLA 2AU1A 2R9CA 4PADA 3D6SA 1NB3A 2E01A 3RVWA 8PCHA 3OISA 1EWOA 4MZSA 2JQGR 2R9MA 5CVMA 5A24A 3IEJA 3ZUAA 3V6CA 1K3BB 2CIOA 1MIRA 3KSEA 1ITOA 3H89A 4I04A 2DC9A 1CB5A 4AXLA 2AS8A 2FRAA 2H7JA 3HD3A 1QDQA 4DMXA 1MS6A 1U9VA 1KFXL 2F7DA 4CDEB 3HHIA 1YT7A 3B79A 3KW9A 1NPZA 5FPWA 1CV8A 1EWMA 1ME4A 1DEUA 3S3QA 3WXGA 1U9WA 2XU1A 3O0UA 3QJ3A 2NQAA 1BY8A 1PIPA 2IPPB 1Y08A 3IOQA 2FYEA 2NQDB 3BC3A 5K16A 3ERVA 1KXRA 9PAPA 1CTEA 4QRVA 1PPPA 1NB5A 1VJVA 2OZ2A 4YYSA 4P6EA 2VHSA 2FTDA 2DCBA 4XR7A 2GHUA 4YYQA 1FH0A 1AECA 1QXPA 4MSXA 4PP2E 2DCCA 2C0YA 3QT4A 4N79A 2YJBA 3PNRA 3U8EA 2FO5A 1TL9A 4WA6A 2AYNA 2HXZA 1CSBB 1MEGA 3BPFA 3H8BA 4YV8A 1AU0A 3M99A 4YYVA 4G54A 3IMAA 2P0RA 3I06A 5F02A 4QBBA 1X9YA 2AYOA 4Q8HA 3MTNA 2ARYA 3PDFA 5CVOB 2E00A 3H8CA 5CHTA 4OELA 2AUXA 2JQFR 4DMYA 1TLOA 2PNSA 3MHSA 1PPNA 2CB5A 3N3GA 4YYWA 1AIMA 2G6DA 2Y6EA 4W4UA 3O1GA 1PE6A 1YK8A 3RVVA 1POPA 2P7UA 1KHPA 5CVNB 2AVWA 3RVXA 3QSDA 1CPJA 1CQDA 2B1NA 1XKGA 2HH5A 3KX1A 1YVBA 1VSNA 2B1MA 3OF8A 2XU4A 3K8UA 1F29A 1S4VA 3E1ZB 4PP1A 2PREA 1PCIA 1NLJA 4YYUA 3CBKA 3KWZA 1NQCA 2YJ9A 4BQVA 3HHAA 2P86A 1MEMA 1AU2A 3F5VA 2FQ9A 2FT2A 2OP3A 2O6XA 4XUIA 2DJFB 3KKUA 7PCKA 2ATOA 4YYRA 4CDCB 3KFQA 3N3KA 1AU4A 3CH3X 4P6GA 5JA7A 1GLOA 3BWKA 3CH2X 2PBHA 3LXSA 3P5VA 4X6IA 1F2CA 2YJCA 3IHPA 1ZIVA 6PADA 2R9NA 3P5UA 1AYWA 1STFE 4FIPA 2DZYA 4I07A 3H7DA 1BQIA 3HWNA 3P5XA 3N4CA 4CZWA 1A6RA 1IWDA 3NHEA 4FJCA 3H6SA 2F1GA 3K9MA 3BOWA 2NQGA 3F75A 2OULA 3C9EA 3AI8A 2BDZA 4W5BA 1HUCB 5CHVA 1O0EA 4QRGA 1M6DA 1THEA 1EF7A 1MDWA 1GMYA 2HD5A 2HHNA 4PI3A 2YJ8A 4QRXA 1U9QX 2ACTA 2PADA 3WXFA 2DCDA 4CDFB 3OVZA 2DCAA 4AXMA 1SNKA 2R9OA 2XU3A 3GCBA 2DC6A 3CBJA 2R9FA 4YVAA 1F2BA 4BS5A 3MORA 1YALA 4ZUXU 4KLBA 4X6HA 2AUZA 3WXEA 5EF4A 3OF9A 2VHFA 3LFYA 1BGOA 3I3TA 3S3RA 1PXVA 4QH6A 1ATKA 1U5IA 5PADA 4X6JA 2AIMA 1GECE 1EWPA 2GFOA 3USVA 1GCBA 3V6EA 1PADA 1DF0A 1ICFA 1AYVA 1EWLA 1TU6A 3MHHA 4CDDB 5J94A 2YJ2A 4RY2A 4N8WA 4K7CA 2E02A 1SP4B 1JQPA 1Q6KA 2XU5A 4BPVA 4Q8GA 4N4ZA 4W5CA 5JH3A 1U9XA 2DC7A 2Y5BA 2WBFX 1NL6A 2BDLA 2DZZA 2DC8A 3TNXA 1ME3A 4FK5A 4HWYA 2E03A 3P5WA 1KHQA 4OEMA 1AYUA 3PBHA 1KFUL 2G8JA 2R6NA 2G8EA 4I05A 1CVZA 2G7YA 2NQIA 3IV2A 1F2AA 1MHWA 1QMYA 4BS6A 3OVXA 2FUDA 1BP4A 3BPMA 2DJGB 1QOLA 2IBIA 3K24A 1PBHA 1YK7A 1PPDA 5EGWA 2FRQA 3DF0A 1AU3A
chains in the Genus database with same CATH superfamily
3PW3A 4BSQA 1ZCMA 1CS8A 3C0RA 1Y4HA 3BCNA 3KWBX 3IUTA 3PHXA 3PRPA 4MZOA 1PPOA 1CJLA 2AU1A 5JZEA 2R9CA 4PADA 3D6SA 1NB3A 2E01A 3RVWA 8PCHA 3OISA 1EWOA 4MZSA 2JQGR 2R9MA 5CVMA 5A24A 3IEJA 3ZUAA 1UKFA 3V6CA 1K3BB 2CIOA 2UZJA 1MIRA 3KSEA 1ITOA 3H89A 4I04A 2DC9A 4D8BA 1CB5A 4AXLA 3PHUA 2AS8A 2FRAA 2H7JA 3HD3A 1QDQA 4DMXA 1MS6A 1U9VA 1KFXL 2F7DA 4BOUA 4CDEB 3HHIA 1YT7A 3B79A 3KW9A 1NPZA 5FPWA 1CV8A 1EWMA 1ME4A 1DEUA 3S3QA 3WXGA 1U9WA 4OW0A 2XU1A 3O0UA 3QJ3A 2NQAA 1BY8A 1PIPA 1YZBA 2IPPB 1Y08A 3IOQA 2FYEA 2NQDB 2DOSA 3BC3A 5K16A 3ERVA 1KXRA 9PAPA 1CTEA 4QRVA 1PPPA 1NB5A 1VJVA 2OZ2A 4YYSA 4P6EA 2VHSA 2FTDA 2DCBA 4XR7A 2GHUA 4YYQA 4REZA 1FH0A 1AECA 1QXPA 4MSXA 4PP2E 2DCCA 2C0YA 3QT4A 2HWKA 4N79A 2YJBA 4WURA 3PNRA 3U8EA 2FO5A 1TL9A 4WA6A 2AYNA 2HXZA 1CSBB 1MEGA 3BPFA 3H8BA 4YV8A 1AU0A 3M99A 4YYVA 4G54A 3IMAA 2P0RA 3I06A 5F02A 4QBBA 1X9YA 2AYOA 4BOPA 4Q8HA 4HXDB 3MTNA 4RF0A 2ARYA 3MTVA 3PDFA 5CVOB 2E00A 3H8CA 5CHTA 4OELA 4R3DA 2AUXA 2JQFR 4DMYA 2BTWA 1TLOA 2PNSA 3PHWA 3MHSA 1PPNA 2CB5A 4RKXA 3N3GA 4YYWA 2BTWB 1AIMA 2G6DA 2Y6EA 4W4UA 3O1GA 1PE6A 4BOQA 1YK8A 3RVVA 1POPA 3BB7A 1DKIA 2P7UA 1KHPA 5CVNB 2AVWA 3RVXA 3IFUA 3QSDA 4BOZA 1CPJA 1CQDA 2B1NA 1XKGA 2HH5A 3KX1A 1YVBA 1VSNA 2B1MA 4A5UA 3OF8A 2XU4A 5E6JA 3K8UA 1F29A 1S4VA 3E1ZB 4P16A 4PP1A 5KO3A 2PREA 2Z84A 2BU3A 1PCIA 1NLJA 4YYUA 3CBKA 3KWZA 1NQCA 2YJ9A 4BQVA 3HHAA 2P86A 1MEMA 1AU2A 3F5VA 2FQ9A 2FT2A 2OP3A 2O6XA 4XUIA 2DJFB 4D8IA 3KKUA 7PCKA 2ATOA 3BBAA 4YYRA 4RNAA 4MM3B 4CDCB 3KFQA 3N3KA 1AU4A 3CH3X 4P6GA 3TRKA 5JA7A 1GLOA 3BWKA 3CH2X 2PBHA 3LXSA 3P5VA 3PRMA 4M0WA 3B21A 4X6IA 4GUAA 1F2CA 2YJCA 3IHPA 1ZIVA 6PADA 2R9NA 3P5UA 1AYWA 1STFE 4FIPA 2DZYA 4I07A 3RNVA 3H7DA 1BQIA 3HWNA 3P5XA 3N4CA 4CZWA 1A6RA 4RF1A 1IWDA 3NHEA 4FJCA 3H6SA 2F1GA 3K9MA 3BOWA 2NQGA 3F75A 5EZSA 2OULA 3C9EA 3AI8A 2BDZA 4PT5A 4OVZA 4W5BA 3W31A 1HUCB 5CHVA 1O0EA 4QRGA 1M6DA 1THEA 1EF7A 1MDWA 1GMYA 4OVZB 2HD5A 2HHNA 4PI3A 2YJ8A 4QRXA 1U9QX 3ZNHA 2ACTA 2PADA 5EZQA 3WXFA 4D8EA 2J7QA 2DCDA 4CDFB 3OVZA 2DCAA 4AXMA 4XZXA 1SNKA 2R9OA 2XU3A 3GCBA 2DC6A 3CBJA 2R9FA 4YVAA 1F2BA 4BS5A 3TMPA 3MORA 3PT2A 1YALA 4ZUXU 4KLBA 4BOSA 4X6HA 2AUZA 3WXEA 5EF4A 3OF9A 2VHFA 3LFYA 1BGOA 3I3TA 2AGAA 3S3RA 1PXVA 4QH6A 1ATKA 1U5IA 1PVJA 3MP2A 4MI7A 5PADA 4X6JA 3O65A 2AIMA 1GECE 3E9SA 1EWPA 2GFOA 3USVA 1GCBA 3V6EA 1PADA 1DF0A 4ZTBA 1ICFA 1AYVA 1EWLA 1TU6A 3MHHA 4IUMA 4CDDB 5J94A 2YJ2A 3MJ5A 2J7QC 4RY2A 4N8WA 4K7CA 2E02A 2JRIA 1SP4B 1JQPA 4IP3A 1Q6KA 2XU5A 4BPVA 4Q8GA 4N4ZA 3W30A 2FE8A 4W5CA 2JTCA 5JH3A 1U9XA 2DC7A 3BY4A 2Y5BA 2WBFX 1NL6A 2BDLA 2DZZA 2DC8A 3TNXA 1ME3A 4FK5A 4HWYA 2E03A 3P5WA 1KHQA 4OEMA 1AYUA 3OQCA 3PBHA 1KFUL 2G8JA 2R6NA 2G8EA 4I05A 1CVZA 2G7YA 2NQIA 3IV2A 1F2AA 1MHWA 1QMYA 4BS6A 3OVXA 2FUDA 1BP4A 3BPMA 2DJGB 1QOLA 2IBIA 3K24A 1PBHA 1YK7A 1PPDA 5EGWA 3PSEA 2FRQA 3DF0A 1AU3A
chains in the Genus database with same CATH topology
3PW3A 4BSQA 1ZCMA 1CS8A 1Y4HA 4BGFA 3BCNA 3KWBX 3IUTA 4MZOA 1PPOA 1CJLA 2AU1A 2R9CA 4PADA 3D6SA 1NB3A 2E01A 3RVWA 1W5RA 8PCHA 3OISA 1EWOA 4MZSA 2JQGR 2R9MA 5CVMA 5A24A 3IEJA 4GUZA 3ZUAA 3V6CA 1K3BB 2CIOA 1MIRA 3KSEA 1ITOA 3H89A 4I04A 2DC9A 1CB5A 4AXLA 2AS8A 2FRAA 2H7JA 3HD3A 1QDQA 4DMXA 1MS6A 1U9VA 1KFXL 2F7DA 4NV8A 4CDEB 3HHIA 1YT7A 3B79A 3KW9A 1NPZA 5FPWA 1CV8A 1EWMA 1ME4A 1DEUA 3S3QA 3WXGA 1U9WA 2XU1A 1W6FA 3O0UA 2NQAA 3QJ3A 1BY8A 1PIPA 2IPPB 1Y08A 3IOQA 2FYEA 2NQDB 2VFBA 3D9WA 3BC3A 5K16A 4B55A 3ERVA 1KXRA 9PAPA 1CTEA 4QRVA 1PPPA 1NB5A 1VJVA 2OZ2A 4YYSA 4P6EA 2VHSA 2FTDA 2DCBA 4XR7A 2GHUA 4YYQA 1FH0A 1AECA 1QXPA 4MSXA 4PP2E 2DCCA 2C0YA 3QT4A 4N79A 2YJBA 3PNRA 3U8EA 2FO5A 1TL9A 4WA6A 2AYNA 2HXZA 1CSBB 1MEGA 3BPFA 3H8BA 4YV8A 1AU0A 3M99A 4YYVA 4G54A 3IMAA 2P0RA 3I06A 5F02A 4QBBA 1X9YA 2AYOA 4Q8HA 3MTNA 2ARYA 3PDFA 5CVOB 2E00A 2BSZA 3H8CA 5CHTA 4OELA 2AUXA 2JQFR 4DMYA 1TLOA 2PNSA 3MHSA 1PPNA 2CB5A 3N3GA 4YYWA 1AIMA 2G6DA 2Y6EA 4W4UA 3O1GA 1PE6A 1YK8A 3RVVA 1POPA 2P7UA 1KHPA 5CVNB 2AVWA 3RVXA 3QSDA 3KX1A 1CPJA 1CQDA 2B1NA 1XKGA 2HH5A 1YVBA 1VSNA 2B1MA 3OF8A 2XU4A 3K8UA 1F29A 1S4VA 3E1ZB 4PP1A 2PREA 1PCIA 1NLJA 4YYUA 3CBKA 3KWZA 1NQCA 1W4TA 2YJ9A 4BQVA 3HHAA 2P86A 1MEMA 1AU2A 3F5VA 2FQ9A 2FT2A 2OP3A 2O6XA 4XUIA 2DJFB 3KKUA 7PCKA 2ATOA 4YYRA 4CDCB 4C5PA 3KFQA 3N3KA 1AU4A 3CH3X 4P6GA 5JA7A 1GLOA 3BWKA 3CH2X 2PBHA 3LXSA 3P5VA 4X6IA 1E2TA 1F2CA 2YJCA 3IHPA 1GX3A 1ZIVA 6PADA 2R9NA 3P5UA 1AYWA 1STFE 4FIPA 2DZYA 4I07A 3H7DA 1BQIA 3HWNA 3P5XA 3N4CA 4CZWA 1A6RA 1IWDA 3NHEA 4FJCA 3H6SA 2F1GA 3K9MA 3BOWA 2NQGA 3F75A 2OULA 3C9EA 3AI8A 2BDZA 4W5BA 1HUCB 2VFCA 5CHVA 1O0EA 4QRGA 1M6DA 1THEA 1EF7A 1MDWA 1GMYA 2HD5A 2HHNA 4PI3A 2YJ8A 4QRXA 1U9QX 2ACTA 2PADA 3WXFA 2DCDA 4CDFB 3OVZA 2DCAA 4AXMA 1SNKA 2R9OA 2XU3A 3GCBA 2DC6A 3CBJA 2R9FA 4YVAA 1F2BA 4BS5A 3MORA 1YALA 4ZUXU 4KLBA 4X6HA 2AUZA 3WXEA 5EF4A 3OF9A 2VHFA 3LFYA 1BGOA 3I3TA 3S3RA 1PXVA 4QH6A 1ATKA 1U5IA 5PADA 4X6JA 2AIMA 1GECE 1EWPA 2GFOA 3USVA 1GCBA 3V6EA 1PADA 1DF0A 1ICFA 1AYVA 1EWLA 1TU6A 3MHHA 4CDDB 5J94A 2YJ2A 4RY2A 4N8WA 4K7CA 2E02A 1SP4B 1JQPA 1Q6KA 2XU5A 4BPVA 4Q8GA 4N4ZA 4W5CA 5JH3A 1U9XA 2DC7A 2Y5BA 2WBFX 1NL6A 2BDLA 2DZZA 2DC8A 3TNXA 1ME3A 4FK5A 4HWYA 2E03A 4NV7A 3P5WA 1KHQA 4OEMA 1AYUA 3PBHA 1KFUL 2G8JA 2R6NA 2G8EA 4I05A 1CVZA 2G7YA 2NQIA 3IV2A 1F2AA 1MHWA 3LTWA 1QMYA 4BS6A 3OVXA 2FUDA 1BP4A 3BPMA 2DJGB 1QOLA 2IBIA 3K24A 1PBHA 1YK7A 1PPDA 5EGWA 2FRQA 3DF0A 1AU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PW3 A;  4BSQ A;  1ZCM A;  1CS8 A;  1Y4H A;  3BCN A;  3KWB X;  3IUT A;  4MZO A;  1PPO A;  1CJL A;  2AU1 A;  2R9C A;  4PAD A;  3D6S A;  1NB3 A;  2E01 A;  3RVW A;  8PCH A;  3OIS A;  1EWO A;  4MZS A;  2JQG R;  2R9M A;  5CVM A;  5A24 A;  3IEJ A;  3ZUA A;  3V6C A;  1K3B B;  2CIO A;  1MIR A;  3KSE A;  1ITO A;  3H89 A;  4I04 A;  2DC9 A;  1CB5 A;  4AXL A;  2AS8 A;  2FRA A;  2H7J A;  3HD3 A;  1QDQ A;  4DMX A;  1MS6 A;  1U9V A;  1KFX L;  2F7D A;  4CDE B;  3HHI A;  1YT7 A;  3B79 A;  3KW9 A;  1NPZ A;  5FPW A;  1CV8 A;  1EWM A;  1ME4 A;  1DEU A;  3S3Q A;  3WXG A;  1U9W A;  2XU1 A;  3O0U A;  3QJ3 A;  2NQA A;  1BY8 A;  1PIP A;  2IPP B;  1Y08 A;  3IOQ A;  2FYE A;  2NQD B;  3BC3 A;  5K16 A;  3ERV A;  1KXR A;  9PAP A;  1CTE A;  4QRV A;  1PPP A;  1NB5 A;  1VJV A;  2OZ2 A;  4YYS A;  4P6E A;  2VHS A;  2FTD A;  2DCB A;  4XR7 A;  2GHU A;  4YYQ A;  1FH0 A;  1AEC A;  1QXP A;  4MSX A;  4PP2 E;  2DCC A;  2C0Y A;  3QT4 A;  4N79 A;  2YJB A;  3PNR A;  3U8E A;  2FO5 A;  1TL9 A;  4WA6 A;  2AYN A;  2HXZ A;  1CSB B;  1MEG A;  3BPF A;  3H8B A;  4YV8 A;  1AU0 A;  3M99 A;  4YYV A;  4G54 A;  3IMA A;  2P0R A;  3I06 A;  5F02 A;  4QBB A;  1X9Y A;  2AYO A;  4Q8H A;  3MTN A;  2ARY A;  3PDF A;  5CVO B;  2E00 A;  3H8C A;  5CHT A;  4OEL A;  2AUX A;  2JQF R;  4DMY A;  1TLO A;  2PNS A;  3MHS A;  1PPN A;  2CB5 A;  3N3G A;  4YYW A;  1AIM A;  2G6D A;  2Y6E A;  4W4U A;  3O1G A;  1PE6 A;  1YK8 A;  3RVV A;  1POP A;  2P7U A;  1KHP A;  5CVN B;  2AVW A;  3RVX A;  3QSD A;  1CPJ A;  1CQD A;  2B1N A;  1XKG A;  2HH5 A;  3KX1 A;  1YVB A;  1VSN A;  2B1M A;  3OF8 A;  2XU4 A;  3K8U A;  1F29 A;  1S4V A;  3E1Z B;  4PP1 A;  2PRE A;  1PCI A;  1NLJ A;  4YYU A;  3CBK A;  3KWZ A;  1NQC A;  2YJ9 A;  4BQV A;  3HHA A;  2P86 A;  1MEM A;  1AU2 A;  3F5V A;  2FQ9 A;  2FT2 A;  2OP3 A;  2O6X A;  4XUI A;  2DJF B;  3KKU A;  7PCK A;  2ATO A;  4YYR A;  4CDC B;  3KFQ A;  3N3K A;  1AU4 A;  3CH3 X;  4P6G A;  5JA7 A;  1GLO A;  3BWK A;  3CH2 X;  2PBH A;  3LXS A;  3P5V A;  4X6I A;  1F2C A;  2YJC A;  3IHP A;  1ZIV A;  6PAD A;  2R9N A;  3P5U A;  1AYW A;  1STF E;  4FIP A;  2DZY A;  4I07 A;  3H7D A;  1BQI A;  3HWN A;  3P5X A;  3N4C A;  4CZW A;  1A6R A;  1IWD A;  3NHE A;  4FJC A;  3H6S A;  2F1G A;  3K9M A;  3BOW A;  2NQG A;  3F75 A;  2OUL A;  3C9E A;  3AI8 A;  2BDZ A;  4W5B A;  1HUC B;  5CHV A;  1O0E A;  4QRG A;  1M6D A;  1THE A;  1EF7 A;  1MDW A;  1GMY A;  2HD5 A;  2HHN A;  4PI3 A;  2YJ8 A;  4QRX A;  1U9Q X;  2ACT A;  2PAD A;  3WXF A;  2DCD A;  4CDF B;  3OVZ A;  2DCA A;  4AXM A;  1SNK A;  2R9O A;  2XU3 A;  3GCB A;  2DC6 A;  3CBJ A;  2R9F A;  4YVA A;  1F2B A;  4BS5 A;  3MOR A;  1YAL A;  4ZUX U;  4KLB A;  4X6H A;  2AUZ A;  3WXE A;  5EF4 A;  3OF9 A;  2VHF A;  3LFY A;  1BGO A;  3I3T A;  3S3R A;  1PXV A;  4QH6 A;  1ATK A;  1U5I A;  5PAD A;  4X6J A;  2AIM A;  1GEC E;  1EWP A;  2GFO A;  3USV A;  1GCB A;  3V6E A;  1PAD A;  1DF0 A;  1ICF A;  1AYV A;  1EWL A;  1TU6 A;  3MHH A;  4CDD B;  5J94 A;  2YJ2 A;  4RY2 A;  4N8W A;  4K7C A;  2E02 A;  1SP4 B;  1JQP A;  1Q6K A;  2XU5 A;  4BPV A;  4Q8G A;  4N4Z A;  4W5C A;  5JH3 A;  1U9X A;  2DC7 A;  2Y5B A;  2WBF X;  1NL6 A;  2BDL A;  2DZZ A;  2DC8 A;  3TNX A;  1ME3 A;  4FK5 A;  4HWY A;  2E03 A;  3P5W A;  1KHQ A;  4OEM A;  1AYU A;  3PBH A;  1KFU L;  2G8J A;  2R6N A;  2G8E A;  4I05 A;  1CVZ A;  2G7Y A;  2NQI A;  3IV2 A;  1F2A A;  1MHW A;  1QMY A;  4BS6 A;  3OVX A;  2FUD A;  1BP4 A;  3BPM A;  2DJG B;  1QOL A;  2IBI A;  3K24 A;  1PBH A;  1YK7 A;  1PPD A;  5EGW A;  2FRQ A;  3DF0 A;  1AU3 A; 
#chains in the Genus database with same CATH topology
 3PW3 A;  4BSQ A;  1ZCM A;  1CS8 A;  3C0R A;  1Y4H A;  3BCN A;  3KWB X;  3IUT A;  3PHX A;  3PRP A;  4MZO A;  1PPO A;  1CJL A;  2AU1 A;  5JZE A;  2R9C A;  4PAD A;  3D6S A;  1NB3 A;  2E01 A;  3RVW A;  8PCH A;  3OIS A;  1EWO A;  4MZS A;  2JQG R;  2R9M A;  5CVM A;  5A24 A;  3IEJ A;  3ZUA A;  1UKF A;  3V6C A;  1K3B B;  2CIO A;  2UZJ A;  1MIR A;  3KSE A;  1ITO A;  3H89 A;  4I04 A;  2DC9 A;  4D8B A;  1CB5 A;  4AXL A;  3PHU A;  2AS8 A;  2FRA A;  2H7J A;  3HD3 A;  1QDQ A;  4DMX A;  1MS6 A;  1U9V A;  1KFX L;  2F7D A;  4BOU A;  4CDE B;  3HHI A;  1YT7 A;  3B79 A;  3KW9 A;  1NPZ A;  5FPW A;  1CV8 A;  1EWM A;  1ME4 A;  1DEU A;  3S3Q A;  3WXG A;  1U9W A;  4OW0 A;  2XU1 A;  3O0U A;  3QJ3 A;  2NQA A;  1BY8 A;  1PIP A;  1YZB A;  2IPP B;  1Y08 A;  3IOQ A;  2FYE A;  2NQD B;  2DOS A;  3BC3 A;  5K16 A;  3ERV A;  1KXR A;  9PAP A;  1CTE A;  4QRV A;  1PPP A;  1NB5 A;  1VJV A;  2OZ2 A;  4YYS A;  4P6E A;  2VHS A;  2FTD A;  2DCB A;  4XR7 A;  2GHU A;  4YYQ A;  4REZ A;  1FH0 A;  1AEC A;  1QXP A;  4MSX A;  4PP2 E;  2DCC A;  2C0Y A;  3QT4 A;  2HWK A;  4N79 A;  2YJB A;  4WUR A;  3PNR A;  3U8E A;  2FO5 A;  1TL9 A;  4WA6 A;  2AYN A;  2HXZ A;  1CSB B;  1MEG A;  3BPF A;  3H8B A;  4YV8 A;  1AU0 A;  3M99 A;  4YYV A;  4G54 A;  3IMA A;  2P0R A;  3I06 A;  5F02 A;  4QBB A;  1X9Y A;  2AYO A;  4BOP A;  4Q8H A;  4HXD B;  3MTN A;  4RF0 A;  2ARY A;  3MTV A;  3PDF A;  5CVO B;  2E00 A;  3H8C A;  5CHT A;  4OEL A;  4R3D A;  2AUX A;  2JQF R;  4DMY A;  2BTW A;  1TLO A;  2PNS A;  3PHW A;  3MHS A;  1PPN A;  2CB5 A;  4RKX A;  3N3G A;  4YYW A;  2BTW B;  1AIM A;  2G6D A;  2Y6E A;  4W4U A;  3O1G A;  1PE6 A;  4BOQ A;  1YK8 A;  3RVV A;  1POP A;  3BB7 A;  1DKI A;  2P7U A;  1KHP A;  5CVN B;  2AVW A;  3RVX A;  3IFU A;  3QSD A;  4BOZ A;  1CPJ A;  1CQD A;  2B1N A;  1XKG A;  2HH5 A;  3KX1 A;  1YVB A;  1VSN A;  2B1M A;  4A5U A;  3OF8 A;  2XU4 A;  5E6J A;  3K8U A;  1F29 A;  1S4V A;  3E1Z B;  4P16 A;  4PP1 A;  5KO3 A;  2PRE A;  2Z84 A;  2BU3 A;  1PCI A;  1NLJ A;  4YYU A;  3CBK A;  3KWZ A;  1NQC A;  2YJ9 A;  4BQV A;  3HHA A;  2P86 A;  1MEM A;  1AU2 A;  3F5V A;  2FQ9 A;  2FT2 A;  2OP3 A;  2O6X A;  4XUI A;  2DJF B;  4D8I A;  3KKU A;  7PCK A;  2ATO A;  3BBA A;  4YYR A;  4RNA A;  4MM3 B;  4CDC B;  3KFQ A;  3N3K A;  1AU4 A;  3CH3 X;  4P6G A;  3TRK A;  5JA7 A;  1GLO A;  3BWK A;  3CH2 X;  2PBH A;  3LXS A;  3P5V A;  3PRM A;  4M0W A;  3B21 A;  4X6I A;  4GUA A;  1F2C A;  2YJC A;  3IHP A;  1ZIV A;  6PAD A;  2R9N A;  3P5U A;  1AYW A;  1STF E;  4FIP A;  2DZY A;  4I07 A;  3RNV A;  3H7D A;  1BQI A;  3HWN A;  3P5X A;  3N4C A;  4CZW A;  1A6R A;  4RF1 A;  1IWD A;  3NHE A;  4FJC A;  3H6S A;  2F1G A;  3K9M A;  3BOW A;  2NQG A;  3F75 A;  5EZS A;  2OUL A;  3C9E A;  3AI8 A;  2BDZ A;  4PT5 A;  4OVZ A;  4W5B A;  3W31 A;  1HUC B;  5CHV A;  1O0E A;  4QRG A;  1M6D A;  1THE A;  1EF7 A;  1MDW A;  1GMY A;  4OVZ B;  2HD5 A;  2HHN A;  4PI3 A;  2YJ8 A;  4QRX A;  1U9Q X;  3ZNH A;  2ACT A;  2PAD A;  5EZQ A;  3WXF A;  4D8E A;  2J7Q A;  2DCD A;  4CDF B;  3OVZ A;  2DCA A;  4AXM A;  4XZX A;  1SNK A;  2R9O A;  2XU3 A;  3GCB A;  2DC6 A;  3CBJ A;  2R9F A;  4YVA A;  1F2B A;  4BS5 A;  3TMP A;  3MOR A;  3PT2 A;  1YAL A;  4ZUX U;  4KLB A;  4BOS A;  4X6H A;  2AUZ A;  3WXE A;  5EF4 A;  3OF9 A;  2VHF A;  3LFY A;  1BGO A;  3I3T A;  2AGA A;  3S3R A;  1PXV A;  4QH6 A;  1ATK A;  1U5I A;  1PVJ A;  3MP2 A;  4MI7 A;  5PAD A;  4X6J A;  3O65 A;  2AIM A;  1GEC E;  3E9S A;  1EWP A;  2GFO A;  3USV A;  1GCB A;  3V6E A;  1PAD A;  1DF0 A;  4ZTB A;  1ICF A;  1AYV A;  1EWL A;  1TU6 A;  3MHH A;  4IUM A;  4CDD B;  5J94 A;  2YJ2 A;  3MJ5 A;  2J7Q C;  4RY2 A;  4N8W A;  4K7C A;  2E02 A;  2JRI A;  1SP4 B;  1JQP A;  4IP3 A;  1Q6K A;  2XU5 A;  4BPV A;  4Q8G A;  4N4Z A;  3W30 A;  2FE8 A;  4W5C A;  2JTC A;  5JH3 A;  1U9X A;  2DC7 A;  3BY4 A;  2Y5B A;  2WBF X;  1NL6 A;  2BDL A;  2DZZ A;  2DC8 A;  3TNX A;  1ME3 A;  4FK5 A;  4HWY A;  2E03 A;  3P5W A;  1KHQ A;  4OEM A;  1AYU A;  3OQC A;  3PBH A;  1KFU L;  2G8J A;  2R6N A;  2G8E A;  4I05 A;  1CVZ A;  2G7Y A;  2NQI A;  3IV2 A;  1F2A A;  1MHW A;  1QMY A;  4BS6 A;  3OVX A;  2FUD A;  1BP4 A;  3BPM A;  2DJG B;  1QOL A;  2IBI A;  3K24 A;  1PBH A;  1YK7 A;  1PPD A;  5EGW A;  3PSE A;  2FRQ A;  3DF0 A;  1AU3 A; 
#chains in the Genus database with same CATH homology
 3PW3 A;  4BSQ A;  1ZCM A;  1CS8 A;  1Y4H A;  4BGF A;  3BCN A;  3KWB X;  3IUT A;  4MZO A;  1PPO A;  1CJL A;  2AU1 A;  2R9C A;  4PAD A;  3D6S A;  1NB3 A;  2E01 A;  3RVW A;  1W5R A;  8PCH A;  3OIS A;  1EWO A;  4MZS A;  2JQG R;  2R9M A;  5CVM A;  5A24 A;  3IEJ A;  4GUZ A;  3ZUA A;  3V6C A;  1K3B B;  2CIO A;  1MIR A;  3KSE A;  1ITO A;  3H89 A;  4I04 A;  2DC9 A;  1CB5 A;  4AXL A;  2AS8 A;  2FRA A;  2H7J A;  3HD3 A;  1QDQ A;  4DMX A;  1MS6 A;  1U9V A;  1KFX L;  2F7D A;  4NV8 A;  4CDE B;  3HHI A;  1YT7 A;  3B79 A;  3KW9 A;  1NPZ A;  5FPW A;  1CV8 A;  1EWM A;  1ME4 A;  1DEU A;  3S3Q A;  3WXG A;  1U9W A;  2XU1 A;  1W6F A;  3O0U A;  2NQA A;  3QJ3 A;  1BY8 A;  1PIP A;  2IPP B;  1Y08 A;  3IOQ A;  2FYE A;  2NQD B;  2VFB A;  3D9W A;  3BC3 A;  5K16 A;  4B55 A;  3ERV A;  1KXR A;  9PAP A;  1CTE A;  4QRV A;  1PPP A;  1NB5 A;  1VJV A;  2OZ2 A;  4YYS A;  4P6E A;  2VHS A;  2FTD A;  2DCB A;  4XR7 A;  2GHU A;  4YYQ A;  1FH0 A;  1AEC A;  1QXP A;  4MSX A;  4PP2 E;  2DCC A;  2C0Y A;  3QT4 A;  4N79 A;  2YJB A;  3PNR A;  3U8E A;  2FO5 A;  1TL9 A;  4WA6 A;  2AYN A;  2HXZ A;  1CSB B;  1MEG A;  3BPF A;  3H8B A;  4YV8 A;  1AU0 A;  3M99 A;  4YYV A;  4G54 A;  3IMA A;  2P0R A;  3I06 A;  5F02 A;  4QBB A;  1X9Y A;  2AYO A;  4Q8H A;  3MTN A;  2ARY A;  3PDF A;  5CVO B;  2E00 A;  2BSZ A;  3H8C A;  5CHT A;  4OEL A;  2AUX A;  2JQF R;  4DMY A;  1TLO A;  2PNS A;  3MHS A;  1PPN A;  2CB5 A;  3N3G A;  4YYW A;  1AIM A;  2G6D A;  2Y6E A;  4W4U A;  3O1G A;  1PE6 A;  1YK8 A;  3RVV A;  1POP A;  2P7U A;  1KHP A;  5CVN B;  2AVW A;  3RVX A;  3QSD A;  3KX1 A;  1CPJ A;  1CQD A;  2B1N A;  1XKG A;  2HH5 A;  1YVB A;  1VSN A;  2B1M A;  3OF8 A;  2XU4 A;  3K8U A;  1F29 A;  1S4V A;  3E1Z B;  4PP1 A;  2PRE A;  1PCI A;  1NLJ A;  4YYU A;  3CBK A;  3KWZ A;  1NQC A;  1W4T A;  2YJ9 A;  4BQV A;  3HHA A;  2P86 A;  1MEM A;  1AU2 A;  3F5V A;  2FQ9 A;  2FT2 A;  2OP3 A;  2O6X A;  4XUI A;  2DJF B;  3KKU A;  7PCK A;  2ATO A;  4YYR A;  4CDC B;  4C5P A;  3KFQ A;  3N3K A;  1AU4 A;  3CH3 X;  4P6G A;  5JA7 A;  1GLO A;  3BWK A;  3CH2 X;  2PBH A;  3LXS A;  3P5V A;  4X6I A;  1E2T A;  1F2C A;  2YJC A;  3IHP A;  1GX3 A;  1ZIV A;  6PAD A;  2R9N A;  3P5U A;  1AYW A;  1STF E;  4FIP A;  2DZY A;  4I07 A;  3H7D A;  1BQI A;  3HWN A;  3P5X A;  3N4C A;  4CZW A;  1A6R A;  1IWD A;  3NHE A;  4FJC A;  3H6S A;  2F1G A;  3K9M A;  3BOW A;  2NQG A;  3F75 A;  2OUL A;  3C9E A;  3AI8 A;  2BDZ A;  4W5B A;  1HUC B;  2VFC A;  5CHV A;  1O0E A;  4QRG A;  1M6D A;  1THE A;  1EF7 A;  1MDW A;  1GMY A;  2HD5 A;  2HHN A;  4PI3 A;  2YJ8 A;  4QRX A;  1U9Q X;  2ACT A;  2PAD A;  3WXF A;  2DCD A;  4CDF B;  3OVZ A;  2DCA A;  4AXM A;  1SNK A;  2R9O A;  2XU3 A;  3GCB A;  2DC6 A;  3CBJ A;  2R9F A;  4YVA A;  1F2B A;  4BS5 A;  3MOR A;  1YAL A;  4ZUX U;  4KLB A;  4X6H A;  2AUZ A;  3WXE A;  5EF4 A;  3OF9 A;  2VHF A;  3LFY A;  1BGO A;  3I3T A;  3S3R A;  1PXV A;  4QH6 A;  1ATK A;  1U5I A;  5PAD A;  4X6J A;  2AIM A;  1GEC E;  1EWP A;  2GFO A;  3USV A;  1GCB A;  3V6E A;  1PAD A;  1DF0 A;  1ICF A;  1AYV A;  1EWL A;  1TU6 A;  3MHH A;  4CDD B;  5J94 A;  2YJ2 A;  4RY2 A;  4N8W A;  4K7C A;  2E02 A;  1SP4 B;  1JQP A;  1Q6K A;  2XU5 A;  4BPV A;  4Q8G A;  4N4Z A;  4W5C A;  5JH3 A;  1U9X A;  2DC7 A;  2Y5B A;  2WBF X;  1NL6 A;  2BDL A;  2DZZ A;  2DC8 A;  3TNX A;  1ME3 A;  4FK5 A;  4HWY A;  2E03 A;  4NV7 A;  3P5W A;  1KHQ A;  4OEM A;  1AYU A;  3PBH A;  1KFU L;  2G8J A;  2R6N A;  2G8E A;  4I05 A;  1CVZ A;  2G7Y A;  2NQI A;  3IV2 A;  1F2A A;  1MHW A;  3LTW A;  1QMY A;  4BS6 A;  3OVX A;  2FUD A;  1BP4 A;  3BPM A;  2DJG B;  1QOL A;  2IBI A;  3K24 A;  1PBH A;  1YK7 A;  1PPD A;  5EGW A;  2FRQ A;  3DF0 A;  1AU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...