4BPVA

Mouse cathepsin s with covalent ligand
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
219
structure length
219
Chain Sequence
TLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKAMDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cathepsin S Nitrile Inhibitors
rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords CATHEPSIN S
total genus 68
structure length 219
sequence length 219
chains with identical sequence B, C, D, E, K
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2013-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4bpvA00
2BDZA 3PBHA 4YV8A 1U9XA 3IMAA 1CSBB 3K24A 4Q8HA 2H7JA 2P0RA 3H8BA 2JQFR 1CV8A 2G7YA 2PNSA 3KWZA 3GCBA 2AVWA 5CVNB 1PPPA 3CBKA 3WXGA 1F2AA 4YYWA 1MHWA 1U9VA 4PADA 2DCCA 2HH5A 1MDWA 3O1GA 3MHHA 2VHFA 2YJBA 1SNKA 2ARYA 4I07A 2OP3A 2R9NA 1CVZA 1ZCMA 1PXVA 2PBHA 3S3RA 2AIMA 4MZSA 3RVXA 4P6GA 2G6DA 3NHEA 1U5IA 1F2BA 1YALA 4KLBA 1PADA 2E02A 4QRXA 3K8UA 1THEA 2YJCA 1DEUA 3WXFA 4W5BA 3KSEA 5J94A 4MSXA 3CBJA 2F1GA 1NLJA 1NQCA 2AUXA 4PP1A 3LXSA 3P5XA 5EF4A 5JH3A 4X6HA 2R9CA 2DCBA 2FRAA 4I04A 3F5VA 4N8WA 1MEGA 1PBHA 3BCNA 3C9EA 1QOLA 3PW3A 3WXEA 1YK7A 2R6NA 1JQPA 5A24A 1BP4A 3OVZA 3N3GA 2AU1A 4MZOA 1AU4A 2OULA 1EF7A 1GLOA 1IWDA 4PI3A 1CS8A 3H89A 1AIMA 2PADA 3KX1A 4QRGA 2XU5A 1VSNA 4HWYA 2VHSA 3OF9A 3M99A 2FQ9A 2AYOA 2E01A 2DJGB 3IHPA 3PNRA 4YYRA 1S4VA 3QT4A 1YK8A 2DC7A 3HD3A 2E03A 1A6RA 4DMYA 4XUIA 1YVBA 4I05A 4XR7A 1TU6A 3KFQA 1ATKA 3N3KA 1KFXL 4FK5A 4DMXA 2P7UA 4RY2A 2G8JA 2IPPB 1PPNA 2PREA 4CDCB 3S3QA 2OZ2A 1CTEA 2FUDA 1PPOA 4YYQA 2Y6EA 4P6EA 5CVMA 1GECE 3E1ZB 3OISA 1KXRA 2HXZA 1EWMA 1NB5A 3B79A 3HHAA 1PIPA 2FTDA 1AYVA 4YYUA 1YT7A 2NQIA 1AU3A 4AXMA 1ICFA 3AI8A 1Y08A 1AU0A 1O0EA 1MIRA 2FO5A 2DCDA 2JQGR 2DZZA 2GFOA 4BQVA 1SP4B 5EGWA 4QRVA 2B1NA 2AS8A 2R9OA 4BS5A 1BQIA 1NB3A 4BSQA 4PP2E 2NQGA 2E00A 1AYWA 4AXLA 2IBIA 1X9YA 1AECA 1MEMA 2AYNA 1ITOA 1CJLA 1F29A 3IV2A 3H7DA 1KHQA 3KW9A 1MS6A 2DCAA 2ATOA 2G8EA 3CH2X 5F02A 4BS6A 4FJCA 2XU1A 4QH6A 3K9MA 3U8EA 4X6JA 3MHSA 2DC9A 3I06A 3QSDA 5CVOB 3ZUAA 5CHTA 4YYVA 1F2CA 3DF0A 2HD5A 4CZWA 1KFUL 1EWPA 3D6SA 3HWNA 3H8CA 2XU4A 2HHNA 3BWKA 3P5WA 4ZUXU 1POPA 1PCIA 2NQAA 3OVXA 1BY8A 6PADA 2P86A 2DJFB 5PADA 4WA6A 1CQDA 2FRQA 3MORA 1STFE 3N4CA 3HHIA 1Y4HA 1GCBA 1Q6KA 1QMYA 1PE6A 1AU2A 3USVA 2YJ9A 1QDQA 4G54A 2O6XA 4YVAA 2XU3A 2BDLA 1TL9A 2GHUA 4CDFB 1BGOA 8PCHA 3TNXA 1EWLA 1VJVA 2NQDB 3KWBX 4YYSA 3RVVA 1PPDA 1ME3A 2DC6A 2DC8A 2B1MA 3V6CA 1NPZA 2YJ2A 3O0UA 1AYUA 2R9MA 4X6IA 4BPVA 3PDFA 2FYEA 1ME4A 4Q8GA 3V6EA 2R9FA 1GMYA 7PCKA 3BC3A 1DF0A 3P5VA 4CDDB 3QJ3A 1U9QX 4OELA 3IEJA 3LFYA 1CPJA 9PAPA 3CH3X 2F7DA 3IUTA 3P5UA 4QBBA 1NL6A 5JA7A 2DZYA 5FPWA 2CB5A 4N79A 3MTNA 3KKUA 2CIOA 4W4UA 3BOWA 4CDEB 3ERVA 3I3TA 4OEMA 2WBFX 3H6SA 1TLOA 5CHVA 3F75A 1CB5A 1ZIVA 1XKGA 3BPFA 2C0YA 1KHPA 1FH0A 2AUZA 2ACTA 5K16A 2YJ8A 3IOQA 1HUCB 1K3BB 1EWOA 4FIPA 1QXPA 3OF8A 4K7CA 1U9WA 4W5CA 4N4ZA 1M6DA 2Y5BA 3BPMA 3RVWA 2FT2A
chains in the Genus database with same CATH superfamily
2BDZA 3PBHA 4YV8A 1U9XA 2JTCA 3IMAA 1CSBB 3K24A 4Q8HA 2H7JA 2P0RA 3H8BA 2JQFR 1CV8A 2G7YA 2PNSA 3KWZA 3GCBA 3TMPA 2AVWA 5CVNB 3OQCA 1PPPA 3CBKA 3WXGA 1F2AA 2BTWB 4YYWA 1MHWA 4OVZA 1U9VA 4PADA 2DCCA 2HH5A 1MDWA 3O1GA 4GUAA 3MHHA 2VHFA 2YJBA 1SNKA 2ARYA 4BOZA 4I07A 2OP3A 2R9NA 1CVZA 1ZCMA 1PXVA 2PBHA 3S3RA 2AIMA 4MZSA 3RVXA 4P6GA 2G6DA 3NHEA 1U5IA 1F2BA 1YALA 4KLBA 1PADA 2E02A 4QRXA 3K8UA 1THEA 2YJCA 3O65A 1DEUA 4BOUA 4D8BA 3WXFA 4W5BA 3KSEA 5J94A 4MSXA 2FE8A 3CBJA 3BBAA 2F1GA 1NLJA 1NQCA 2AUXA 4IP3A 4PP1A 4BOPA 3LXSA 3P5XA 5EF4A 5JH3A 4X6HA 2R9CA 2DCBA 2FRAA 4I04A 3F5VA 4N8WA 3BY4A 1MEGA 1PBHA 3BCNA 2Z84A 3C9EA 1QOLA 3PW3A 3WXEA 2AGAA 4HXDB 1YK7A 2R6NA 1JQPA 5A24A 1BP4A 3OVZA 3ZNHA 4RKXA 3N3GA 2AU1A 4MZOA 1AU4A 4OVZB 2OULA 1EF7A 1GLOA 1IWDA 4PI3A 1CS8A 3H89A 1AIMA 2PADA 3KX1A 4QRGA 4A5UA 2XU5A 1VSNA 4HWYA 2VHSA 4RF0A 4REZA 3OF9A 3M99A 2FQ9A 2AYOA 4BOSA 2E01A 2DJGB 3IHPA 4BOQA 3PNRA 4YYRA 1S4VA 3C0RA 3QT4A 1YK8A 2DC7A 3HD3A 2E03A 1A6RA 4DMYA 4XUIA 1YVBA 4I05A 4XR7A 1TU6A 3KFQA 1ATKA 3N3KA 1KFXL 4MI7A 4FK5A 3TRKA 4DMXA 2P7UA 4RY2A 2G8JA 2IPPB 4P16A 1PPNA 2PREA 4CDCB 3S3QA 2OZ2A 1CTEA 3PT2A 2FUDA 1PPOA 2JRIA 3PHXA 4YYQA 2Y6EA 4P6EA 5CVMA 1GECE 3E1ZB 3OISA 1KXRA 2HXZA 1EWMA 1NB5A 3B79A 3HHAA 1PIPA 2FTDA 1AYVA 4YYUA 5JZEA 1YT7A 2NQIA 1AU3A 4AXMA 1ICFA 3AI8A 1Y08A 2J7QC 1AU0A 1O0EA 1MIRA 2FO5A 2DCDA 2JQGR 2DZZA 2GFOA 4BQVA 1SP4B 5EGWA 4QRVA 2B1NA 2AS8A 2R9OA 4BS5A 3W31A 1BQIA 1NB3A 4BSQA 4PP2E 2NQGA 2E00A 1AYWA 4AXLA 2IBIA 1X9YA 1AECA 1MEMA 2AYNA 1ITOA 2HWKA 1CJLA 1F29A 3IV2A 3H7DA 1KHQA 3KW9A 1MS6A 2DCAA 3MP2A 2ATOA 2G8EA 3CH2X 5F02A 4BS6A 4FJCA 2XU1A 4QH6A 3K9MA 3U8EA 4X6JA 3MHSA 5EZSA 2DC9A 3I06A 3QSDA 5CVOB 3ZUAA 5CHTA 4YYVA 4D8IA 1F2CA 3DF0A 2HD5A 4CZWA 1KFUL 1EWPA 3D6SA 3HWNA 3H8CA 2XU4A 2HHNA 3BWKA 3P5WA 4ZUXU 1POPA 4MM3B 1PCIA 2NQAA 3OVXA 1BY8A 6PADA 2P86A 2DJFB 4WA6A 5PADA 3MJ5A 1CQDA 2FRQA 3MORA 1STFE 4RNAA 3PHUA 3N4CA 3HHIA 1Y4HA 1GCBA 1Q6KA 1QMYA 1UKFA 1PE6A 1AU2A 3USVA 3IFUA 2YJ9A 3B21A 1QDQA 1DKIA 4G54A 2O6XA 4YVAA 2XU3A 2BDLA 1TL9A 2GHUA 4CDFB 1BGOA 8PCHA 5E6JA 3TNXA 1EWLA 1VJVA 2DOSA 2NQDB 3KWBX 4YYSA 3RVVA 5KO3A 3PRPA 1PPDA 1ME3A 2DC6A 2DC8A 3PHWA 1PVJA 2B1MA 3V6CA 1NPZA 2YJ2A 3O0UA 1AYUA 2R9MA 4X6IA 4BPVA 3PDFA 2FYEA 1ME4A 4Q8GA 3V6EA 4D8EA 2R9FA 1GMYA 4M0WA 7PCKA 3BC3A 4XZXA 3RNVA 3PRMA 1DF0A 3P5VA 4OW0A 4CDDB 3QJ3A 1U9QX 4OELA 2BU3A 3IEJA 3LFYA 1CPJA 9PAPA 3CH3X 2F7DA 3IUTA 3E9SA 3P5UA 4QBBA 1NL6A 5JA7A 4RF1A 2UZJA 2DZYA 5FPWA 2CB5A 4N79A 3MTNA 3KKUA 2CIOA 4W4UA 3BOWA 4ZTBA 4CDEB 3ERVA 3I3TA 2BTWA 4OEMA 2WBFX 3H6SA 3PSEA 1TLOA 5CHVA 3F75A 4IUMA 1CB5A 1ZIVA 1XKGA 3BPFA 2C0YA 1YZBA 3W30A 1KHPA 1FH0A 3BB7A 2AUZA 2ACTA 5K16A 4PT5A 3MTVA 2YJ8A 3IOQA 1HUCB 1K3BB 1EWOA 2J7QA 4FIPA 1QXPA 3OF8A 4K7CA 1U9WA 4W5CA 4N4ZA 1M6DA 5EZQA 4R3DA 4WURA 2Y5BA 3BPMA 3RVWA 2FT2A
chains in the Genus database with same CATH topology
2BDZA 3PBHA 4YV8A 1U9XA 3IMAA 1CSBB 3K24A 4Q8HA 2H7JA 2P0RA 3H8BA 2JQFR 1CV8A 1W4TA 2G7YA 2PNSA 3KWZA 3GCBA 2AVWA 5CVNB 1PPPA 3CBKA 3WXGA 1F2AA 4YYWA 1MHWA 1U9VA 4PADA 2DCCA 2HH5A 1MDWA 3O1GA 3MHHA 2VHFA 2YJBA 1SNKA 2VFCA 2ARYA 4I07A 2OP3A 2R9NA 1CVZA 1ZCMA 1PXVA 2PBHA 3S3RA 2AIMA 4MZSA 3RVXA 4P6GA 2G6DA 3NHEA 1U5IA 1F2BA 1YALA 4KLBA 1PADA 2E02A 4QRXA 3K8UA 1THEA 2YJCA 1DEUA 3WXFA 4W5BA 3KSEA 5J94A 4MSXA 3CBJA 2F1GA 1NLJA 1NQCA 2AUXA 4PP1A 3LXSA 3P5XA 5EF4A 5JH3A 4X6HA 2R9CA 2DCBA 2FRAA 4I04A 3F5VA 4N8WA 1MEGA 1PBHA 3BCNA 3C9EA 1QOLA 3PW3A 3WXEA 1YK7A 2R6NA 1JQPA 5A24A 1BP4A 3OVZA 3N3GA 2AU1A 4MZOA 1AU4A 2OULA 1EF7A 1GLOA 1IWDA 4PI3A 1CS8A 3H89A 1AIMA 2PADA 3KX1A 4QRGA 2XU5A 1VSNA 4HWYA 2VHSA 3OF9A 3M99A 2FQ9A 2AYOA 2E01A 2DJGB 3IHPA 3PNRA 4YYRA 1S4VA 3QT4A 1YK8A 2DC7A 3HD3A 2E03A 1A6RA 4DMYA 4XUIA 1YVBA 4I05A 4XR7A 1TU6A 3KFQA 1ATKA 3N3KA 1KFXL 4FK5A 4DMXA 1W6FA 2P7UA 4RY2A 2G8JA 2IPPB 1PPNA 2PREA 4CDCB 3S3QA 2OZ2A 1CTEA 2FUDA 1PPOA 1GX3A 4YYQA 2Y6EA 4P6EA 5CVMA 1GECE 3E1ZB 3OISA 1KXRA 2HXZA 1EWMA 1NB5A 3B79A 3HHAA 1PIPA 2FTDA 1AYVA 4YYUA 1YT7A 2NQIA 1AU3A 4AXMA 1ICFA 3AI8A 1Y08A 1AU0A 1E2TA 1O0EA 1MIRA 2FO5A 2DCDA 2JQGR 2DZZA 2GFOA 4BQVA 1SP4B 5EGWA 4QRVA 2B1NA 2AS8A 2R9OA 4BS5A 1BQIA 1NB3A 4BSQA 4PP2E 2NQGA 2E00A 1AYWA 4AXLA 2IBIA 1X9YA 1AECA 1MEMA 2AYNA 1ITOA 1CJLA 1F29A 3IV2A 3H7DA 1KHQA 3KW9A 1MS6A 2DCAA 2ATOA 2G8EA 3CH2X 5F02A 4BS6A 4FJCA 4QH6A 2XU1A 3K9MA 3U8EA 4X6JA 3MHSA 2DC9A 3I06A 3QSDA 5CVOB 3ZUAA 5CHTA 4YYVA 1F2CA 3DF0A 2HD5A 4CZWA 1KFUL 1EWPA 3D6SA 3HWNA 3H8CA 2XU4A 2HHNA 3BWKA 3P5WA 4ZUXU 1POPA 2VFBA 1PCIA 2NQAA 3OVXA 1BY8A 6PADA 2P86A 2DJFB 4WA6A 5PADA 4C5PA 1CQDA 2FRQA 3MORA 1STFE 2BSZA 3N4CA 3HHIA 1Y4HA 1GCBA 1Q6KA 1QMYA 1PE6A 1AU2A 3LTWA 3USVA 2YJ9A 1QDQA 4G54A 4B55A 2O6XA 4YVAA 2XU3A 2BDLA 1TL9A 2GHUA 4CDFB 1BGOA 8PCHA 3TNXA 1EWLA 1VJVA 2NQDB 3KWBX 4YYSA 3RVVA 1PPDA 1ME3A 2DC6A 2DC8A 2B1MA 3V6CA 1NPZA 3D9WA 2YJ2A 3O0UA 1AYUA 2R9MA 4X6IA 4BPVA 3PDFA 2FYEA 1ME4A 4Q8GA 3V6EA 2R9FA 1GMYA 7PCKA 4BGFA 3BC3A 4NV8A 1DF0A 3P5VA 4CDDB 1W5RA 3QJ3A 1U9QX 4OELA 3IEJA 3LFYA 1CPJA 9PAPA 3CH3X 2F7DA 3IUTA 3P5UA 4QBBA 1NL6A 5JA7A 2DZYA 5FPWA 2CB5A 4N79A 3MTNA 3KKUA 2CIOA 4W4UA 3BOWA 4CDEB 3ERVA 3I3TA 4OEMA 2WBFX 3H6SA 1TLOA 5CHVA 3F75A 1CB5A 1ZIVA 1XKGA 4NV7A 3BPFA 2C0YA 4GUZA 1KHPA 1FH0A 2AUZA 2ACTA 5K16A 2YJ8A 3IOQA 1HUCB 1K3BB 1EWOA 4FIPA 1QXPA 3OF8A 4K7CA 1U9WA 4W5CA 4N4ZA 1M6DA 2Y5BA 3BPMA 3RVWA 2FT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BDZ A;  3PBH A;  4YV8 A;  1U9X A;  3IMA A;  1CSB B;  3K24 A;  4Q8H A;  2H7J A;  2P0R A;  3H8B A;  2JQF R;  1CV8 A;  2G7Y A;  2PNS A;  3KWZ A;  3GCB A;  2AVW A;  5CVN B;  1PPP A;  3CBK A;  3WXG A;  1F2A A;  4YYW A;  1MHW A;  1U9V A;  4PAD A;  2DCC A;  2HH5 A;  1MDW A;  3O1G A;  3MHH A;  2VHF A;  2YJB A;  1SNK A;  2ARY A;  4I07 A;  2OP3 A;  2R9N A;  1CVZ A;  1ZCM A;  1PXV A;  2PBH A;  3S3R A;  2AIM A;  4MZS A;  3RVX A;  4P6G A;  2G6D A;  3NHE A;  1U5I A;  1F2B A;  1YAL A;  4KLB A;  1PAD A;  2E02 A;  4QRX A;  3K8U A;  1THE A;  2YJC A;  1DEU A;  3WXF A;  4W5B A;  3KSE A;  5J94 A;  4MSX A;  3CBJ A;  2F1G A;  1NLJ A;  1NQC A;  2AUX A;  4PP1 A;  3LXS A;  3P5X A;  5EF4 A;  5JH3 A;  4X6H A;  2R9C A;  2DCB A;  2FRA A;  4I04 A;  3F5V A;  4N8W A;  1MEG A;  1PBH A;  3BCN A;  3C9E A;  1QOL A;  3PW3 A;  3WXE A;  1YK7 A;  2R6N A;  1JQP A;  5A24 A;  1BP4 A;  3OVZ A;  3N3G A;  2AU1 A;  4MZO A;  1AU4 A;  2OUL A;  1EF7 A;  1GLO A;  1IWD A;  4PI3 A;  1CS8 A;  3H89 A;  1AIM A;  2PAD A;  3KX1 A;  4QRG A;  2XU5 A;  1VSN A;  4HWY A;  2VHS A;  3OF9 A;  3M99 A;  2FQ9 A;  2AYO A;  2E01 A;  2DJG B;  3IHP A;  3PNR A;  4YYR A;  1S4V A;  3QT4 A;  1YK8 A;  2DC7 A;  3HD3 A;  2E03 A;  1A6R A;  4DMY A;  4XUI A;  1YVB A;  4I05 A;  4XR7 A;  1TU6 A;  3KFQ A;  1ATK A;  3N3K A;  1KFX L;  4FK5 A;  4DMX A;  2P7U A;  4RY2 A;  2G8J A;  2IPP B;  1PPN A;  2PRE A;  4CDC B;  3S3Q A;  2OZ2 A;  1CTE A;  2FUD A;  1PPO A;  4YYQ A;  2Y6E A;  4P6E A;  5CVM A;  1GEC E;  3E1Z B;  3OIS A;  1KXR A;  2HXZ A;  1EWM A;  1NB5 A;  3B79 A;  3HHA A;  1PIP A;  2FTD A;  1AYV A;  4YYU A;  1YT7 A;  2NQI A;  1AU3 A;  4AXM A;  1ICF A;  3AI8 A;  1Y08 A;  1AU0 A;  1O0E A;  1MIR A;  2FO5 A;  2DCD A;  2JQG R;  2DZZ A;  2GFO A;  4BQV A;  1SP4 B;  5EGW A;  4QRV A;  2B1N A;  2AS8 A;  2R9O A;  4BS5 A;  1BQI A;  1NB3 A;  4BSQ A;  4PP2 E;  2NQG A;  2E00 A;  1AYW A;  4AXL A;  2IBI A;  1X9Y A;  1AEC A;  1MEM A;  2AYN A;  1ITO A;  1CJL A;  1F29 A;  3IV2 A;  3H7D A;  1KHQ A;  3KW9 A;  1MS6 A;  2DCA A;  2ATO A;  2G8E A;  3CH2 X;  5F02 A;  4BS6 A;  4FJC A;  2XU1 A;  4QH6 A;  3K9M A;  3U8E A;  4X6J A;  3MHS A;  2DC9 A;  3I06 A;  3QSD A;  5CVO B;  3ZUA A;  5CHT A;  4YYV A;  1F2C A;  3DF0 A;  2HD5 A;  4CZW A;  1KFU L;  1EWP A;  3D6S A;  3HWN A;  3H8C A;  2XU4 A;  2HHN A;  3BWK A;  3P5W A;  4ZUX U;  1POP A;  1PCI A;  2NQA A;  3OVX A;  1BY8 A;  6PAD A;  2P86 A;  2DJF B;  5PAD A;  4WA6 A;  1CQD A;  2FRQ A;  3MOR A;  1STF E;  3N4C A;  3HHI A;  1Y4H A;  1GCB A;  1Q6K A;  1QMY A;  1PE6 A;  1AU2 A;  3USV A;  2YJ9 A;  1QDQ A;  4G54 A;  2O6X A;  4YVA A;  2XU3 A;  2BDL A;  1TL9 A;  2GHU A;  4CDF B;  1BGO A;  8PCH A;  3TNX A;  1EWL A;  1VJV A;  2NQD B;  3KWB X;  4YYS A;  3RVV A;  1PPD A;  1ME3 A;  2DC6 A;  2DC8 A;  2B1M A;  3V6C A;  1NPZ A;  2YJ2 A;  3O0U A;  1AYU A;  2R9M A;  4X6I A;  4BPV A;  3PDF A;  2FYE A;  1ME4 A;  4Q8G A;  3V6E A;  2R9F A;  1GMY A;  7PCK A;  3BC3 A;  1DF0 A;  3P5V A;  4CDD B;  3QJ3 A;  1U9Q X;  4OEL A;  3IEJ A;  3LFY A;  1CPJ A;  9PAP A;  3CH3 X;  2F7D A;  3IUT A;  3P5U A;  4QBB A;  1NL6 A;  5JA7 A;  2DZY A;  5FPW A;  2CB5 A;  4N79 A;  3MTN A;  3KKU A;  2CIO A;  4W4U A;  3BOW A;  4CDE B;  3ERV A;  3I3T A;  4OEM A;  2WBF X;  3H6S A;  1TLO A;  5CHV A;  3F75 A;  1CB5 A;  1ZIV A;  1XKG A;  3BPF A;  2C0Y A;  1KHP A;  1FH0 A;  2AUZ A;  2ACT A;  5K16 A;  2YJ8 A;  3IOQ A;  1HUC B;  1K3B B;  1EWO A;  4FIP A;  1QXP A;  3OF8 A;  4K7C A;  1U9W A;  4W5C A;  4N4Z A;  1M6D A;  2Y5B A;  3BPM A;  3RVW A;  2FT2 A; 
#chains in the Genus database with same CATH topology
 2BDZ A;  3PBH A;  4YV8 A;  1U9X A;  2JTC A;  3IMA A;  1CSB B;  3K24 A;  4Q8H A;  2H7J A;  2P0R A;  3H8B A;  2JQF R;  1CV8 A;  2G7Y A;  2PNS A;  3KWZ A;  3GCB A;  3TMP A;  2AVW A;  5CVN B;  3OQC A;  1PPP A;  3CBK A;  3WXG A;  1F2A A;  2BTW B;  4YYW A;  1MHW A;  4OVZ A;  1U9V A;  4PAD A;  2DCC A;  2HH5 A;  1MDW A;  3O1G A;  4GUA A;  3MHH A;  2VHF A;  2YJB A;  1SNK A;  2ARY A;  4BOZ A;  4I07 A;  2OP3 A;  2R9N A;  1CVZ A;  1ZCM A;  1PXV A;  2PBH A;  3S3R A;  2AIM A;  4MZS A;  3RVX A;  4P6G A;  2G6D A;  3NHE A;  1U5I A;  1F2B A;  1YAL A;  4KLB A;  1PAD A;  2E02 A;  4QRX A;  3K8U A;  1THE A;  2YJC A;  3O65 A;  1DEU A;  4BOU A;  4D8B A;  3WXF A;  4W5B A;  3KSE A;  5J94 A;  4MSX A;  2FE8 A;  3CBJ A;  3BBA A;  2F1G A;  1NLJ A;  1NQC A;  2AUX A;  4IP3 A;  4PP1 A;  4BOP A;  3LXS A;  3P5X A;  5EF4 A;  5JH3 A;  4X6H A;  2R9C A;  2DCB A;  2FRA A;  4I04 A;  3F5V A;  4N8W A;  3BY4 A;  1MEG A;  1PBH A;  3BCN A;  2Z84 A;  3C9E A;  1QOL A;  3PW3 A;  3WXE A;  2AGA A;  4HXD B;  1YK7 A;  2R6N A;  1JQP A;  5A24 A;  1BP4 A;  3OVZ A;  3ZNH A;  4RKX A;  3N3G A;  2AU1 A;  4MZO A;  1AU4 A;  4OVZ B;  2OUL A;  1EF7 A;  1GLO A;  1IWD A;  4PI3 A;  1CS8 A;  3H89 A;  1AIM A;  2PAD A;  3KX1 A;  4QRG A;  4A5U A;  2XU5 A;  1VSN A;  4HWY A;  2VHS A;  4RF0 A;  4REZ A;  3OF9 A;  3M99 A;  2FQ9 A;  2AYO A;  4BOS A;  2E01 A;  2DJG B;  3IHP A;  4BOQ A;  3PNR A;  4YYR A;  1S4V A;  3C0R A;  3QT4 A;  1YK8 A;  2DC7 A;  3HD3 A;  2E03 A;  1A6R A;  4DMY A;  4XUI A;  1YVB A;  4I05 A;  4XR7 A;  1TU6 A;  3KFQ A;  1ATK A;  3N3K A;  1KFX L;  4MI7 A;  4FK5 A;  3TRK A;  4DMX A;  2P7U A;  4RY2 A;  2G8J A;  2IPP B;  4P16 A;  1PPN A;  2PRE A;  4CDC B;  3S3Q A;  2OZ2 A;  1CTE A;  3PT2 A;  2FUD A;  1PPO A;  2JRI A;  3PHX A;  4YYQ A;  2Y6E A;  4P6E A;  5CVM A;  1GEC E;  3E1Z B;  3OIS A;  1KXR A;  2HXZ A;  1EWM A;  1NB5 A;  3B79 A;  3HHA A;  1PIP A;  2FTD A;  1AYV A;  4YYU A;  5JZE A;  1YT7 A;  2NQI A;  1AU3 A;  4AXM A;  1ICF A;  3AI8 A;  1Y08 A;  2J7Q C;  1AU0 A;  1O0E A;  1MIR A;  2FO5 A;  2DCD A;  2JQG R;  2DZZ A;  2GFO A;  4BQV A;  1SP4 B;  5EGW A;  4QRV A;  2B1N A;  2AS8 A;  2R9O A;  4BS5 A;  3W31 A;  1BQI A;  1NB3 A;  4BSQ A;  4PP2 E;  2NQG A;  2E00 A;  1AYW A;  4AXL A;  2IBI A;  1X9Y A;  1AEC A;  1MEM A;  2AYN A;  1ITO A;  2HWK A;  1CJL A;  1F29 A;  3IV2 A;  3H7D A;  1KHQ A;  3KW9 A;  1MS6 A;  2DCA A;  3MP2 A;  2ATO A;  2G8E A;  3CH2 X;  5F02 A;  4BS6 A;  4FJC A;  2XU1 A;  4QH6 A;  3K9M A;  3U8E A;  4X6J A;  3MHS A;  5EZS A;  2DC9 A;  3I06 A;  3QSD A;  5CVO B;  3ZUA A;  5CHT A;  4YYV A;  4D8I A;  1F2C A;  3DF0 A;  2HD5 A;  4CZW A;  1KFU L;  1EWP A;  3D6S A;  3HWN A;  3H8C A;  2XU4 A;  2HHN A;  3BWK A;  3P5W A;  4ZUX U;  1POP A;  4MM3 B;  1PCI A;  2NQA A;  3OVX A;  1BY8 A;  6PAD A;  2P86 A;  2DJF B;  4WA6 A;  5PAD A;  3MJ5 A;  1CQD A;  2FRQ A;  3MOR A;  1STF E;  4RNA A;  3PHU A;  3N4C A;  3HHI A;  1Y4H A;  1GCB A;  1Q6K A;  1QMY A;  1UKF A;  1PE6 A;  1AU2 A;  3USV A;  3IFU A;  2YJ9 A;  3B21 A;  1QDQ A;  1DKI A;  4G54 A;  2O6X A;  4YVA A;  2XU3 A;  2BDL A;  1TL9 A;  2GHU A;  4CDF B;  1BGO A;  8PCH A;  5E6J A;  3TNX A;  1EWL A;  1VJV A;  2DOS A;  2NQD B;  3KWB X;  4YYS A;  3RVV A;  5KO3 A;  3PRP A;  1PPD A;  1ME3 A;  2DC6 A;  2DC8 A;  3PHW A;  1PVJ A;  2B1M A;  3V6C A;  1NPZ A;  2YJ2 A;  3O0U A;  1AYU A;  2R9M A;  4X6I A;  4BPV A;  3PDF A;  2FYE A;  1ME4 A;  4Q8G A;  3V6E A;  4D8E A;  2R9F A;  1GMY A;  4M0W A;  7PCK A;  3BC3 A;  4XZX A;  3RNV A;  3PRM A;  1DF0 A;  3P5V A;  4OW0 A;  4CDD B;  3QJ3 A;  1U9Q X;  4OEL A;  2BU3 A;  3IEJ A;  3LFY A;  1CPJ A;  9PAP A;  3CH3 X;  2F7D A;  3IUT A;  3E9S A;  3P5U A;  4QBB A;  1NL6 A;  5JA7 A;  4RF1 A;  2UZJ A;  2DZY A;  5FPW A;  2CB5 A;  4N79 A;  3MTN A;  3KKU A;  2CIO A;  4W4U A;  3BOW A;  4ZTB A;  4CDE B;  3ERV A;  3I3T A;  2BTW A;  4OEM A;  2WBF X;  3H6S A;  3PSE A;  1TLO A;  5CHV A;  3F75 A;  4IUM A;  1CB5 A;  1ZIV A;  1XKG A;  3BPF A;  2C0Y A;  1YZB A;  3W30 A;  1KHP A;  1FH0 A;  3BB7 A;  2AUZ A;  2ACT A;  5K16 A;  4PT5 A;  3MTV A;  2YJ8 A;  3IOQ A;  1HUC B;  1K3B B;  1EWO A;  2J7Q A;  4FIP A;  1QXP A;  3OF8 A;  4K7C A;  1U9W A;  4W5C A;  4N4Z A;  1M6D A;  5EZQ A;  4R3D A;  4WUR A;  2Y5B A;  3BPM A;  3RVW A;  2FT2 A; 
#chains in the Genus database with same CATH homology
 2BDZ A;  3PBH A;  4YV8 A;  1U9X A;  3IMA A;  1CSB B;  3K24 A;  4Q8H A;  2H7J A;  2P0R A;  3H8B A;  2JQF R;  1CV8 A;  1W4T A;  2G7Y A;  2PNS A;  3KWZ A;  3GCB A;  2AVW A;  5CVN B;  1PPP A;  3CBK A;  3WXG A;  1F2A A;  4YYW A;  1MHW A;  1U9V A;  4PAD A;  2DCC A;  2HH5 A;  1MDW A;  3O1G A;  3MHH A;  2VHF A;  2YJB A;  1SNK A;  2VFC A;  2ARY A;  4I07 A;  2OP3 A;  2R9N A;  1CVZ A;  1ZCM A;  1PXV A;  2PBH A;  3S3R A;  2AIM A;  4MZS A;  3RVX A;  4P6G A;  2G6D A;  3NHE A;  1U5I A;  1F2B A;  1YAL A;  4KLB A;  1PAD A;  2E02 A;  4QRX A;  3K8U A;  1THE A;  2YJC A;  1DEU A;  3WXF A;  4W5B A;  3KSE A;  5J94 A;  4MSX A;  3CBJ A;  2F1G A;  1NLJ A;  1NQC A;  2AUX A;  4PP1 A;  3LXS A;  3P5X A;  5EF4 A;  5JH3 A;  4X6H A;  2R9C A;  2DCB A;  2FRA A;  4I04 A;  3F5V A;  4N8W A;  1MEG A;  1PBH A;  3BCN A;  3C9E A;  1QOL A;  3PW3 A;  3WXE A;  1YK7 A;  2R6N A;  1JQP A;  5A24 A;  1BP4 A;  3OVZ A;  3N3G A;  2AU1 A;  4MZO A;  1AU4 A;  2OUL A;  1EF7 A;  1GLO A;  1IWD A;  4PI3 A;  1CS8 A;  3H89 A;  1AIM A;  2PAD A;  3KX1 A;  4QRG A;  2XU5 A;  1VSN A;  4HWY A;  2VHS A;  3OF9 A;  3M99 A;  2FQ9 A;  2AYO A;  2E01 A;  2DJG B;  3IHP A;  3PNR A;  4YYR A;  1S4V A;  3QT4 A;  1YK8 A;  2DC7 A;  3HD3 A;  2E03 A;  1A6R A;  4DMY A;  4XUI A;  1YVB A;  4I05 A;  4XR7 A;  1TU6 A;  3KFQ A;  1ATK A;  3N3K A;  1KFX L;  4FK5 A;  4DMX A;  1W6F A;  2P7U A;  4RY2 A;  2G8J A;  2IPP B;  1PPN A;  2PRE A;  4CDC B;  3S3Q A;  2OZ2 A;  1CTE A;  2FUD A;  1PPO A;  1GX3 A;  4YYQ A;  2Y6E A;  4P6E A;  5CVM A;  1GEC E;  3E1Z B;  3OIS A;  1KXR A;  2HXZ A;  1EWM A;  1NB5 A;  3B79 A;  3HHA A;  1PIP A;  2FTD A;  1AYV A;  4YYU A;  1YT7 A;  2NQI A;  1AU3 A;  4AXM A;  1ICF A;  3AI8 A;  1Y08 A;  1AU0 A;  1E2T A;  1O0E A;  1MIR A;  2FO5 A;  2DCD A;  2JQG R;  2DZZ A;  2GFO A;  4BQV A;  1SP4 B;  5EGW A;  4QRV A;  2B1N A;  2AS8 A;  2R9O A;  4BS5 A;  1BQI A;  1NB3 A;  4BSQ A;  4PP2 E;  2NQG A;  2E00 A;  1AYW A;  4AXL A;  2IBI A;  1X9Y A;  1AEC A;  1MEM A;  2AYN A;  1ITO A;  1CJL A;  1F29 A;  3IV2 A;  3H7D A;  1KHQ A;  3KW9 A;  1MS6 A;  2DCA A;  2ATO A;  2G8E A;  3CH2 X;  5F02 A;  4BS6 A;  4FJC A;  4QH6 A;  2XU1 A;  3K9M A;  3U8E A;  4X6J A;  3MHS A;  2DC9 A;  3I06 A;  3QSD A;  5CVO B;  3ZUA A;  5CHT A;  4YYV A;  1F2C A;  3DF0 A;  2HD5 A;  4CZW A;  1KFU L;  1EWP A;  3D6S A;  3HWN A;  3H8C A;  2XU4 A;  2HHN A;  3BWK A;  3P5W A;  4ZUX U;  1POP A;  2VFB A;  1PCI A;  2NQA A;  3OVX A;  1BY8 A;  6PAD A;  2P86 A;  2DJF B;  4WA6 A;  5PAD A;  4C5P A;  1CQD A;  2FRQ A;  3MOR A;  1STF E;  2BSZ A;  3N4C A;  3HHI A;  1Y4H A;  1GCB A;  1Q6K A;  1QMY A;  1PE6 A;  1AU2 A;  3LTW A;  3USV A;  2YJ9 A;  1QDQ A;  4G54 A;  4B55 A;  2O6X A;  4YVA A;  2XU3 A;  2BDL A;  1TL9 A;  2GHU A;  4CDF B;  1BGO A;  8PCH A;  3TNX A;  1EWL A;  1VJV A;  2NQD B;  3KWB X;  4YYS A;  3RVV A;  1PPD A;  1ME3 A;  2DC6 A;  2DC8 A;  2B1M A;  3V6C A;  1NPZ A;  3D9W A;  2YJ2 A;  3O0U A;  1AYU A;  2R9M A;  4X6I A;  4BPV A;  3PDF A;  2FYE A;  1ME4 A;  4Q8G A;  3V6E A;  2R9F A;  1GMY A;  7PCK A;  4BGF A;  3BC3 A;  4NV8 A;  1DF0 A;  3P5V A;  4CDD B;  1W5R A;  3QJ3 A;  1U9Q X;  4OEL A;  3IEJ A;  3LFY A;  1CPJ A;  9PAP A;  3CH3 X;  2F7D A;  3IUT A;  3P5U A;  4QBB A;  1NL6 A;  5JA7 A;  2DZY A;  5FPW A;  2CB5 A;  4N79 A;  3MTN A;  3KKU A;  2CIO A;  4W4U A;  3BOW A;  4CDE B;  3ERV A;  3I3T A;  4OEM A;  2WBF X;  3H6S A;  1TLO A;  5CHV A;  3F75 A;  1CB5 A;  1ZIV A;  1XKG A;  4NV7 A;  3BPF A;  2C0Y A;  4GUZ A;  1KHP A;  1FH0 A;  2AUZ A;  2ACT A;  5K16 A;  2YJ8 A;  3IOQ A;  1HUC B;  1K3B B;  1EWO A;  4FIP A;  1QXP A;  3OF8 A;  4K7C A;  1U9W A;  4W5C A;  4N4Z A;  1M6D A;  2Y5B A;  3BPM A;  3RVW A;  2FT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...