4BPVA

Mouse cathepsin s with covalent ligand
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
219
structure length
219
Chain Sequence
TLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKAMDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CATHEPSIN S
publication title Cathepsin S Nitrile Inhibitors
rcsb
source organism Mus musculus
total genus 68
structure length 219
sequence length 219
chains with identical sequence B, C, D, E, K
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2013-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4bpvA00
2E03A 2E01A 3OF8A 2DCBA 1EWOA 1ME4A 1PPNA 4QRXA 4QH6A 2Y5BA 2F7DA 1TLOA 2NQAA 1IWDA 1EWMA 4W5CA 4W4UA 1YT7A 1NPZA 1PIPA 2NQGA 3BC3A 1CQDA 2XU4A 3P5XA 3KKUA 2CIOA 3IMAA 1ME3A 3OF9A 1CPJA 1GLOA 3IUTA 1MEGA 1ATKA 3HWNA 2G6DA 2Y6EA 2R9MA 2FT2A 4Q8HA 4W5BA 2FRAA 1MDWA 4XR7A 1GMYA 3KWZA 4BQVA 4MSXA 4CDFB 1NQCA 4K7CA 4KLBA 2AIMA 4CDDB 2DJGB 5CHVA 2FYEA 4YYRA 1CB5A 1BGOA 3MORA 4FJCA 4I04A 1PCIA 4CDCB 3CH2X 7PCKA 4MZOA 2DZZA 3H7DA 1SNKA 4DMXA 2IPPB 4YVAA 1PADA 2H7JA 1KHQA 2DJFB 3HHIA 3F75A 6PADA 2AUXA 5JA7A 4N79A 2XU5A 1M6DA 4X6JA 3MTNA 3K24A 3H6SA 5EF4A 1F2BA 1CSBB 1AU0A 1MHWA 2B1MA 3HD3A 1AYWA 5EGWA 2JQGR 3BOWA 3O1GA 3NHEA 4BS6A 4YYWA 2IBIA 5PADA 3IHPA 4QRGA 3RVXA 4FIPA 5FPWA 1EWLA 1U9WA 4Q8GA 3C9EA 1DEUA 2DC8A 2CB5A 3CBJA 1BP4A 3QJ3A 3DF0A 2G7YA 4PADA 1QOLA 3B79A 2PNSA 2ARYA 2JQFR 2OP3A 1A6RA 4CDEB 1CVZA 4X6HA 3S3RA 3OISA 1NLJA 5CVOB 3M99A 3MHHA 3IV2A 3RVVA 3BCNA 3OVXA 2VHFA 2ACTA 3PW3A 2G8EA 3S3QA 5F02A 1AU3A 1AU2A 2AYNA 2R9FA 1S4VA 1FH0A 2OZ2A 3LFYA 2HHNA 1SP4B 2PBHA 2HH5A 3PBHA 2ATOA 1QDQA 2C0YA 4PP2E 3BWKA 3V6CA 4OEMA 1KFUL 2GHUA 2FQ9A 2P7UA 2DC7A 4YV8A 4BPVA 5JH3A 3K9MA 1GCBA 3N3KA 1VSNA 1PPOA 1MS6A 3ZUAA 4WA6A 2P86A 4P6EA 2FUDA 1PE6A 3KWBX 1YK7A 3LXSA 1U9QX 1CTEA 5K16A 2PREA 2AU1A 1QXPA 4DMYA 2R9CA 1ZCMA 2B1NA 2DZYA 2P0RA 4MZSA 1NB3A 2WBFX 1HUCB 2DC6A 1F2AA 1KXRA 1YK8A 3PDFA 4YYSA 1U9VA 2AVWA 1F2CA 3ERVA 4HWYA 1ICFA 4X6IA 3KX1A 5J94A 4AXLA 4RY2A 2AS8A 1AU4A 1EF7A 2OULA 4ZUXU 3MHSA 4N4ZA 3I06A 2FRQA 2R9NA 1KFXL 4PP1A 3K8UA 1CS8A 2VHSA 3CBKA 2DC9A 3V6EA 3O0UA 2E02A 1KHPA 4I05A 5A24A 1AIMA 1Y08A 1BY8A 3GCBA 4OELA 2DCCA 2XU1A 3BPFA 3N3GA 1DF0A 4QRVA 5CVMA 1GECE 4PI3A 3D6SA 8PCHA 3IEJA 2FTDA 1U9XA 2YJCA 4YYVA 4I07A 2YJ8A 3RVWA 2PADA 2R9OA 1Y4HA 1PPPA 1U5IA 3F5VA 1TL9A 1O0EA 1XKGA 1BQIA 2HXZA 4QBBA 3IOQA 3QSDA 2BDZA 2E00A 1NL6A 4XUIA 1ITOA 1CV8A 1PPDA 1PXVA 4BS5A 1YVBA 1VJVA 3H8BA 1MEMA 3P5VA 3H8CA 5CVNB 3USVA 5CHTA 4YYQA 2BDLA 2F1GA 1STFE 2FO5A 2DCAA 2DCDA 4CZWA 2AUZA 1MIRA 9PAPA 3E1ZB 3WXGA 3HHAA 3P5UA 1X9YA 3WXFA 2AYOA 1AYUA 4P6GA 2GFOA 3P5WA 4FK5A 2XU3A 3I3TA 3KW9A 3N4CA 1TU6A 3AI8A 4BSQA 2NQIA 1EWPA 1POPA 3U8EA 2YJ2A 2HD5A 4N8WA 4AXMA 1QMYA 2R6NA 3WXEA 1CJLA 3BPMA 1F29A 1NB5A 1PBHA 2NQDB 3QT4A 3KSEA 1JQPA 3TNXA 3KFQA 1YALA 3CH3X 4YYUA 1Q6KA 3OVZA 2O6XA 1THEA 1K3BB 2YJ9A 2YJBA 1ZIVA 2G8JA 1AECA 1AYVA 4G54A 3PNRA 3H89A
chains in the Genus database with same CATH superfamily
2E03A 2E01A 3OF8A 2DCBA 1EWOA 1ME4A 1PPNA 4QRXA 4QH6A 2Y5BA 2J7QA 2F7DA 1TLOA 2NQAA 1IWDA 1EWMA 4W5CA 4W4UA 4RNAA 1YT7A 1NPZA 1PIPA 2NQGA 4BOZA 3BC3A 1CQDA 2XU4A 3P5XA 3KKUA 2CIOA 3IMAA 1ME3A 3OQCA 3OF9A 1CPJA 1GLOA 3IUTA 1MEGA 1ATKA 3HWNA 2G6DA 2Y6EA 2R9MA 2FT2A 4Q8HA 4W5BA 2FRAA 1MDWA 4XR7A 1GMYA 3KWZA 4BQVA 4MSXA 4CDFB 3PHXA 1NQCA 4K7CA 4KLBA 2AIMA 4CDDB 4RF1A 2DJGB 5CHVA 2FYEA 4YYRA 1CB5A 1BGOA 3MORA 4FJCA 4I04A 1PCIA 4CDCB 3CH2X 7PCKA 4MZOA 2DZZA 3H7DA 1SNKA 4HXDB 4DMXA 2IPPB 4YVAA 1PADA 2H7JA 1KHQA 2DJFB 3HHIA 3F75A 6PADA 2AUXA 4P16A 5JA7A 4N79A 5KO3A 2XU5A 1M6DA 4X6JA 3MTNA 3K24A 3H6SA 5EF4A 1F2BA 1CSBB 1AU0A 1MHWA 2B1MA 3HD3A 1AYWA 5EGWA 2JQGR 3BOWA 3O1GA 3NHEA 4BS6A 2HWKA 4YYWA 2IBIA 5PADA 3IHPA 4QRGA 3RVXA 4FIPA 3BB7A 5FPWA 1EWLA 4BOPA 1U9WA 4Q8GA 4RKXA 3C9EA 4MM3B 1DEUA 2DC8A 2CB5A 4MI7A 3CBJA 1BP4A 3DF0A 3QJ3A 2G7YA 4PADA 1QOLA 3B79A 2PNSA 3PRMA 2JRIA 2ARYA 2JQFR 2OP3A 1A6RA 4CDEB 1CVZA 3PSEA 4X6HA 3S3RA 3OISA 1DKIA 1NLJA 5CVOB 3M99A 3MHHA 3IV2A 3RVVA 3BCNA 3OVXA 2VHFA 3ZNHA 2ACTA 3PW3A 2G8EA 5EZQA 3O65A 3S3QA 3B21A 3C0RA 5F02A 1AU3A 3TMPA 1AU2A 5EZSA 2AYNA 2R9FA 4BOSA 1S4VA 1FH0A 2OZ2A 3LFYA 2HHNA 3PHWA 1SP4B 2PBHA 2HH5A 3PBHA 2ATOA 3MP2A 4OW0A 1QDQA 2C0YA 4PP2E 3BWKA 3V6CA 4OEMA 1KFUL 2GHUA 2FQ9A 2P7UA 4RF0A 2DC7A 4YV8A 4BPVA 4D8BA 5JH3A 4BOUA 3K9MA 1GCBA 2BTWB 3N3KA 1VSNA 1PPOA 1MS6A 2JTCA 3E9SA 3ZUAA 4PT5A 4WA6A 2P86A 4P6EA 3TRKA 2FUDA 1PE6A 3KWBX 1YK7A 3LXSA 1U9QX 1CTEA 5K16A 2PREA 2AU1A 3PT2A 1QXPA 4DMYA 2R9CA 1ZCMA 2B1NA 2DZYA 2P0RA 4MZSA 1NB3A 2WBFX 1HUCB 2DC6A 1F2AA 1KXRA 4GUAA 3IFUA 1YK8A 3PDFA 4YYSA 4REZA 4ZTBA 1U9VA 2AVWA 1F2CA 3ERVA 4HWYA 1ICFA 4X6IA 2UZJA 3KX1A 3W31A 5J94A 4AXLA 4RY2A 2AS8A 1AU4A 5JZEA 1EF7A 2OULA 4ZUXU 3MHSA 4N4ZA 3I06A 3MJ5A 2FRQA 2R9NA 1KFXL 4PP1A 3K8UA 3PHUA 1CS8A 2VHSA 3CBKA 1UKFA 2DC9A 4XZXA 3V6EA 3O0UA 2E02A 1KHPA 4I05A 5A24A 1AIMA 2AGAA 1Y08A 1BY8A 3GCBA 4OELA 2DCCA 2XU1A 3BPFA 3N3GA 1DF0A 4D8IA 4QRVA 5CVMA 1GECE 3MTVA 4PI3A 3D6SA 8PCHA 3IEJA 4R3DA 2FTDA 1U9XA 2YJCA 1PVJA 4YYVA 5E6JA 4I07A 2YJ8A 4IP3A 3RVWA 2PADA 2R9OA 1Y4HA 1PPPA 1U5IA 3F5VA 1TL9A 1O0EA 1XKGA 1BQIA 2HXZA 4QBBA 3IOQA 3PRPA 3QSDA 2BDZA 2E00A 1NL6A 2Z84A 4XUIA 1ITOA 1CV8A 1PPDA 2DOSA 1PXVA 4BS5A 1YVBA 4IUMA 2BU3A 3RNVA 1VJVA 4M0WA 3H8BA 1MEMA 3P5VA 3H8CA 5CVNB 3USVA 5CHTA 4OVZB 2BDLA 2F1GA 4YYQA 1STFE 2FO5A 2DCAA 2DCDA 4WURA 4CZWA 2AUZA 1MIRA 9PAPA 3E1ZB 3WXGA 3HHAA 3P5UA 1X9YA 3WXFA 2AYOA 1AYUA 4P6GA 2GFOA 3P5WA 4FK5A 2XU3A 3I3TA 3KW9A 3N4CA 1TU6A 3AI8A 4BSQA 2NQIA 1EWPA 1POPA 3U8EA 2YJ2A 2HD5A 4N8WA 4AXMA 1QMYA 2R6NA 4D8EA 3WXEA 1CJLA 3BPMA 1F29A 1NB5A 1PBHA 4A5UA 2NQDB 3QT4A 3KSEA 4BOQA 1JQPA 3TNXA 3KFQA 1YALA 3CH3X 4YYUA 1Q6KA 3OVZA 2O6XA 1THEA 1K3BB 2YJ9A 2YJBA 2FE8A 1ZIVA 3W30A 3BBAA 3BY4A 1YZBA 2BTWA 2G8JA 1AECA 1AYVA 4OVZA 4G54A 2J7QC 3PNRA 3H89A
chains in the Genus database with same CATH topology
2E03A 2E01A 3OF8A 2DCBA 1EWOA 1ME4A 1PPNA 4QRXA 4QH6A 2Y5BA 2F7DA 1TLOA 4NV7A 2NQAA 1IWDA 1EWMA 4W5CA 4NV8A 4W4UA 1YT7A 1NPZA 1PIPA 2NQGA 3BC3A 1CQDA 2XU4A 3P5XA 3KKUA 2CIOA 3IMAA 1ME3A 3OF9A 1CPJA 1GLOA 3IUTA 1MEGA 1ATKA 3HWNA 2G6DA 2Y6EA 2R9MA 2FT2A 4Q8HA 4W5BA 2FRAA 1MDWA 4XR7A 1GMYA 3KWZA 4BQVA 4MSXA 4CDFB 1NQCA 4K7CA 4KLBA 2AIMA 4CDDB 3D9WA 2DJGB 5CHVA 2FYEA 4YYRA 1CB5A 1BGOA 3MORA 4FJCA 4I04A 1PCIA 4CDCB 3CH2X 7PCKA 4MZOA 2DZZA 3H7DA 1SNKA 4DMXA 2IPPB 4YVAA 1PADA 2VFCA 2H7JA 1KHQA 2DJFB 3HHIA 3F75A 6PADA 2AUXA 5JA7A 4N79A 2XU5A 1M6DA 4X6JA 3MTNA 3K24A 3H6SA 5EF4A 1F2BA 1CSBB 1AU0A 1MHWA 2B1MA 3HD3A 1AYWA 5EGWA 2JQGR 3BOWA 3O1GA 3NHEA 4BS6A 4YYWA 2IBIA 5PADA 3IHPA 4QRGA 3RVXA 4FIPA 5FPWA 1EWLA 1U9WA 4Q8GA 3C9EA 1DEUA 2DC8A 2CB5A 3CBJA 1BP4A 3DF0A 3QJ3A 2G7YA 4PADA 1QOLA 3B79A 2PNSA 2ARYA 2JQFR 2OP3A 1A6RA 4CDEB 1CVZA 2VFBA 4X6HA 3S3RA 3OISA 1NLJA 5CVOB 3M99A 3MHHA 3IV2A 3RVVA 3BCNA 3OVXA 2VHFA 2ACTA 3PW3A 2G8EA 3S3QA 5F02A 1AU3A 1AU2A 2AYNA 2R9FA 1S4VA 1FH0A 2OZ2A 3LFYA 2HHNA 1SP4B 2PBHA 2HH5A 3PBHA 2ATOA 1QDQA 2C0YA 4PP2E 3BWKA 3V6CA 4OEMA 1KFUL 2GHUA 2FQ9A 2P7UA 2DC7A 4YV8A 4BPVA 5JH3A 3K9MA 1GCBA 3N3KA 1VSNA 1W5RA 1PPOA 1MS6A 3ZUAA 1W6FA 4WA6A 2P86A 4P6EA 2FUDA 1PE6A 3KWBX 1YK7A 3LXSA 1U9QX 1CTEA 5K16A 2PREA 2AU1A 1QXPA 4DMYA 2R9CA 1ZCMA 2B1NA 2DZYA 2P0RA 4MZSA 1NB3A 2WBFX 1HUCB 2DC6A 1F2AA 1KXRA 1W4TA 1YK8A 3PDFA 4YYSA 1U9VA 2AVWA 1F2CA 3ERVA 4HWYA 1ICFA 4X6IA 3LTWA 3KX1A 5J94A 4AXLA 4RY2A 2AS8A 1AU4A 1EF7A 2OULA 4ZUXU 3MHSA 1E2TA 4N4ZA 3I06A 2FRQA 2R9NA 1KFXL 4PP1A 3K8UA 4BGFA 1CS8A 2VHSA 3CBKA 2DC9A 3V6EA 3O0UA 2E02A 1GX3A 1KHPA 4I05A 5A24A 1AIMA 1Y08A 1BY8A 3GCBA 4OELA 2DCCA 2XU1A 3BPFA 3N3GA 1DF0A 4QRVA 5CVMA 1GECE 4PI3A 3D6SA 8PCHA 3IEJA 2FTDA 1U9XA 2YJCA 4YYVA 4I07A 2YJ8A 3RVWA 2PADA 2R9OA 1Y4HA 1PPPA 1U5IA 3F5VA 1TL9A 1O0EA 1XKGA 1BQIA 2HXZA 4QBBA 3IOQA 3QSDA 2BDZA 2BSZA 2E00A 1NL6A 4XUIA 1ITOA 1CV8A 1PPDA 1PXVA 4BS5A 1YVBA 1VJVA 4B55A 3H8BA 1MEMA 3P5VA 3H8CA 5CVNB 3USVA 5CHTA 4YYQA 2BDLA 2F1GA 1STFE 2FO5A 2DCAA 2DCDA 4CZWA 2AUZA 1MIRA 9PAPA 3E1ZB 4C5PA 3WXGA 3HHAA 3P5UA 1X9YA 3WXFA 2AYOA 1AYUA 4P6GA 2GFOA 3P5WA 4FK5A 2XU3A 3I3TA 3KW9A 3N4CA 1TU6A 3AI8A 4BSQA 2NQIA 1EWPA 1POPA 3U8EA 2YJ2A 2HD5A 4N8WA 4AXMA 1QMYA 2R6NA 3WXEA 1CJLA 3BPMA 1F29A 1NB5A 1PBHA 2NQDB 4GUZA 3QT4A 3KSEA 1JQPA 3TNXA 3KFQA 1YALA 3CH3X 4YYUA 1Q6KA 3OVZA 2O6XA 1THEA 1K3BB 2YJ9A 2YJBA 1ZIVA 2G8JA 1AECA 1AYVA 4G54A 3PNRA 3H89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E03 A;  2E01 A;  3OF8 A;  2DCB A;  1EWO A;  1ME4 A;  1PPN A;  4QRX A;  4QH6 A;  2Y5B A;  2F7D A;  1TLO A;  2NQA A;  1IWD A;  1EWM A;  4W5C A;  4W4U A;  1YT7 A;  1NPZ A;  1PIP A;  2NQG A;  3BC3 A;  1CQD A;  2XU4 A;  3P5X A;  3KKU A;  2CIO A;  3IMA A;  1ME3 A;  3OF9 A;  1CPJ A;  1GLO A;  3IUT A;  1MEG A;  1ATK A;  3HWN A;  2G6D A;  2Y6E A;  2R9M A;  2FT2 A;  4Q8H A;  4W5B A;  2FRA A;  1MDW A;  4XR7 A;  1GMY A;  3KWZ A;  4BQV A;  4MSX A;  4CDF B;  1NQC A;  4K7C A;  4KLB A;  2AIM A;  4CDD B;  2DJG B;  5CHV A;  2FYE A;  4YYR A;  1CB5 A;  1BGO A;  3MOR A;  4FJC A;  4I04 A;  1PCI A;  4CDC B;  3CH2 X;  7PCK A;  4MZO A;  2DZZ A;  3H7D A;  1SNK A;  4DMX A;  2IPP B;  4YVA A;  1PAD A;  2H7J A;  1KHQ A;  2DJF B;  3HHI A;  3F75 A;  6PAD A;  2AUX A;  5JA7 A;  4N79 A;  2XU5 A;  1M6D A;  4X6J A;  3MTN A;  3K24 A;  3H6S A;  5EF4 A;  1F2B A;  1CSB B;  1AU0 A;  1MHW A;  2B1M A;  3HD3 A;  1AYW A;  5EGW A;  2JQG R;  3BOW A;  3O1G A;  3NHE A;  4BS6 A;  4YYW A;  2IBI A;  5PAD A;  3IHP A;  4QRG A;  3RVX A;  4FIP A;  5FPW A;  1EWL A;  1U9W A;  4Q8G A;  3C9E A;  1DEU A;  2DC8 A;  2CB5 A;  3CBJ A;  1BP4 A;  3QJ3 A;  3DF0 A;  2G7Y A;  4PAD A;  1QOL A;  3B79 A;  2PNS A;  2ARY A;  2JQF R;  2OP3 A;  1A6R A;  4CDE B;  1CVZ A;  4X6H A;  3S3R A;  3OIS A;  1NLJ A;  5CVO B;  3M99 A;  3MHH A;  3IV2 A;  3RVV A;  3BCN A;  3OVX A;  2VHF A;  2ACT A;  3PW3 A;  2G8E A;  3S3Q A;  5F02 A;  1AU3 A;  1AU2 A;  2AYN A;  2R9F A;  1S4V A;  1FH0 A;  2OZ2 A;  3LFY A;  2HHN A;  1SP4 B;  2PBH A;  2HH5 A;  3PBH A;  2ATO A;  1QDQ A;  2C0Y A;  4PP2 E;  3BWK A;  3V6C A;  4OEM A;  1KFU L;  2GHU A;  2FQ9 A;  2P7U A;  2DC7 A;  4YV8 A;  4BPV A;  5JH3 A;  3K9M A;  1GCB A;  3N3K A;  1VSN A;  1PPO A;  1MS6 A;  3ZUA A;  4WA6 A;  2P86 A;  4P6E A;  2FUD A;  1PE6 A;  3KWB X;  1YK7 A;  3LXS A;  1U9Q X;  1CTE A;  5K16 A;  2PRE A;  2AU1 A;  1QXP A;  4DMY A;  2R9C A;  1ZCM A;  2B1N A;  2DZY A;  2P0R A;  4MZS A;  1NB3 A;  2WBF X;  1HUC B;  2DC6 A;  1F2A A;  1KXR A;  1YK8 A;  3PDF A;  4YYS A;  1U9V A;  2AVW A;  1F2C A;  3ERV A;  4HWY A;  1ICF A;  4X6I A;  3KX1 A;  5J94 A;  4AXL A;  4RY2 A;  2AS8 A;  1AU4 A;  1EF7 A;  2OUL A;  4ZUX U;  3MHS A;  4N4Z A;  3I06 A;  2FRQ A;  2R9N A;  1KFX L;  4PP1 A;  3K8U A;  1CS8 A;  2VHS A;  3CBK A;  2DC9 A;  3V6E A;  3O0U A;  2E02 A;  1KHP A;  4I05 A;  5A24 A;  1AIM A;  1Y08 A;  1BY8 A;  3GCB A;  4OEL A;  2DCC A;  2XU1 A;  3BPF A;  3N3G A;  1DF0 A;  4QRV A;  5CVM A;  1GEC E;  4PI3 A;  3D6S A;  8PCH A;  3IEJ A;  2FTD A;  1U9X A;  2YJC A;  4YYV A;  4I07 A;  2YJ8 A;  3RVW A;  2PAD A;  2R9O A;  1Y4H A;  1PPP A;  1U5I A;  3F5V A;  1TL9 A;  1O0E A;  1XKG A;  1BQI A;  2HXZ A;  4QBB A;  3IOQ A;  3QSD A;  2BDZ A;  2E00 A;  1NL6 A;  4XUI A;  1ITO A;  1CV8 A;  1PPD A;  1PXV A;  4BS5 A;  1YVB A;  1VJV A;  3H8B A;  1MEM A;  3P5V A;  3H8C A;  5CVN B;  3USV A;  5CHT A;  4YYQ A;  2BDL A;  2F1G A;  1STF E;  2FO5 A;  2DCA A;  2DCD A;  4CZW A;  2AUZ A;  1MIR A;  9PAP A;  3E1Z B;  3WXG A;  3HHA A;  3P5U A;  1X9Y A;  3WXF A;  2AYO A;  1AYU A;  4P6G A;  2GFO A;  3P5W A;  4FK5 A;  2XU3 A;  3I3T A;  3KW9 A;  3N4C A;  1TU6 A;  3AI8 A;  4BSQ A;  2NQI A;  1EWP A;  1POP A;  3U8E A;  2YJ2 A;  2HD5 A;  4N8W A;  4AXM A;  1QMY A;  2R6N A;  3WXE A;  1CJL A;  3BPM A;  1F29 A;  1NB5 A;  1PBH A;  2NQD B;  3QT4 A;  3KSE A;  1JQP A;  3TNX A;  3KFQ A;  1YAL A;  3CH3 X;  4YYU A;  1Q6K A;  3OVZ A;  2O6X A;  1THE A;  1K3B B;  2YJ9 A;  2YJB A;  1ZIV A;  2G8J A;  1AEC A;  1AYV A;  4G54 A;  3PNR A;  3H89 A; 
#chains in the Genus database with same CATH topology
 2E03 A;  2E01 A;  3OF8 A;  2DCB A;  1EWO A;  1ME4 A;  1PPN A;  4QRX A;  4QH6 A;  2Y5B A;  2J7Q A;  2F7D A;  1TLO A;  2NQA A;  1IWD A;  1EWM A;  4W5C A;  4W4U A;  4RNA A;  1YT7 A;  1NPZ A;  1PIP A;  2NQG A;  4BOZ A;  3BC3 A;  1CQD A;  2XU4 A;  3P5X A;  3KKU A;  2CIO A;  3IMA A;  1ME3 A;  3OQC A;  3OF9 A;  1CPJ A;  1GLO A;  3IUT A;  1MEG A;  1ATK A;  3HWN A;  2G6D A;  2Y6E A;  2R9M A;  2FT2 A;  4Q8H A;  4W5B A;  2FRA A;  1MDW A;  4XR7 A;  1GMY A;  3KWZ A;  4BQV A;  4MSX A;  4CDF B;  3PHX A;  1NQC A;  4K7C A;  4KLB A;  2AIM A;  4CDD B;  4RF1 A;  2DJG B;  5CHV A;  2FYE A;  4YYR A;  1CB5 A;  1BGO A;  3MOR A;  4FJC A;  4I04 A;  1PCI A;  4CDC B;  3CH2 X;  7PCK A;  4MZO A;  2DZZ A;  3H7D A;  1SNK A;  4HXD B;  4DMX A;  2IPP B;  4YVA A;  1PAD A;  2H7J A;  1KHQ A;  2DJF B;  3HHI A;  3F75 A;  6PAD A;  2AUX A;  4P16 A;  5JA7 A;  4N79 A;  5KO3 A;  2XU5 A;  1M6D A;  4X6J A;  3MTN A;  3K24 A;  3H6S A;  5EF4 A;  1F2B A;  1CSB B;  1AU0 A;  1MHW A;  2B1M A;  3HD3 A;  1AYW A;  5EGW A;  2JQG R;  3BOW A;  3O1G A;  3NHE A;  4BS6 A;  2HWK A;  4YYW A;  2IBI A;  5PAD A;  3IHP A;  4QRG A;  3RVX A;  4FIP A;  3BB7 A;  5FPW A;  1EWL A;  4BOP A;  1U9W A;  4Q8G A;  4RKX A;  3C9E A;  4MM3 B;  1DEU A;  2DC8 A;  2CB5 A;  4MI7 A;  3CBJ A;  1BP4 A;  3DF0 A;  3QJ3 A;  2G7Y A;  4PAD A;  1QOL A;  3B79 A;  2PNS A;  3PRM A;  2JRI A;  2ARY A;  2JQF R;  2OP3 A;  1A6R A;  4CDE B;  1CVZ A;  3PSE A;  4X6H A;  3S3R A;  3OIS A;  1DKI A;  1NLJ A;  5CVO B;  3M99 A;  3MHH A;  3IV2 A;  3RVV A;  3BCN A;  3OVX A;  2VHF A;  3ZNH A;  2ACT A;  3PW3 A;  2G8E A;  5EZQ A;  3O65 A;  3S3Q A;  3B21 A;  3C0R A;  5F02 A;  1AU3 A;  3TMP A;  1AU2 A;  5EZS A;  2AYN A;  2R9F A;  4BOS A;  1S4V A;  1FH0 A;  2OZ2 A;  3LFY A;  2HHN A;  3PHW A;  1SP4 B;  2PBH A;  2HH5 A;  3PBH A;  2ATO A;  3MP2 A;  4OW0 A;  1QDQ A;  2C0Y A;  4PP2 E;  3BWK A;  3V6C A;  4OEM A;  1KFU L;  2GHU A;  2FQ9 A;  2P7U A;  4RF0 A;  2DC7 A;  4YV8 A;  4BPV A;  4D8B A;  5JH3 A;  4BOU A;  3K9M A;  1GCB A;  2BTW B;  3N3K A;  1VSN A;  1PPO A;  1MS6 A;  2JTC A;  3E9S A;  3ZUA A;  4PT5 A;  4WA6 A;  2P86 A;  4P6E A;  3TRK A;  2FUD A;  1PE6 A;  3KWB X;  1YK7 A;  3LXS A;  1U9Q X;  1CTE A;  5K16 A;  2PRE A;  2AU1 A;  3PT2 A;  1QXP A;  4DMY A;  2R9C A;  1ZCM A;  2B1N A;  2DZY A;  2P0R A;  4MZS A;  1NB3 A;  2WBF X;  1HUC B;  2DC6 A;  1F2A A;  1KXR A;  4GUA A;  3IFU A;  1YK8 A;  3PDF A;  4YYS A;  4REZ A;  4ZTB A;  1U9V A;  2AVW A;  1F2C A;  3ERV A;  4HWY A;  1ICF A;  4X6I A;  2UZJ A;  3KX1 A;  3W31 A;  5J94 A;  4AXL A;  4RY2 A;  2AS8 A;  1AU4 A;  5JZE A;  1EF7 A;  2OUL A;  4ZUX U;  3MHS A;  4N4Z A;  3I06 A;  3MJ5 A;  2FRQ A;  2R9N A;  1KFX L;  4PP1 A;  3K8U A;  3PHU A;  1CS8 A;  2VHS A;  3CBK A;  1UKF A;  2DC9 A;  4XZX A;  3V6E A;  3O0U A;  2E02 A;  1KHP A;  4I05 A;  5A24 A;  1AIM A;  2AGA A;  1Y08 A;  1BY8 A;  3GCB A;  4OEL A;  2DCC A;  2XU1 A;  3BPF A;  3N3G A;  1DF0 A;  4D8I A;  4QRV A;  5CVM A;  1GEC E;  3MTV A;  4PI3 A;  3D6S A;  8PCH A;  3IEJ A;  4R3D A;  2FTD A;  1U9X A;  2YJC A;  1PVJ A;  4YYV A;  5E6J A;  4I07 A;  2YJ8 A;  4IP3 A;  3RVW A;  2PAD A;  2R9O A;  1Y4H A;  1PPP A;  1U5I A;  3F5V A;  1TL9 A;  1O0E A;  1XKG A;  1BQI A;  2HXZ A;  4QBB A;  3IOQ A;  3PRP A;  3QSD A;  2BDZ A;  2E00 A;  1NL6 A;  2Z84 A;  4XUI A;  1ITO A;  1CV8 A;  1PPD A;  2DOS A;  1PXV A;  4BS5 A;  1YVB A;  4IUM A;  2BU3 A;  3RNV A;  1VJV A;  4M0W A;  3H8B A;  1MEM A;  3P5V A;  3H8C A;  5CVN B;  3USV A;  5CHT A;  4OVZ B;  2BDL A;  2F1G A;  4YYQ A;  1STF E;  2FO5 A;  2DCA A;  2DCD A;  4WUR A;  4CZW A;  2AUZ A;  1MIR A;  9PAP A;  3E1Z B;  3WXG A;  3HHA A;  3P5U A;  1X9Y A;  3WXF A;  2AYO A;  1AYU A;  4P6G A;  2GFO A;  3P5W A;  4FK5 A;  2XU3 A;  3I3T A;  3KW9 A;  3N4C A;  1TU6 A;  3AI8 A;  4BSQ A;  2NQI A;  1EWP A;  1POP A;  3U8E A;  2YJ2 A;  2HD5 A;  4N8W A;  4AXM A;  1QMY A;  2R6N A;  4D8E A;  3WXE A;  1CJL A;  3BPM A;  1F29 A;  1NB5 A;  1PBH A;  4A5U A;  2NQD B;  3QT4 A;  3KSE A;  4BOQ A;  1JQP A;  3TNX A;  3KFQ A;  1YAL A;  3CH3 X;  4YYU A;  1Q6K A;  3OVZ A;  2O6X A;  1THE A;  1K3B B;  2YJ9 A;  2YJB A;  2FE8 A;  1ZIV A;  3W30 A;  3BBA A;  3BY4 A;  1YZB A;  2BTW A;  2G8J A;  1AEC A;  1AYV A;  4OVZ A;  4G54 A;  2J7Q C;  3PNR A;  3H89 A; 
#chains in the Genus database with same CATH homology
 2E03 A;  2E01 A;  3OF8 A;  2DCB A;  1EWO A;  1ME4 A;  1PPN A;  4QRX A;  4QH6 A;  2Y5B A;  2F7D A;  1TLO A;  4NV7 A;  2NQA A;  1IWD A;  1EWM A;  4W5C A;  4NV8 A;  4W4U A;  1YT7 A;  1NPZ A;  1PIP A;  2NQG A;  3BC3 A;  1CQD A;  2XU4 A;  3P5X A;  3KKU A;  2CIO A;  3IMA A;  1ME3 A;  3OF9 A;  1CPJ A;  1GLO A;  3IUT A;  1MEG A;  1ATK A;  3HWN A;  2G6D A;  2Y6E A;  2R9M A;  2FT2 A;  4Q8H A;  4W5B A;  2FRA A;  1MDW A;  4XR7 A;  1GMY A;  3KWZ A;  4BQV A;  4MSX A;  4CDF B;  1NQC A;  4K7C A;  4KLB A;  2AIM A;  4CDD B;  3D9W A;  2DJG B;  5CHV A;  2FYE A;  4YYR A;  1CB5 A;  1BGO A;  3MOR A;  4FJC A;  4I04 A;  1PCI A;  4CDC B;  3CH2 X;  7PCK A;  4MZO A;  2DZZ A;  3H7D A;  1SNK A;  4DMX A;  2IPP B;  4YVA A;  1PAD A;  2VFC A;  2H7J A;  1KHQ A;  2DJF B;  3HHI A;  3F75 A;  6PAD A;  2AUX A;  5JA7 A;  4N79 A;  2XU5 A;  1M6D A;  4X6J A;  3MTN A;  3K24 A;  3H6S A;  5EF4 A;  1F2B A;  1CSB B;  1AU0 A;  1MHW A;  2B1M A;  3HD3 A;  1AYW A;  5EGW A;  2JQG R;  3BOW A;  3O1G A;  3NHE A;  4BS6 A;  4YYW A;  2IBI A;  5PAD A;  3IHP A;  4QRG A;  3RVX A;  4FIP A;  5FPW A;  1EWL A;  1U9W A;  4Q8G A;  3C9E A;  1DEU A;  2DC8 A;  2CB5 A;  3CBJ A;  1BP4 A;  3DF0 A;  3QJ3 A;  2G7Y A;  4PAD A;  1QOL A;  3B79 A;  2PNS A;  2ARY A;  2JQF R;  2OP3 A;  1A6R A;  4CDE B;  1CVZ A;  2VFB A;  4X6H A;  3S3R A;  3OIS A;  1NLJ A;  5CVO B;  3M99 A;  3MHH A;  3IV2 A;  3RVV A;  3BCN A;  3OVX A;  2VHF A;  2ACT A;  3PW3 A;  2G8E A;  3S3Q A;  5F02 A;  1AU3 A;  1AU2 A;  2AYN A;  2R9F A;  1S4V A;  1FH0 A;  2OZ2 A;  3LFY A;  2HHN A;  1SP4 B;  2PBH A;  2HH5 A;  3PBH A;  2ATO A;  1QDQ A;  2C0Y A;  4PP2 E;  3BWK A;  3V6C A;  4OEM A;  1KFU L;  2GHU A;  2FQ9 A;  2P7U A;  2DC7 A;  4YV8 A;  4BPV A;  5JH3 A;  3K9M A;  1GCB A;  3N3K A;  1VSN A;  1W5R A;  1PPO A;  1MS6 A;  3ZUA A;  1W6F A;  4WA6 A;  2P86 A;  4P6E A;  2FUD A;  1PE6 A;  3KWB X;  1YK7 A;  3LXS A;  1U9Q X;  1CTE A;  5K16 A;  2PRE A;  2AU1 A;  1QXP A;  4DMY A;  2R9C A;  1ZCM A;  2B1N A;  2DZY A;  2P0R A;  4MZS A;  1NB3 A;  2WBF X;  1HUC B;  2DC6 A;  1F2A A;  1KXR A;  1W4T A;  1YK8 A;  3PDF A;  4YYS A;  1U9V A;  2AVW A;  1F2C A;  3ERV A;  4HWY A;  1ICF A;  4X6I A;  3LTW A;  3KX1 A;  5J94 A;  4AXL A;  4RY2 A;  2AS8 A;  1AU4 A;  1EF7 A;  2OUL A;  4ZUX U;  3MHS A;  1E2T A;  4N4Z A;  3I06 A;  2FRQ A;  2R9N A;  1KFX L;  4PP1 A;  3K8U A;  4BGF A;  1CS8 A;  2VHS A;  3CBK A;  2DC9 A;  3V6E A;  3O0U A;  2E02 A;  1GX3 A;  1KHP A;  4I05 A;  5A24 A;  1AIM A;  1Y08 A;  1BY8 A;  3GCB A;  4OEL A;  2DCC A;  2XU1 A;  3BPF A;  3N3G A;  1DF0 A;  4QRV A;  5CVM A;  1GEC E;  4PI3 A;  3D6S A;  8PCH A;  3IEJ A;  2FTD A;  1U9X A;  2YJC A;  4YYV A;  4I07 A;  2YJ8 A;  3RVW A;  2PAD A;  2R9O A;  1Y4H A;  1PPP A;  1U5I A;  3F5V A;  1TL9 A;  1O0E A;  1XKG A;  1BQI A;  2HXZ A;  4QBB A;  3IOQ A;  3QSD A;  2BDZ A;  2BSZ A;  2E00 A;  1NL6 A;  4XUI A;  1ITO A;  1CV8 A;  1PPD A;  1PXV A;  4BS5 A;  1YVB A;  1VJV A;  4B55 A;  3H8B A;  1MEM A;  3P5V A;  3H8C A;  5CVN B;  3USV A;  5CHT A;  4YYQ A;  2BDL A;  2F1G A;  1STF E;  2FO5 A;  2DCA A;  2DCD A;  4CZW A;  2AUZ A;  1MIR A;  9PAP A;  3E1Z B;  4C5P A;  3WXG A;  3HHA A;  3P5U A;  1X9Y A;  3WXF A;  2AYO A;  1AYU A;  4P6G A;  2GFO A;  3P5W A;  4FK5 A;  2XU3 A;  3I3T A;  3KW9 A;  3N4C A;  1TU6 A;  3AI8 A;  4BSQ A;  2NQI A;  1EWP A;  1POP A;  3U8E A;  2YJ2 A;  2HD5 A;  4N8W A;  4AXM A;  1QMY A;  2R6N A;  3WXE A;  1CJL A;  3BPM A;  1F29 A;  1NB5 A;  1PBH A;  2NQD B;  4GUZ A;  3QT4 A;  3KSE A;  1JQP A;  3TNX A;  3KFQ A;  1YAL A;  3CH3 X;  4YYU A;  1Q6K A;  3OVZ A;  2O6X A;  1THE A;  1K3B B;  2YJ9 A;  2YJB A;  1ZIV A;  2G8J A;  1AEC A;  1AYV A;  4G54 A;  3PNR A;  3H89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...