4BPVA

Mouse cathepsin s with covalent ligand
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
219
structure length
219
Chain Sequence
b'TLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKAMDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN S
molecule tags Hydrolase
source organism Mus musculus
publication title Cathepsin S Nitrile Inhibitors
rcsb
total genus 68
structure length 219
sequence length 219
chains with identical sequence B, C, D, E, K
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2013-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4bpvA00
2F7DA 8PCHA 1U9WA 2DCCA 2YJ8A 5CHVA 3IV2A 4I05A 4CDFB 2C0YA 2DJFB 3BC3A 3TNXA 2FYEA 1GMYA 1QOLA 4CDDB 1Y4HA 1ATKA 2FUDA 1AECA 5FPWA 3QT4A 1KHPA 1FH0A 1PXVA 1DF0A 3RVWA 2E01A 1PE6A 3HWNA 3MTNA 2AUZA 3KKUA 2PREA 3QJ3A 4PP1A 3ERVA 1ITOA 3C9EA 5JA7A 2GHUA 2HHNA 3KWZA 4QH6A 4FJCA 1CVZA 1U9QX 4QRXA 2FQ9A 4PI3A 1ME3A 2Y5BA 3K24A 2G6DA 1STFE 3K8UA 2HH5A 1KHQA 1IWDA 2DC7A 4XUIA 2PNSA 5CVMA 2DZYA 3U8EA 4YV8A 1CQDA 2HD5A 3S3QA 1NB5A 3S3RA 2OP3A 1CV8A 3QSDA 3E1ZB 2CIOA 1CJLA 2FT2A 2G8JA 1HUCB 3P5WA 3BOWA 3KW9A 2ARYA 3LXSA 4KLBA 2YJ9A 2FO5A 1QXPA 2AYOA 4QBBA 2XU3A 2YJCA 3HD3A 3F5VA 1BP4A 3I3TA 3V6CA 4G54A 3CH2X 3V6EA 2Y6EA 1PBHA 2P7UA 1NB3A 1PPOA 3ZUAA 1AYWA 3P5VA 1BGOA 4MZOA 1SP4B 2F1GA 1BY8A 1DEUA 5EF4A 2XU1A 2NQAA 2GFOA 2BDLA 2AIMA 1POPA 4FK5A 3MHSA 1CPJA 5PADA 4RY2A 1KFXL 5CVNB 1NLJA 4Q8HA 2R9FA 3BPFA 5EGWA 1AIMA 1QMYA 2P0RA 3OF8A 2ATOA 1AYVA 1TU6A 1ME4A 1PPDA 1M6DA 5JH3A 3NHEA 4W4UA 1EWPA 2P86A 1MS6A 3MORA 4N79A 3AI8A 3BCNA 1U5IA 6PADA 2FRAA 3WXEA 2DCBA 3OVXA 2AS8A 2E02A 2HXZA 2XU4A 1GLOA 3IHPA 7PCKA 4I07A 1EWOA 2OULA 1O0EA 4YYUA 1AU3A 2PBHA 3OISA 3MHHA 3RVVA 2FTDA 4N8WA 2OZ2A 2H7JA 3H6SA 2DC9A 2B1NA 3OF9A 1NL6A 4BSQA 2VHFA 2NQIA 4MZSA 4I04A 1GECE 2FRQA 3P5XA 4W5CA 2NQGA 4OELA 2NQDB 3M99A 4X6IA 4HWYA 1PADA 1MIRA 4YYWA 1AU4A 4CDEB 3PNRA 3KFQA 1U9VA 3N3KA 2DCAA 3USVA 2O6XA 3N4CA 2R6NA 1CS8A 3PBHA 1F2AA 3P5UA 1A6RA 3HHAA 3H89A 2AU1A 1Q6KA 3O0UA 4YVAA 1F29A 3LFYA 4BS5A 2G7YA 3H7DA 1ZIVA 2JQFR 1S4VA 2VHSA 4PADA 3B79A 2DC8A 4K7CA 3OVZA 1VSNA 3BPMA 5CVOB 1X9YA 4Q8GA 1AYUA 1QDQA 1F2CA 1K3BB 4AXLA 2ACTA 3K9MA 2WBFX 3KWBX 4PP2E 1CTEA 3WXGA 2R9CA 4AXMA 3CH3X 1MEMA 3WXFA 2R9OA 2AVWA 1VJVA 2AYNA 1YALA 2R9NA 4X6JA 2AUXA 3KSEA 3O1GA 3CBKA 3IMAA 1U9XA 2XU5A 1SNKA 2E00A 4P6EA 3RVXA 1THEA 1YT7A 4FIPA 1JQPA 1MDWA 3H8BA 1EF7A 2PADA 4CDCB 4DMXA 1PPPA 2IBIA 2R9MA 1YVBA 2DZZA 1KFUL 3BWKA 2YJBA 4W5BA 1PIPA 5K16A 3KX1A 1ICFA 2DJGB 1GCBA 1TLOA 4YYSA 1YK7A 2B1MA 5CHTA 2E03A 4YYQA 1KXRA 2G8EA 1CB5A 3IEJA 4YYRA 5F02A 2BDZA 3DF0A 4OEMA 3PDFA 1YK8A 2IPPB 3D6SA 1MHWA 5J94A 1NQCA 2JQGR 4N4ZA 4YYVA 1Y08A 4BQVA 4CZWA 4BPVA 1AU0A 3GCBA 1EWLA 9PAPA 1MEGA 3CBJA 4QRVA 3IOQA 1F2BA 2DC6A 1BQIA 1PCIA 3F75A 4ZUXU 1XKGA 2DCDA 2CB5A 4WA6A 3PW3A 4X6HA 3H8CA 4MSXA 2YJ2A 1CSBB 1NPZA 5A24A 3N3GA 4QRGA 4BS6A 1ZCMA 1PPNA 4P6GA 1TL9A 1AU2A 4DMYA 4XR7A 1EWMA 3I06A 3IUTA 3HHIA
chains in the Genus database with same CATH superfamily
2F7DA 8PCHA 1U9WA 2DCCA 2YJ8A 4MM3B 5CHVA 3IV2A 4RF0A 4I05A 4CDFB 2C0YA 2DJFB 3BC3A 3TNXA 2FYEA 1GMYA 1QOLA 4CDDB 1Y4HA 1ATKA 2FUDA 1AECA 5FPWA 3IFUA 3QT4A 1KHPA 1FH0A 1PXVA 1DF0A 3RVWA 2E01A 5EZSA 1PE6A 3HWNA 3BBAA 2AUZA 2J7QA 3KKUA 3MTNA 2PREA 3QJ3A 4PP1A 5JZEA 3ERVA 1UKFA 1ITOA 3C9EA 4PT5A 5JA7A 2BU3A 4BOQA 2GHUA 2HHNA 3W30A 3KWZA 4QH6A 4FJCA 1CVZA 1U9QX 2AGAA 2FQ9A 4QRXA 4RNAA 4PI3A 2J7QC 1ME3A 3E9SA 2Y5BA 3K24A 2G6DA 1STFE 3K8UA 2HH5A 1KHQA 1IWDA 4MI7A 2DC7A 4XUIA 2PNSA 5CVMA 2DZYA 3U8EA 4YV8A 3RNVA 2DOSA 3TMPA 1CQDA 2HD5A 3S3QA 1NB5A 3S3RA 2OP3A 1CV8A 3QSDA 3E1ZB 2CIOA 1CJLA 2FT2A 2G8JA 1HUCB 3P5WA 3BOWA 3KW9A 2ARYA 3LXSA 4KLBA 2YJ9A 2FO5A 4XZXA 1QXPA 2AYOA 4QBBA 2XU3A 2YJCA 3HD3A 3F5VA 4RF1A 1BP4A 3I3TA 3PRPA 3V6CA 4G54A 3CH2X 4R3DA 3V6EA 2Y6EA 1PBHA 2P7UA 1NB3A 1PPOA 3ZUAA 1AYWA 3P5VA 1BGOA 4MZOA 1SP4B 2F1GA 1BY8A 1DEUA 5EF4A 3PSEA 2XU1A 2NQAA 2GFOA 2BDLA 2AIMA 1POPA 4D8EA 4FK5A 3MHSA 1CPJA 5PADA 4RY2A 1KFXL 4D8BA 5CVNB 1NLJA 4REZA 4Q8HA 2R9FA 3BPFA 5EGWA 1AIMA 1QMYA 2P0RA 1DKIA 3OF8A 2ATOA 1AYVA 1TU6A 1ME4A 2JTCA 1YZBA 1PPDA 4RKXA 1M6DA 5JH3A 3NHEA 4W4UA 1EWPA 2P86A 1MS6A 3MORA 4N79A 3AI8A 3BCNA 1U5IA 6PADA 2FRAA 3WXEA 2DCBA 3OVXA 2AS8A 2E02A 2HXZA 2XU4A 1GLOA 3IHPA 7PCKA 4I07A 1EWOA 2OULA 2Z84A 1O0EA 4YYUA 1AU3A 2PBHA 3OISA 3MJ5A 3MHHA 3RVVA 2FTDA 4IUMA 4N8WA 3B21A 2OZ2A 2H7JA 3H6SA 2DC9A 3PHUA 2B1NA 3OF9A 1NL6A 4BSQA 2VHFA 2NQIA 4MZSA 4I04A 1GECE 2FRQA 3P5XA 4W5CA 1PVJA 3C0RA 2NQGA 2BTWA 4OELA 2NQDB 4OVZB 2BTWB 3M99A 4X6IA 4HWYA 1PADA 1MIRA 4YYWA 1AU4A 4BOSA 4CDEB 3PNRA 5KO3A 3KFQA 1U9VA 3N3KA 2DCAA 3PT2A 4IP3A 3USVA 4BOUA 2O6XA 3N4CA 2HWKA 2R6NA 1CS8A 3PBHA 1F2AA 3P5UA 1A6RA 3HHAA 3H89A 2AU1A 1Q6KA 3O0UA 4YVAA 3BB7A 1F29A 3LFYA 3O65A 4BS5A 4BOZA 2G7YA 3BY4A 3PRMA 3H7DA 4M0WA 4OW0A 4OVZA 1ZIVA 2JQFR 1S4VA 2VHSA 4PADA 3B79A 2DC8A 4K7CA 3OVZA 1VSNA 3BPMA 3MTVA 5CVOB 4P16A 1X9YA 4Q8GA 1AYUA 1QDQA 3W31A 1F2CA 1K3BB 4AXLA 2ACTA 3K9MA 2WBFX 3KWBX 4PP2E 1CTEA 3WXGA 2R9CA 4AXMA 3CH3X 4BOPA 1MEMA 3WXFA 2JRIA 2R9OA 2AVWA 1VJVA 2AYNA 1YALA 2R9NA 2UZJA 4X6JA 2AUXA 3OQCA 4A5UA 3KSEA 3O1GA 3CBKA 3IMAA 1U9XA 2XU5A 1SNKA 2E00A 4P6EA 3RVXA 1THEA 1YT7A 4FIPA 4GUAA 1JQPA 1MDWA 3H8BA 1EF7A 2PADA 4CDCB 4D8IA 4DMXA 1PPPA 2IBIA 2R9MA 1YVBA 3PHWA 2DZZA 1KFUL 3BWKA 2YJBA 4W5BA 1PIPA 5K16A 3KX1A 1ICFA 3MP2A 3ZNHA 2DJGB 1GCBA 1TLOA 4YYSA 1YK7A 2B1MA 3TRKA 5CHTA 2E03A 4YYQA 1KXRA 2G8EA 1CB5A 3IEJA 4YYRA 5F02A 2BDZA 3DF0A 4OEMA 3PDFA 1YK8A 2IPPB 3D6SA 3PHXA 4WURA 1MHWA 5J94A 1NQCA 2JQGR 4N4ZA 4YYVA 1Y08A 4BQVA 4CZWA 4BPVA 5EZQA 1AU0A 3GCBA 1EWLA 9PAPA 4HXDB 1MEGA 3CBJA 2FE8A 4QRVA 3IOQA 1F2BA 2DC6A 1BQIA 5E6JA 1PCIA 3F75A 4ZUXU 1XKGA 2DCDA 2CB5A 4WA6A 3PW3A 4X6HA 3H8CA 4MSXA 2YJ2A 1CSBB 1NPZA 5A24A 3N3GA 4ZTBA 4QRGA 4BS6A 1ZCMA 1PPNA 4P6GA 1TL9A 1AU2A 4DMYA 4XR7A 1EWMA 3I06A 3IUTA 3HHIA
chains in the Genus database with same CATH topology
2F7DA 8PCHA 1U9WA 2DCCA 2YJ8A 5CHVA 3IV2A 4I05A 4CDFB 2C0YA 2DJFB 3BC3A 3TNXA 2FYEA 1GMYA 1QOLA 4CDDB 1Y4HA 1ATKA 2FUDA 1AECA 5FPWA 3QT4A 1KHPA 1FH0A 1PXVA 1DF0A 3RVWA 2E01A 1PE6A 3HWNA 3MTNA 2AUZA 3KKUA 2PREA 3QJ3A 4PP1A 3ERVA 1ITOA 3C9EA 5JA7A 2GHUA 2HHNA 3KWZA 4QH6A 4FJCA 1CVZA 1U9QX 4QRXA 2FQ9A 4PI3A 1E2TA 1ME3A 2Y5BA 3K24A 2G6DA 1STFE 3K8UA 2HH5A 1KHQA 1IWDA 2DC7A 4XUIA 2PNSA 5CVMA 2DZYA 3U8EA 4YV8A 1CQDA 2HD5A 3S3QA 1NB5A 3S3RA 2OP3A 1CV8A 3QSDA 3E1ZB 2CIOA 1CJLA 2FT2A 2G8JA 1HUCB 3P5WA 3BOWA 3KW9A 2ARYA 3LXSA 4KLBA 2YJ9A 2FO5A 1QXPA 2AYOA 4QBBA 2XU3A 2YJCA 3HD3A 3F5VA 1BP4A 3I3TA 3V6CA 4G54A 3CH2X 3V6EA 2Y6EA 1PBHA 2P7UA 1NB3A 1PPOA 3ZUAA 1AYWA 3P5VA 1BGOA 4MZOA 1SP4B 2F1GA 1BY8A 1DEUA 5EF4A 2XU1A 2NQAA 2GFOA 2BDLA 2AIMA 4GUZA 1POPA 4FK5A 3MHSA 1CPJA 5PADA 4RY2A 1KFXL 5CVNB 1NLJA 4Q8HA 2R9FA 3BPFA 5EGWA 1AIMA 1QMYA 2P0RA 3OF8A 2ATOA 1AYVA 1TU6A 1ME4A 1PPDA 1M6DA 5JH3A 3NHEA 4W4UA 1EWPA 2P86A 1MS6A 3MORA 3D9WA 4N79A 3AI8A 4B55A 3BCNA 1U5IA 6PADA 2FRAA 3WXEA 2DCBA 4BGFA 3OVXA 2AS8A 2E02A 2HXZA 2XU4A 1GLOA 3IHPA 7PCKA 4I07A 1EWOA 2OULA 1O0EA 4YYUA 1AU3A 2PBHA 3OISA 3MHHA 3RVVA 2FTDA 4N8WA 2OZ2A 2H7JA 3H6SA 2DC9A 2B1NA 3OF9A 1NL6A 4BSQA 2VHFA 2NQIA 4MZSA 4I04A 1GECE 2FRQA 3P5XA 4W5CA 2NQGA 4OELA 2NQDB 3M99A 4X6IA 4HWYA 1PADA 1MIRA 4YYWA 1AU4A 4CDEB 3PNRA 3KFQA 1U9VA 3N3KA 2DCAA 3USVA 2O6XA 3N4CA 2R6NA 1CS8A 3PBHA 1F2AA 3P5UA 1A6RA 3HHAA 3H89A 2AU1A 1Q6KA 3O0UA 4YVAA 1F29A 3LFYA 4BS5A 2G7YA 3H7DA 1ZIVA 3LTWA 2JQFR 1S4VA 2VHSA 4PADA 3B79A 2DC8A 4K7CA 3OVZA 1VSNA 3BPMA 5CVOB 1X9YA 4Q8GA 1AYUA 1QDQA 1F2CA 1K3BB 4AXLA 1GX3A 2ACTA 3K9MA 2WBFX 3KWBX 4PP2E 1CTEA 3WXGA 1W4TA 2R9CA 4AXMA 3CH3X 1MEMA 3WXFA 2R9OA 2AVWA 1VJVA 2AYNA 1YALA 2R9NA 4X6JA 2AUXA 3KSEA 3O1GA 3CBKA 3IMAA 1U9XA 2XU5A 1SNKA 2E00A 4P6EA 2VFBA 3RVXA 1THEA 1YT7A 4FIPA 1JQPA 1MDWA 3H8BA 1EF7A 2PADA 4CDCB 4DMXA 1PPPA 2IBIA 2R9MA 1YVBA 2DZZA 2BSZA 1KFUL 4NV7A 3BWKA 2YJBA 4W5BA 1PIPA 5K16A 3KX1A 1ICFA 2DJGB 1GCBA 1TLOA 4YYSA 1YK7A 2B1MA 5CHTA 2E03A 4YYQA 1KXRA 2G8EA 1CB5A 1W6FA 3IEJA 4YYRA 5F02A 2BDZA 3DF0A 4OEMA 3PDFA 1YK8A 2IPPB 3D6SA 1MHWA 5J94A 1NQCA 2JQGR 4N4ZA 4YYVA 1Y08A 4BQVA 4CZWA 4BPVA 1AU0A 3GCBA 2VFCA 1EWLA 9PAPA 1MEGA 3CBJA 4QRVA 3IOQA 1F2BA 2DC6A 1BQIA 1PCIA 3F75A 4ZUXU 1XKGA 2DCDA 2CB5A 4WA6A 3PW3A 4X6HA 3H8CA 4MSXA 2YJ2A 1CSBB 1NPZA 5A24A 1W5RA 3N3GA 4C5PA 4QRGA 4BS6A 1ZCMA 1PPNA 4P6GA 1TL9A 1AU2A 4DMYA 4XR7A 1EWMA 3I06A 4NV8A 3IUTA 3HHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F7D A;  8PCH A;  1U9W A;  2DCC A;  2YJ8 A;  5CHV A;  3IV2 A;  4I05 A;  4CDF B;  2C0Y A;  2DJF B;  3BC3 A;  3TNX A;  2FYE A;  1GMY A;  1QOL A;  4CDD B;  1Y4H A;  1ATK A;  2FUD A;  1AEC A;  5FPW A;  3QT4 A;  1KHP A;  1FH0 A;  1PXV A;  1DF0 A;  3RVW A;  2E01 A;  1PE6 A;  3HWN A;  3MTN A;  2AUZ A;  3KKU A;  2PRE A;  3QJ3 A;  4PP1 A;  3ERV A;  1ITO A;  3C9E A;  5JA7 A;  2GHU A;  2HHN A;  3KWZ A;  4QH6 A;  4FJC A;  1CVZ A;  1U9Q X;  4QRX A;  2FQ9 A;  4PI3 A;  1ME3 A;  2Y5B A;  3K24 A;  2G6D A;  1STF E;  3K8U A;  2HH5 A;  1KHQ A;  1IWD A;  2DC7 A;  4XUI A;  2PNS A;  5CVM A;  2DZY A;  3U8E A;  4YV8 A;  1CQD A;  2HD5 A;  3S3Q A;  1NB5 A;  3S3R A;  2OP3 A;  1CV8 A;  3QSD A;  3E1Z B;  2CIO A;  1CJL A;  2FT2 A;  2G8J A;  1HUC B;  3P5W A;  3BOW A;  3KW9 A;  2ARY A;  3LXS A;  4KLB A;  2YJ9 A;  2FO5 A;  1QXP A;  2AYO A;  4QBB A;  2XU3 A;  2YJC A;  3HD3 A;  3F5V A;  1BP4 A;  3I3T A;  3V6C A;  4G54 A;  3CH2 X;  3V6E A;  2Y6E A;  1PBH A;  2P7U A;  1NB3 A;  1PPO A;  3ZUA A;  1AYW A;  3P5V A;  1BGO A;  4MZO A;  1SP4 B;  2F1G A;  1BY8 A;  1DEU A;  5EF4 A;  2XU1 A;  2NQA A;  2GFO A;  2BDL A;  2AIM A;  1POP A;  4FK5 A;  3MHS A;  1CPJ A;  5PAD A;  4RY2 A;  1KFX L;  5CVN B;  1NLJ A;  4Q8H A;  2R9F A;  3BPF A;  5EGW A;  1AIM A;  1QMY A;  2P0R A;  3OF8 A;  2ATO A;  1AYV A;  1TU6 A;  1ME4 A;  1PPD A;  1M6D A;  5JH3 A;  3NHE A;  4W4U A;  1EWP A;  2P86 A;  1MS6 A;  3MOR A;  4N79 A;  3AI8 A;  3BCN A;  1U5I A;  6PAD A;  2FRA A;  3WXE A;  2DCB A;  3OVX A;  2AS8 A;  2E02 A;  2HXZ A;  2XU4 A;  1GLO A;  3IHP A;  7PCK A;  4I07 A;  1EWO A;  2OUL A;  1O0E A;  4YYU A;  1AU3 A;  2PBH A;  3OIS A;  3MHH A;  3RVV A;  2FTD A;  4N8W A;  2OZ2 A;  2H7J A;  3H6S A;  2DC9 A;  2B1N A;  3OF9 A;  1NL6 A;  4BSQ A;  2VHF A;  2NQI A;  4MZS A;  4I04 A;  1GEC E;  2FRQ A;  3P5X A;  4W5C A;  2NQG A;  4OEL A;  2NQD B;  3M99 A;  4X6I A;  4HWY A;  1PAD A;  1MIR A;  4YYW A;  1AU4 A;  4CDE B;  3PNR A;  3KFQ A;  1U9V A;  3N3K A;  2DCA A;  3USV A;  2O6X A;  3N4C A;  2R6N A;  1CS8 A;  3PBH A;  1F2A A;  3P5U A;  1A6R A;  3HHA A;  3H89 A;  2AU1 A;  1Q6K A;  3O0U A;  4YVA A;  1F29 A;  3LFY A;  4BS5 A;  2G7Y A;  3H7D A;  1ZIV A;  2JQF R;  1S4V A;  2VHS A;  4PAD A;  3B79 A;  2DC8 A;  4K7C A;  3OVZ A;  1VSN A;  3BPM A;  5CVO B;  1X9Y A;  4Q8G A;  1AYU A;  1QDQ A;  1F2C A;  1K3B B;  4AXL A;  2ACT A;  3K9M A;  2WBF X;  3KWB X;  4PP2 E;  1CTE A;  3WXG A;  2R9C A;  4AXM A;  3CH3 X;  1MEM A;  3WXF A;  2R9O A;  2AVW A;  1VJV A;  2AYN A;  1YAL A;  2R9N A;  4X6J A;  2AUX A;  3KSE A;  3O1G A;  3CBK A;  3IMA A;  1U9X A;  2XU5 A;  1SNK A;  2E00 A;  4P6E A;  3RVX A;  1THE A;  1YT7 A;  4FIP A;  1JQP A;  1MDW A;  3H8B A;  1EF7 A;  2PAD A;  4CDC B;  4DMX A;  1PPP A;  2IBI A;  2R9M A;  1YVB A;  2DZZ A;  1KFU L;  3BWK A;  2YJB A;  4W5B A;  1PIP A;  5K16 A;  3KX1 A;  1ICF A;  2DJG B;  1GCB A;  1TLO A;  4YYS A;  1YK7 A;  2B1M A;  5CHT A;  2E03 A;  4YYQ A;  1KXR A;  2G8E A;  1CB5 A;  3IEJ A;  4YYR A;  5F02 A;  2BDZ A;  3DF0 A;  4OEM A;  3PDF A;  1YK8 A;  2IPP B;  3D6S A;  1MHW A;  5J94 A;  1NQC A;  2JQG R;  4N4Z A;  4YYV A;  1Y08 A;  4BQV A;  4CZW A;  4BPV A;  1AU0 A;  3GCB A;  1EWL A;  9PAP A;  1MEG A;  3CBJ A;  4QRV A;  3IOQ A;  1F2B A;  2DC6 A;  1BQI A;  1PCI A;  3F75 A;  4ZUX U;  1XKG A;  2DCD A;  2CB5 A;  4WA6 A;  3PW3 A;  4X6H A;  3H8C A;  4MSX A;  2YJ2 A;  1CSB B;  1NPZ A;  5A24 A;  3N3G A;  4QRG A;  4BS6 A;  1ZCM A;  1PPN A;  4P6G A;  1TL9 A;  1AU2 A;  4DMY A;  4XR7 A;  1EWM A;  3I06 A;  3IUT A;  3HHI A; 
#chains in the Genus database with same CATH topology
 2F7D A;  8PCH A;  1U9W A;  2DCC A;  2YJ8 A;  4MM3 B;  5CHV A;  3IV2 A;  4RF0 A;  4I05 A;  4CDF B;  2C0Y A;  2DJF B;  3BC3 A;  3TNX A;  2FYE A;  1GMY A;  1QOL A;  4CDD B;  1Y4H A;  1ATK A;  2FUD A;  1AEC A;  5FPW A;  3IFU A;  3QT4 A;  1KHP A;  1FH0 A;  1PXV A;  1DF0 A;  3RVW A;  2E01 A;  5EZS A;  1PE6 A;  3HWN A;  3BBA A;  2AUZ A;  2J7Q A;  3KKU A;  3MTN A;  2PRE A;  3QJ3 A;  4PP1 A;  5JZE A;  3ERV A;  1UKF A;  1ITO A;  3C9E A;  4PT5 A;  5JA7 A;  2BU3 A;  4BOQ A;  2GHU A;  2HHN A;  3W30 A;  3KWZ A;  4QH6 A;  4FJC A;  1CVZ A;  1U9Q X;  2AGA A;  2FQ9 A;  4QRX A;  4RNA A;  4PI3 A;  2J7Q C;  1ME3 A;  3E9S A;  2Y5B A;  3K24 A;  2G6D A;  1STF E;  3K8U A;  2HH5 A;  1KHQ A;  1IWD A;  4MI7 A;  2DC7 A;  4XUI A;  2PNS A;  5CVM A;  2DZY A;  3U8E A;  4YV8 A;  3RNV A;  2DOS A;  3TMP A;  1CQD A;  2HD5 A;  3S3Q A;  1NB5 A;  3S3R A;  2OP3 A;  1CV8 A;  3QSD A;  3E1Z B;  2CIO A;  1CJL A;  2FT2 A;  2G8J A;  1HUC B;  3P5W A;  3BOW A;  3KW9 A;  2ARY A;  3LXS A;  4KLB A;  2YJ9 A;  2FO5 A;  4XZX A;  1QXP A;  2AYO A;  4QBB A;  2XU3 A;  2YJC A;  3HD3 A;  3F5V A;  4RF1 A;  1BP4 A;  3I3T A;  3PRP A;  3V6C A;  4G54 A;  3CH2 X;  4R3D A;  3V6E A;  2Y6E A;  1PBH A;  2P7U A;  1NB3 A;  1PPO A;  3ZUA A;  1AYW A;  3P5V A;  1BGO A;  4MZO A;  1SP4 B;  2F1G A;  1BY8 A;  1DEU A;  5EF4 A;  3PSE A;  2XU1 A;  2NQA A;  2GFO A;  2BDL A;  2AIM A;  1POP A;  4D8E A;  4FK5 A;  3MHS A;  1CPJ A;  5PAD A;  4RY2 A;  1KFX L;  4D8B A;  5CVN B;  1NLJ A;  4REZ A;  4Q8H A;  2R9F A;  3BPF A;  5EGW A;  1AIM A;  1QMY A;  2P0R A;  1DKI A;  3OF8 A;  2ATO A;  1AYV A;  1TU6 A;  1ME4 A;  2JTC A;  1YZB A;  1PPD A;  4RKX A;  1M6D A;  5JH3 A;  3NHE A;  4W4U A;  1EWP A;  2P86 A;  1MS6 A;  3MOR A;  4N79 A;  3AI8 A;  3BCN A;  1U5I A;  6PAD A;  2FRA A;  3WXE A;  2DCB A;  3OVX A;  2AS8 A;  2E02 A;  2HXZ A;  2XU4 A;  1GLO A;  3IHP A;  7PCK A;  4I07 A;  1EWO A;  2OUL A;  2Z84 A;  1O0E A;  4YYU A;  1AU3 A;  2PBH A;  3OIS A;  3MJ5 A;  3MHH A;  3RVV A;  2FTD A;  4IUM A;  4N8W A;  3B21 A;  2OZ2 A;  2H7J A;  3H6S A;  2DC9 A;  3PHU A;  2B1N A;  3OF9 A;  1NL6 A;  4BSQ A;  2VHF A;  2NQI A;  4MZS A;  4I04 A;  1GEC E;  2FRQ A;  3P5X A;  4W5C A;  1PVJ A;  3C0R A;  2NQG A;  2BTW A;  4OEL A;  2NQD B;  4OVZ B;  2BTW B;  3M99 A;  4X6I A;  4HWY A;  1PAD A;  1MIR A;  4YYW A;  1AU4 A;  4BOS A;  4CDE B;  3PNR A;  5KO3 A;  3KFQ A;  1U9V A;  3N3K A;  2DCA A;  3PT2 A;  4IP3 A;  3USV A;  4BOU A;  2O6X A;  3N4C A;  2HWK A;  2R6N A;  1CS8 A;  3PBH A;  1F2A A;  3P5U A;  1A6R A;  3HHA A;  3H89 A;  2AU1 A;  1Q6K A;  3O0U A;  4YVA A;  3BB7 A;  1F29 A;  3LFY A;  3O65 A;  4BS5 A;  4BOZ A;  2G7Y A;  3BY4 A;  3PRM A;  3H7D A;  4M0W A;  4OW0 A;  4OVZ A;  1ZIV A;  2JQF R;  1S4V A;  2VHS A;  4PAD A;  3B79 A;  2DC8 A;  4K7C A;  3OVZ A;  1VSN A;  3BPM A;  3MTV A;  5CVO B;  4P16 A;  1X9Y A;  4Q8G A;  1AYU A;  1QDQ A;  3W31 A;  1F2C A;  1K3B B;  4AXL A;  2ACT A;  3K9M A;  2WBF X;  3KWB X;  4PP2 E;  1CTE A;  3WXG A;  2R9C A;  4AXM A;  3CH3 X;  4BOP A;  1MEM A;  3WXF A;  2JRI A;  2R9O A;  2AVW A;  1VJV A;  2AYN A;  1YAL A;  2R9N A;  2UZJ A;  4X6J A;  2AUX A;  3OQC A;  4A5U A;  3KSE A;  3O1G A;  3CBK A;  3IMA A;  1U9X A;  2XU5 A;  1SNK A;  2E00 A;  4P6E A;  3RVX A;  1THE A;  1YT7 A;  4FIP A;  4GUA A;  1JQP A;  1MDW A;  3H8B A;  1EF7 A;  2PAD A;  4CDC B;  4D8I A;  4DMX A;  1PPP A;  2IBI A;  2R9M A;  1YVB A;  3PHW A;  2DZZ A;  1KFU L;  3BWK A;  2YJB A;  4W5B A;  1PIP A;  5K16 A;  3KX1 A;  1ICF A;  3MP2 A;  3ZNH A;  2DJG B;  1GCB A;  1TLO A;  4YYS A;  1YK7 A;  2B1M A;  3TRK A;  5CHT A;  2E03 A;  4YYQ A;  1KXR A;  2G8E A;  1CB5 A;  3IEJ A;  4YYR A;  5F02 A;  2BDZ A;  3DF0 A;  4OEM A;  3PDF A;  1YK8 A;  2IPP B;  3D6S A;  3PHX A;  4WUR A;  1MHW A;  5J94 A;  1NQC A;  2JQG R;  4N4Z A;  4YYV A;  1Y08 A;  4BQV A;  4CZW A;  4BPV A;  5EZQ A;  1AU0 A;  3GCB A;  1EWL A;  9PAP A;  4HXD B;  1MEG A;  3CBJ A;  2FE8 A;  4QRV A;  3IOQ A;  1F2B A;  2DC6 A;  1BQI A;  5E6J A;  1PCI A;  3F75 A;  4ZUX U;  1XKG A;  2DCD A;  2CB5 A;  4WA6 A;  3PW3 A;  4X6H A;  3H8C A;  4MSX A;  2YJ2 A;  1CSB B;  1NPZ A;  5A24 A;  3N3G A;  4ZTB A;  4QRG A;  4BS6 A;  1ZCM A;  1PPN A;  4P6G A;  1TL9 A;  1AU2 A;  4DMY A;  4XR7 A;  1EWM A;  3I06 A;  3IUT A;  3HHI A; 
#chains in the Genus database with same CATH homology
 2F7D A;  8PCH A;  1U9W A;  2DCC A;  2YJ8 A;  5CHV A;  3IV2 A;  4I05 A;  4CDF B;  2C0Y A;  2DJF B;  3BC3 A;  3TNX A;  2FYE A;  1GMY A;  1QOL A;  4CDD B;  1Y4H A;  1ATK A;  2FUD A;  1AEC A;  5FPW A;  3QT4 A;  1KHP A;  1FH0 A;  1PXV A;  1DF0 A;  3RVW A;  2E01 A;  1PE6 A;  3HWN A;  3MTN A;  2AUZ A;  3KKU A;  2PRE A;  3QJ3 A;  4PP1 A;  3ERV A;  1ITO A;  3C9E A;  5JA7 A;  2GHU A;  2HHN A;  3KWZ A;  4QH6 A;  4FJC A;  1CVZ A;  1U9Q X;  4QRX A;  2FQ9 A;  4PI3 A;  1E2T A;  1ME3 A;  2Y5B A;  3K24 A;  2G6D A;  1STF E;  3K8U A;  2HH5 A;  1KHQ A;  1IWD A;  2DC7 A;  4XUI A;  2PNS A;  5CVM A;  2DZY A;  3U8E A;  4YV8 A;  1CQD A;  2HD5 A;  3S3Q A;  1NB5 A;  3S3R A;  2OP3 A;  1CV8 A;  3QSD A;  3E1Z B;  2CIO A;  1CJL A;  2FT2 A;  2G8J A;  1HUC B;  3P5W A;  3BOW A;  3KW9 A;  2ARY A;  3LXS A;  4KLB A;  2YJ9 A;  2FO5 A;  1QXP A;  2AYO A;  4QBB A;  2XU3 A;  2YJC A;  3HD3 A;  3F5V A;  1BP4 A;  3I3T A;  3V6C A;  4G54 A;  3CH2 X;  3V6E A;  2Y6E A;  1PBH A;  2P7U A;  1NB3 A;  1PPO A;  3ZUA A;  1AYW A;  3P5V A;  1BGO A;  4MZO A;  1SP4 B;  2F1G A;  1BY8 A;  1DEU A;  5EF4 A;  2XU1 A;  2NQA A;  2GFO A;  2BDL A;  2AIM A;  4GUZ A;  1POP A;  4FK5 A;  3MHS A;  1CPJ A;  5PAD A;  4RY2 A;  1KFX L;  5CVN B;  1NLJ A;  4Q8H A;  2R9F A;  3BPF A;  5EGW A;  1AIM A;  1QMY A;  2P0R A;  3OF8 A;  2ATO A;  1AYV A;  1TU6 A;  1ME4 A;  1PPD A;  1M6D A;  5JH3 A;  3NHE A;  4W4U A;  1EWP A;  2P86 A;  1MS6 A;  3MOR A;  3D9W A;  4N79 A;  3AI8 A;  4B55 A;  3BCN A;  1U5I A;  6PAD A;  2FRA A;  3WXE A;  2DCB A;  4BGF A;  3OVX A;  2AS8 A;  2E02 A;  2HXZ A;  2XU4 A;  1GLO A;  3IHP A;  7PCK A;  4I07 A;  1EWO A;  2OUL A;  1O0E A;  4YYU A;  1AU3 A;  2PBH A;  3OIS A;  3MHH A;  3RVV A;  2FTD A;  4N8W A;  2OZ2 A;  2H7J A;  3H6S A;  2DC9 A;  2B1N A;  3OF9 A;  1NL6 A;  4BSQ A;  2VHF A;  2NQI A;  4MZS A;  4I04 A;  1GEC E;  2FRQ A;  3P5X A;  4W5C A;  2NQG A;  4OEL A;  2NQD B;  3M99 A;  4X6I A;  4HWY A;  1PAD A;  1MIR A;  4YYW A;  1AU4 A;  4CDE B;  3PNR A;  3KFQ A;  1U9V A;  3N3K A;  2DCA A;  3USV A;  2O6X A;  3N4C A;  2R6N A;  1CS8 A;  3PBH A;  1F2A A;  3P5U A;  1A6R A;  3HHA A;  3H89 A;  2AU1 A;  1Q6K A;  3O0U A;  4YVA A;  1F29 A;  3LFY A;  4BS5 A;  2G7Y A;  3H7D A;  1ZIV A;  3LTW A;  2JQF R;  1S4V A;  2VHS A;  4PAD A;  3B79 A;  2DC8 A;  4K7C A;  3OVZ A;  1VSN A;  3BPM A;  5CVO B;  1X9Y A;  4Q8G A;  1AYU A;  1QDQ A;  1F2C A;  1K3B B;  4AXL A;  1GX3 A;  2ACT A;  3K9M A;  2WBF X;  3KWB X;  4PP2 E;  1CTE A;  3WXG A;  1W4T A;  2R9C A;  4AXM A;  3CH3 X;  1MEM A;  3WXF A;  2R9O A;  2AVW A;  1VJV A;  2AYN A;  1YAL A;  2R9N A;  4X6J A;  2AUX A;  3KSE A;  3O1G A;  3CBK A;  3IMA A;  1U9X A;  2XU5 A;  1SNK A;  2E00 A;  4P6E A;  2VFB A;  3RVX A;  1THE A;  1YT7 A;  4FIP A;  1JQP A;  1MDW A;  3H8B A;  1EF7 A;  2PAD A;  4CDC B;  4DMX A;  1PPP A;  2IBI A;  2R9M A;  1YVB A;  2DZZ A;  2BSZ A;  1KFU L;  4NV7 A;  3BWK A;  2YJB A;  4W5B A;  1PIP A;  5K16 A;  3KX1 A;  1ICF A;  2DJG B;  1GCB A;  1TLO A;  4YYS A;  1YK7 A;  2B1M A;  5CHT A;  2E03 A;  4YYQ A;  1KXR A;  2G8E A;  1CB5 A;  1W6F A;  3IEJ A;  4YYR A;  5F02 A;  2BDZ A;  3DF0 A;  4OEM A;  3PDF A;  1YK8 A;  2IPP B;  3D6S A;  1MHW A;  5J94 A;  1NQC A;  2JQG R;  4N4Z A;  4YYV A;  1Y08 A;  4BQV A;  4CZW A;  4BPV A;  1AU0 A;  3GCB A;  2VFC A;  1EWL A;  9PAP A;  1MEG A;  3CBJ A;  4QRV A;  3IOQ A;  1F2B A;  2DC6 A;  1BQI A;  1PCI A;  3F75 A;  4ZUX U;  1XKG A;  2DCD A;  2CB5 A;  4WA6 A;  3PW3 A;  4X6H A;  3H8C A;  4MSX A;  2YJ2 A;  1CSB B;  1NPZ A;  5A24 A;  1W5R A;  3N3G A;  4C5P A;  4QRG A;  4BS6 A;  1ZCM A;  1PPN A;  4P6G A;  1TL9 A;  1AU2 A;  4DMY A;  4XR7 A;  1EWM A;  3I06 A;  4NV8 A;  3IUT A;  3HHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...