5J94A

Human cathepsin k mutant c25s in complex with the allosteric effector nsc13345
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
223
structure length
223
Chain Sequence
YIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSSWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin K
publication title A novel allosteric mechanism in the cysteine peptidase cathepsin K discovered by computational methods.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 223
sequence length 223
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2016-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 5j94A00
1U9QX 3BOWA 3MHHA 1VSNA 2E01A 5JH3A 3I06A 1A6RA 3AI8A 2JQFR 3RVVA 1PPNA 2R9NA 5FPWA 4W4UA 3IOQA 2R9MA 2R9CA 2DZYA 4K7CA 3C9EA 4W5CA 2YJBA 2B1NA 1CJLA 1THEA 1EWMA 2R9OA 2YJCA 2R9FA 1VJVA 1GCBA 4N8WA 3WXFA 1ITOA 2DCDA 4QRGA 1BP4A 4QBBA 2YJ9A 4G54A 2H7JA 1CQDA 4ZUXU 2ATOA 3O0UA 1Y08A 5CHTA 2GHUA 1O0EA 3WXEA 3DF0A 4P6EA 3QSDA 3LFYA 3LXSA 1CPJA 1FH0A 3MHSA 3BWKA 1PPPA 3RVWA 1DF0A 2OP3A 2CB5A 1PXVA 2HH5A 4CZWA 1ME4A 1YT7A 3HHAA 1GECE 3K8UA 1F2AA 1JQPA 3OVZA 1U5IA 3MTNA 1XKGA 1EWLA 3BC3A 1AYUA 4X6HA 3H89A 2NQAA 3H8CA 4PI3A 4BS5A 4HWYA 3M99A 1CV8A 1AYWA 5EGWA 3CBJA 4FK5A 4YYUA 5CVOB 3U8EA 2DZZA 3PDFA 4PP1A 3ERVA 9PAPA 1MEGA 3I3TA 2R6NA 1NPZA 4BSQA 1BY8A 2AYNA 4I04A 2YJ2A 1KHQA 2DJGB 1DEUA 2DJFB 2AIMA 1QDQA 4PADA 1F2CA 3N4CA 4RY2A 2DC8A 4W5BA 1U9XA 2JQGR 2YJ8A 2P86A 1STFE 2AVWA 4CDDB 2AUXA 4CDFB 2AUZA 5A24A 3V6CA 3IUTA 3F5VA 1YALA 4MZOA 2FTDA 1F29A 4DMYA 4YVAA 2ACTA 1YK7A 5F02A 5JA7A 4I05A 4BS6A 4BPVA 1F2BA 4XUIA 1AU3A 1HUCB 2WBFX 1PPOA 4DMXA 3KW9A 1TU6A 1AECA 1ME3A 3IHPA 4FIPA 2FT2A 1EWOA 2E00A 2FUDA 2XU3A 2NQGA 3H8BA 3KWBX 4YYVA 1AU2A 2DCAA 5CVMA 1KFXL 2HHNA 1KXRA 3H7DA 1BGOA 4X6IA 3BCNA 5J94A 3BPMA 2FO5A 1YK8A 3S3RA 3D6SA 2FYEA 2FRAA 3PW3A 1CTEA 3HHIA 1ZIVA 3NHEA 1NB3A 3RVXA 4WA6A 1AU4A 3GCBA 2DC7A 2GFOA 1NL6A 1MDWA 2DCCA 3P5XA 1ATKA 4YYRA 1QOLA 1EF7A 2E03A 4PP2E 4QRXA 3P5VA 2DC9A 3P5UA 2BDZA 4N4ZA 1Q6KA 1AU0A 2B1MA 4OELA 3CH2X 3OF9A 3QT4A 2IBIA 1SNKA 2G7YA 2ARYA 2BDLA 2OZ2A 3B79A 2NQDB 2FRQA 2IPPB 2NQIA 4KLBA 1SP4B 1Y4HA 2FQ9A 4YYWA 3CH3X 1CVZA 8PCHA 3KKUA 4N79A 1PIPA 3F75A 1QXPA 2Y6EA 3HD3A 4YV8A 4AXLA 3KSEA 3H6SA 1PE6A 1PADA 2Y5BA 1TLOA 3KX1A 1BQIA 2AS8A 3OVXA 1PBHA 1GLOA 2G8EA 5CVNB 1IWDA 3KFQA 1NQCA 3N3KA 1MS6A 1YVBA 4I07A 2O6XA 3IV2A 2DCBA 4Q8HA 2E02A 2HXZA 4QH6A 1AIMA 1TL9A 2P7UA 2C0YA 1EWPA 1KHPA 2PADA 3K9MA 4OEMA 4CDCB 3WXGA 3MORA 2CIOA 3HWNA 4CDEB 3PNRA 1M6DA 2AYOA 2VHSA 3BPFA 1U9WA 4YYSA 2DC6A 4FJCA 2P0RA 3PBHA 3IMAA 2XU5A 3KWZA 2F1GA 4BQVA 2PNSA 1POPA 1AYVA 1NLJA 1QMYA 2G8JA 3OF8A 7PCKA 2F7DA 3P5WA 1X9YA 2XU4A 3CBKA 5CHVA 4XR7A 1MIRA 2HD5A 2G6DA 3ZUAA 4MZSA 4MSXA 4YYQA 3E1ZB 2PREA 4P6GA 5EF4A 3IEJA 3S3QA 1KFUL 3N3GA 1U9VA 3USVA 5K16A 1CS8A 3K24A 1MHWA 1NB5A 2OULA 2XU1A 1PPDA 2VHFA 3O1GA 2AU1A 3V6EA 1GMYA 1PCIA 2PBHA 1CB5A 5PADA 1ICFA 1S4VA 4Q8GA 3TNXA 4X6JA 4AXMA 1CSBB 6PADA 3QJ3A 1MEMA 4QRVA 1K3BB 1ZCMA 3OISA
chains in the Genus database with same CATH superfamily
1U9QX 3BOWA 3MHHA 1VSNA 2E01A 4REZA 5JH3A 3I06A 1A6RA 3AI8A 2JQFR 3RVVA 1PPNA 2R9NA 5FPWA 4W4UA 3IOQA 2R9MA 1YZBA 2R9CA 2DZYA 4K7CA 3C9EA 4W5CA 2YJBA 4M0WA 2B1NA 1CJLA 1THEA 1EWMA 2R9OA 2YJCA 3W30A 2R9FA 1VJVA 4OVZB 1GCBA 2DOSA 4N8WA 3WXFA 3PHWA 1ITOA 2DCDA 4QRGA 1BP4A 4QBBA 2YJ9A 4G54A 2H7JA 1CQDA 4ZUXU 2ATOA 3O0UA 3B21A 1Y08A 5CHTA 2GHUA 1O0EA 3WXEA 3DF0A 4P6EA 3QSDA 3LFYA 3BB7A 3LXSA 1CPJA 1FH0A 3W31A 3MHSA 4BOSA 3BWKA 1PPPA 3RVWA 1DF0A 2OP3A 5EZSA 2BTWA 2CB5A 1PXVA 2HH5A 4CZWA 1ME4A 1YT7A 3HHAA 1GECE 2Z84A 3K8UA 1F2AA 1JQPA 3OVZA 1U5IA 3MTNA 1XKGA 3O65A 1EWLA 3BC3A 1AYUA 4X6HA 3H89A 2NQAA 3IFUA 3H8CA 4PI3A 4BS5A 4HWYA 3M99A 1CV8A 1AYWA 5EGWA 3CBJA 4FK5A 4YYUA 4IP3A 5CVOB 3U8EA 2DZZA 3PDFA 4PP1A 5KO3A 3ERVA 3BBAA 9PAPA 1MEGA 3I3TA 2R6NA 1NPZA 2UZJA 4BSQA 4OW0A 1BY8A 2AYNA 2BU3A 4I04A 2YJ2A 1KHQA 2DJGB 1DEUA 2DJFB 2AIMA 5E6JA 1QDQA 3PT2A 4PADA 1F2CA 3N4CA 4RY2A 2DC8A 4W5BA 1U9XA 2JQGR 2YJ8A 3PSEA 2P86A 1STFE 2AVWA 4CDDB 4IUMA 2AUXA 4CDFB 4BOZA 4BOPA 4RKXA 2AUZA 5A24A 1DKIA 3V6CA 2J7QA 3IUTA 3F5VA 2JTCA 1YALA 3PHXA 4MZOA 2FTDA 1F29A 4P16A 4DMYA 4RF1A 4YVAA 2ACTA 4RNAA 1YK7A 5F02A 5JA7A 4I05A 4BS6A 4BPVA 1F2BA 4XUIA 1AU3A 1HUCB 3MTVA 2WBFX 1PPOA 4DMXA 3KW9A 1TU6A 1AECA 1ME3A 3IHPA 4FIPA 2FT2A 1EWOA 2E00A 2FUDA 2XU3A 2NQGA 3H8BA 3KWBX 4YYVA 2J7QC 1AU2A 2DCAA 5CVMA 1KFXL 2HHNA 4D8IA 1KXRA 3H7DA 1BGOA 4X6IA 3BCNA 5J94A 3BPMA 2FO5A 1YK8A 3S3RA 3D6SA 2FYEA 2FRAA 3PW3A 1CTEA 3BY4A 3HHIA 1ZIVA 3NHEA 1NB3A 3RVXA 4WA6A 1AU4A 3GCBA 2DC7A 3PHUA 2GFOA 1NL6A 1MDWA 4OVZA 2DCCA 3P5XA 1ATKA 4YYRA 1QOLA 1EF7A 2E03A 4PP2E 4QRXA 4MI7A 3P5VA 3PRPA 2DC9A 3P5UA 2BDZA 4N4ZA 1Q6KA 1AU0A 2B1MA 4OELA 1PVJA 3CH2X 4A5UA 3OF9A 3QT4A 2IBIA 1SNKA 2G7YA 3MP2A 2ARYA 2BDLA 2OZ2A 3B79A 2NQDB 2FRQA 2IPPB 2NQIA 4KLBA 1SP4B 1Y4HA 4BOQA 2FQ9A 4YYWA 3CH3X 1CVZA 8PCHA 3TMPA 3KKUA 4N79A 1PIPA 3F75A 1QXPA 2Y6EA 3HD3A 4YV8A 4AXLA 3KSEA 3H6SA 1PE6A 1PADA 2Y5BA 1TLOA 3KX1A 1BQIA 2AS8A 3OVXA 1PBHA 1GLOA 2G8EA 5CVNB 3OQCA 1IWDA 2HWKA 3KFQA 1NQCA 4HXDB 3N3KA 1MS6A 2AGAA 3PRMA 1YVBA 4I07A 2O6XA 3IV2A 2DCBA 4Q8HA 2E02A 2HXZA 4GUAA 2BTWB 4QH6A 1AIMA 1TL9A 2P7UA 2C0YA 1EWPA 1KHPA 2PADA 3K9MA 4OEMA 4CDCB 3WXGA 3MORA 2FE8A 2CIOA 3HWNA 4PT5A 4CDEB 3PNRA 1M6DA 2AYOA 2VHSA 3BPFA 1U9WA 4RF0A 4YYSA 2DC6A 4FJCA 2P0RA 3PBHA 3IMAA 2XU5A 3KWZA 2F1GA 4BQVA 2PNSA 1POPA 1AYVA 1NLJA 1QMYA 2G8JA 3OF8A 7PCKA 2F7DA 3P5WA 5JZEA 1X9YA 2XU4A 5EZQA 3CBKA 5CHVA 4XR7A 3C0RA 1MIRA 2HD5A 2G6DA 3ZUAA 4MZSA 4MSXA 3E9SA 2JRIA 3ZNHA 3RNVA 4YYQA 4WURA 3E1ZB 3TRKA 2PREA 4D8EA 4P6GA 5EF4A 3IEJA 3S3QA 1KFUL 3N3GA 1U9VA 3USVA 5K16A 1CS8A 1UKFA 3K24A 1MHWA 1NB5A 2OULA 2XU1A 1PPDA 4XZXA 4BOUA 2VHFA 3O1GA 2AU1A 3V6EA 1GMYA 4R3DA 1PCIA 2PBHA 1CB5A 5PADA 1ICFA 1S4VA 4D8BA 4Q8GA 3TNXA 3MJ5A 4X6JA 4AXMA 1CSBB 6PADA 4MM3B 3QJ3A 1MEMA 4QRVA 1K3BB 4ZTBA 1ZCMA 3OISA
chains in the Genus database with same CATH topology
1U9QX 3BOWA 3MHHA 1VSNA 2E01A 5JH3A 3I06A 1A6RA 3AI8A 2JQFR 3RVVA 1PPNA 2R9NA 5FPWA 4W4UA 3IOQA 2R9MA 2R9CA 2DZYA 4K7CA 3C9EA 4W5CA 2YJBA 2B1NA 1CJLA 1THEA 1EWMA 2R9OA 2YJCA 2R9FA 1VJVA 1GCBA 4N8WA 3WXFA 1ITOA 1GX3A 2DCDA 4QRGA 1BP4A 4QBBA 2YJ9A 4G54A 2H7JA 1CQDA 4ZUXU 2ATOA 3O0UA 3D9WA 1Y08A 5CHTA 2GHUA 1O0EA 3WXEA 3DF0A 4P6EA 3QSDA 3LFYA 3LXSA 1CPJA 1FH0A 3MHSA 3BWKA 1PPPA 3RVWA 1DF0A 2OP3A 2VFBA 2CB5A 1PXVA 2HH5A 4CZWA 1ME4A 1YT7A 3HHAA 1GECE 3K8UA 1F2AA 1JQPA 3OVZA 1U5IA 3MTNA 1XKGA 1EWLA 3BC3A 1AYUA 4X6HA 3H89A 4BGFA 2NQAA 3H8CA 4PI3A 4BS5A 4HWYA 3M99A 1CV8A 1AYWA 5EGWA 3CBJA 4FK5A 4YYUA 5CVOB 3U8EA 2DZZA 3PDFA 4PP1A 3ERVA 9PAPA 1MEGA 3I3TA 2R6NA 1W6FA 1NPZA 4BSQA 1BY8A 2AYNA 4I04A 2YJ2A 1KHQA 2DJGB 1DEUA 2DJFB 2AIMA 1QDQA 4PADA 4C5PA 1F2CA 3N4CA 4RY2A 2DC8A 4W5BA 1U9XA 2JQGR 2YJ8A 2P86A 1STFE 2AVWA 4CDDB 2AUXA 4CDFB 4NV8A 2AUZA 5A24A 3V6CA 3IUTA 3F5VA 1YALA 4MZOA 2FTDA 1F29A 4DMYA 4YVAA 2ACTA 1YK7A 5F02A 5JA7A 4I05A 4BS6A 4BPVA 1F2BA 4XUIA 1AU3A 1E2TA 1HUCB 2WBFX 1PPOA 4DMXA 3KW9A 1TU6A 1AECA 1ME3A 3IHPA 4FIPA 2FT2A 1EWOA 2E00A 2FUDA 2XU3A 2NQGA 3H8BA 3KWBX 4YYVA 2BSZA 1AU2A 2DCAA 5CVMA 1KFXL 2HHNA 1KXRA 3H7DA 1BGOA 4X6IA 3BCNA 5J94A 3BPMA 2FO5A 1YK8A 3S3RA 3D6SA 2FYEA 2FRAA 3PW3A 4B55A 1CTEA 3HHIA 1ZIVA 3NHEA 1NB3A 3RVXA 4WA6A 1AU4A 3GCBA 2DC7A 2GFOA 1NL6A 1MDWA 2DCCA 3P5XA 1ATKA 4YYRA 1QOLA 1EF7A 2E03A 4PP2E 4QRXA 3P5VA 2DC9A 3P5UA 2BDZA 4N4ZA 1Q6KA 1AU0A 2B1MA 4OELA 3CH2X 3OF9A 3QT4A 2IBIA 1SNKA 2G7YA 2ARYA 2BDLA 2OZ2A 4NV7A 3B79A 2NQDB 2FRQA 2IPPB 2NQIA 4KLBA 1SP4B 1Y4HA 2FQ9A 4YYWA 3CH3X 1CVZA 8PCHA 3KKUA 4N79A 1PIPA 3F75A 1QXPA 2Y6EA 3HD3A 4YV8A 4AXLA 3KSEA 3H6SA 1PE6A 1PADA 2Y5BA 1TLOA 3KX1A 1BQIA 2AS8A 3OVXA 1PBHA 1GLOA 2G8EA 5CVNB 1IWDA 3KFQA 1NQCA 3N3KA 1MS6A 1YVBA 4I07A 2O6XA 3IV2A 2DCBA 4Q8HA 2E02A 2HXZA 4QH6A 1AIMA 1TL9A 2P7UA 2C0YA 1EWPA 1KHPA 2PADA 4GUZA 3K9MA 4OEMA 4CDCB 3WXGA 3MORA 2CIOA 3HWNA 4CDEB 3PNRA 1M6DA 2AYOA 2VHSA 3BPFA 1U9WA 4YYSA 2DC6A 4FJCA 2P0RA 3PBHA 3IMAA 2XU5A 3KWZA 2F1GA 2VFCA 4BQVA 2PNSA 1POPA 1AYVA 1NLJA 1QMYA 2G8JA 3OF8A 7PCKA 2F7DA 3P5WA 1X9YA 2XU4A 3CBKA 5CHVA 4XR7A 1MIRA 2HD5A 2G6DA 3ZUAA 4MZSA 4MSXA 4YYQA 3E1ZB 2PREA 4P6GA 5EF4A 3IEJA 3S3QA 1KFUL 3LTWA 3N3GA 1U9VA 3USVA 5K16A 1CS8A 3K24A 1MHWA 1NB5A 2OULA 2XU1A 1PPDA 2VHFA 3O1GA 2AU1A 3V6EA 1GMYA 1PCIA 2PBHA 1CB5A 1W4TA 5PADA 1ICFA 1S4VA 4Q8GA 3TNXA 4X6JA 1W5RA 4AXMA 1CSBB 6PADA 3QJ3A 1MEMA 4QRVA 1K3BB 1ZCMA 3OISA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U9Q X;  3BOW A;  3MHH A;  1VSN A;  2E01 A;  5JH3 A;  3I06 A;  1A6R A;  3AI8 A;  2JQF R;  3RVV A;  1PPN A;  2R9N A;  5FPW A;  4W4U A;  3IOQ A;  2R9M A;  2R9C A;  2DZY A;  4K7C A;  3C9E A;  4W5C A;  2YJB A;  2B1N A;  1CJL A;  1THE A;  1EWM A;  2R9O A;  2YJC A;  2R9F A;  1VJV A;  1GCB A;  4N8W A;  3WXF A;  1ITO A;  2DCD A;  4QRG A;  1BP4 A;  4QBB A;  2YJ9 A;  4G54 A;  2H7J A;  1CQD A;  4ZUX U;  2ATO A;  3O0U A;  1Y08 A;  5CHT A;  2GHU A;  1O0E A;  3WXE A;  3DF0 A;  4P6E A;  3QSD A;  3LFY A;  3LXS A;  1CPJ A;  1FH0 A;  3MHS A;  3BWK A;  1PPP A;  3RVW A;  1DF0 A;  2OP3 A;  2CB5 A;  1PXV A;  2HH5 A;  4CZW A;  1ME4 A;  1YT7 A;  3HHA A;  1GEC E;  3K8U A;  1F2A A;  1JQP A;  3OVZ A;  1U5I A;  3MTN A;  1XKG A;  1EWL A;  3BC3 A;  1AYU A;  4X6H A;  3H89 A;  2NQA A;  3H8C A;  4PI3 A;  4BS5 A;  4HWY A;  3M99 A;  1CV8 A;  1AYW A;  5EGW A;  3CBJ A;  4FK5 A;  4YYU A;  5CVO B;  3U8E A;  2DZZ A;  3PDF A;  4PP1 A;  3ERV A;  9PAP A;  1MEG A;  3I3T A;  2R6N A;  1NPZ A;  4BSQ A;  1BY8 A;  2AYN A;  4I04 A;  2YJ2 A;  1KHQ A;  2DJG B;  1DEU A;  2DJF B;  2AIM A;  1QDQ A;  4PAD A;  1F2C A;  3N4C A;  4RY2 A;  2DC8 A;  4W5B A;  1U9X A;  2JQG R;  2YJ8 A;  2P86 A;  1STF E;  2AVW A;  4CDD B;  2AUX A;  4CDF B;  2AUZ A;  5A24 A;  3V6C A;  3IUT A;  3F5V A;  1YAL A;  4MZO A;  2FTD A;  1F29 A;  4DMY A;  4YVA A;  2ACT A;  1YK7 A;  5F02 A;  5JA7 A;  4I05 A;  4BS6 A;  4BPV A;  1F2B A;  4XUI A;  1AU3 A;  1HUC B;  2WBF X;  1PPO A;  4DMX A;  3KW9 A;  1TU6 A;  1AEC A;  1ME3 A;  3IHP A;  4FIP A;  2FT2 A;  1EWO A;  2E00 A;  2FUD A;  2XU3 A;  2NQG A;  3H8B A;  3KWB X;  4YYV A;  1AU2 A;  2DCA A;  5CVM A;  1KFX L;  2HHN A;  1KXR A;  3H7D A;  1BGO A;  4X6I A;  3BCN A;  5J94 A;  3BPM A;  2FO5 A;  1YK8 A;  3S3R A;  3D6S A;  2FYE A;  2FRA A;  3PW3 A;  1CTE A;  3HHI A;  1ZIV A;  3NHE A;  1NB3 A;  3RVX A;  4WA6 A;  1AU4 A;  3GCB A;  2DC7 A;  2GFO A;  1NL6 A;  1MDW A;  2DCC A;  3P5X A;  1ATK A;  4YYR A;  1QOL A;  1EF7 A;  2E03 A;  4PP2 E;  4QRX A;  3P5V A;  2DC9 A;  3P5U A;  2BDZ A;  4N4Z A;  1Q6K A;  1AU0 A;  2B1M A;  4OEL A;  3CH2 X;  3OF9 A;  3QT4 A;  2IBI A;  1SNK A;  2G7Y A;  2ARY A;  2BDL A;  2OZ2 A;  3B79 A;  2NQD B;  2FRQ A;  2IPP B;  2NQI A;  4KLB A;  1SP4 B;  1Y4H A;  2FQ9 A;  4YYW A;  3CH3 X;  1CVZ A;  8PCH A;  3KKU A;  4N79 A;  1PIP A;  3F75 A;  1QXP A;  2Y6E A;  3HD3 A;  4YV8 A;  4AXL A;  3KSE A;  3H6S A;  1PE6 A;  1PAD A;  2Y5B A;  1TLO A;  3KX1 A;  1BQI A;  2AS8 A;  3OVX A;  1PBH A;  1GLO A;  2G8E A;  5CVN B;  1IWD A;  3KFQ A;  1NQC A;  3N3K A;  1MS6 A;  1YVB A;  4I07 A;  2O6X A;  3IV2 A;  2DCB A;  4Q8H A;  2E02 A;  2HXZ A;  4QH6 A;  1AIM A;  1TL9 A;  2P7U A;  2C0Y A;  1EWP A;  1KHP A;  2PAD A;  3K9M A;  4OEM A;  4CDC B;  3WXG A;  3MOR A;  2CIO A;  3HWN A;  4CDE B;  3PNR A;  1M6D A;  2AYO A;  2VHS A;  3BPF A;  1U9W A;  4YYS A;  2DC6 A;  4FJC A;  2P0R A;  3PBH A;  3IMA A;  2XU5 A;  3KWZ A;  2F1G A;  4BQV A;  2PNS A;  1POP A;  1AYV A;  1NLJ A;  1QMY A;  2G8J A;  3OF8 A;  7PCK A;  2F7D A;  3P5W A;  1X9Y A;  2XU4 A;  3CBK A;  5CHV A;  4XR7 A;  1MIR A;  2HD5 A;  2G6D A;  3ZUA A;  4MZS A;  4MSX A;  4YYQ A;  3E1Z B;  2PRE A;  4P6G A;  5EF4 A;  3IEJ A;  3S3Q A;  1KFU L;  3N3G A;  1U9V A;  3USV A;  5K16 A;  1CS8 A;  3K24 A;  1MHW A;  1NB5 A;  2OUL A;  2XU1 A;  1PPD A;  2VHF A;  3O1G A;  2AU1 A;  3V6E A;  1GMY A;  1PCI A;  2PBH A;  1CB5 A;  5PAD A;  1ICF A;  1S4V A;  4Q8G A;  3TNX A;  4X6J A;  4AXM A;  1CSB B;  6PAD A;  3QJ3 A;  1MEM A;  4QRV A;  1K3B B;  1ZCM A;  3OIS A; 
#chains in the Genus database with same CATH topology
 1U9Q X;  3BOW A;  3MHH A;  1VSN A;  2E01 A;  4REZ A;  5JH3 A;  3I06 A;  1A6R A;  3AI8 A;  2JQF R;  3RVV A;  1PPN A;  2R9N A;  5FPW A;  4W4U A;  3IOQ A;  2R9M A;  1YZB A;  2R9C A;  2DZY A;  4K7C A;  3C9E A;  4W5C A;  2YJB A;  4M0W A;  2B1N A;  1CJL A;  1THE A;  1EWM A;  2R9O A;  2YJC A;  3W30 A;  2R9F A;  1VJV A;  4OVZ B;  1GCB A;  2DOS A;  4N8W A;  3WXF A;  3PHW A;  1ITO A;  2DCD A;  4QRG A;  1BP4 A;  4QBB A;  2YJ9 A;  4G54 A;  2H7J A;  1CQD A;  4ZUX U;  2ATO A;  3O0U A;  3B21 A;  1Y08 A;  5CHT A;  2GHU A;  1O0E A;  3WXE A;  3DF0 A;  4P6E A;  3QSD A;  3LFY A;  3BB7 A;  3LXS A;  1CPJ A;  1FH0 A;  3W31 A;  3MHS A;  4BOS A;  3BWK A;  1PPP A;  3RVW A;  1DF0 A;  2OP3 A;  5EZS A;  2BTW A;  2CB5 A;  1PXV A;  2HH5 A;  4CZW A;  1ME4 A;  1YT7 A;  3HHA A;  1GEC E;  2Z84 A;  3K8U A;  1F2A A;  1JQP A;  3OVZ A;  1U5I A;  3MTN A;  1XKG A;  3O65 A;  1EWL A;  3BC3 A;  1AYU A;  4X6H A;  3H89 A;  2NQA A;  3IFU A;  3H8C A;  4PI3 A;  4BS5 A;  4HWY A;  3M99 A;  1CV8 A;  1AYW A;  5EGW A;  3CBJ A;  4FK5 A;  4YYU A;  4IP3 A;  5CVO B;  3U8E A;  2DZZ A;  3PDF A;  4PP1 A;  5KO3 A;  3ERV A;  3BBA A;  9PAP A;  1MEG A;  3I3T A;  2R6N A;  1NPZ A;  2UZJ A;  4BSQ A;  4OW0 A;  1BY8 A;  2AYN A;  2BU3 A;  4I04 A;  2YJ2 A;  1KHQ A;  2DJG B;  1DEU A;  2DJF B;  2AIM A;  5E6J A;  1QDQ A;  3PT2 A;  4PAD A;  1F2C A;  3N4C A;  4RY2 A;  2DC8 A;  4W5B A;  1U9X A;  2JQG R;  2YJ8 A;  3PSE A;  2P86 A;  1STF E;  2AVW A;  4CDD B;  4IUM A;  2AUX A;  4CDF B;  4BOZ A;  4BOP A;  4RKX A;  2AUZ A;  5A24 A;  1DKI A;  3V6C A;  2J7Q A;  3IUT A;  3F5V A;  2JTC A;  1YAL A;  3PHX A;  4MZO A;  2FTD A;  1F29 A;  4P16 A;  4DMY A;  4RF1 A;  4YVA A;  2ACT A;  4RNA A;  1YK7 A;  5F02 A;  5JA7 A;  4I05 A;  4BS6 A;  4BPV A;  1F2B A;  4XUI A;  1AU3 A;  1HUC B;  3MTV A;  2WBF X;  1PPO A;  4DMX A;  3KW9 A;  1TU6 A;  1AEC A;  1ME3 A;  3IHP A;  4FIP A;  2FT2 A;  1EWO A;  2E00 A;  2FUD A;  2XU3 A;  2NQG A;  3H8B A;  3KWB X;  4YYV A;  2J7Q C;  1AU2 A;  2DCA A;  5CVM A;  1KFX L;  2HHN A;  4D8I A;  1KXR A;  3H7D A;  1BGO A;  4X6I A;  3BCN A;  5J94 A;  3BPM A;  2FO5 A;  1YK8 A;  3S3R A;  3D6S A;  2FYE A;  2FRA A;  3PW3 A;  1CTE A;  3BY4 A;  3HHI A;  1ZIV A;  3NHE A;  1NB3 A;  3RVX A;  4WA6 A;  1AU4 A;  3GCB A;  2DC7 A;  3PHU A;  2GFO A;  1NL6 A;  1MDW A;  4OVZ A;  2DCC A;  3P5X A;  1ATK A;  4YYR A;  1QOL A;  1EF7 A;  2E03 A;  4PP2 E;  4QRX A;  4MI7 A;  3P5V A;  3PRP A;  2DC9 A;  3P5U A;  2BDZ A;  4N4Z A;  1Q6K A;  1AU0 A;  2B1M A;  4OEL A;  1PVJ A;  3CH2 X;  4A5U A;  3OF9 A;  3QT4 A;  2IBI A;  1SNK A;  2G7Y A;  3MP2 A;  2ARY A;  2BDL A;  2OZ2 A;  3B79 A;  2NQD B;  2FRQ A;  2IPP B;  2NQI A;  4KLB A;  1SP4 B;  1Y4H A;  4BOQ A;  2FQ9 A;  4YYW A;  3CH3 X;  1CVZ A;  8PCH A;  3TMP A;  3KKU A;  4N79 A;  1PIP A;  3F75 A;  1QXP A;  2Y6E A;  3HD3 A;  4YV8 A;  4AXL A;  3KSE A;  3H6S A;  1PE6 A;  1PAD A;  2Y5B A;  1TLO A;  3KX1 A;  1BQI A;  2AS8 A;  3OVX A;  1PBH A;  1GLO A;  2G8E A;  5CVN B;  3OQC A;  1IWD A;  2HWK A;  3KFQ A;  1NQC A;  4HXD B;  3N3K A;  1MS6 A;  2AGA A;  3PRM A;  1YVB A;  4I07 A;  2O6X A;  3IV2 A;  2DCB A;  4Q8H A;  2E02 A;  2HXZ A;  4GUA A;  2BTW B;  4QH6 A;  1AIM A;  1TL9 A;  2P7U A;  2C0Y A;  1EWP A;  1KHP A;  2PAD A;  3K9M A;  4OEM A;  4CDC B;  3WXG A;  3MOR A;  2FE8 A;  2CIO A;  3HWN A;  4PT5 A;  4CDE B;  3PNR A;  1M6D A;  2AYO A;  2VHS A;  3BPF A;  1U9W A;  4RF0 A;  4YYS A;  2DC6 A;  4FJC A;  2P0R A;  3PBH A;  3IMA A;  2XU5 A;  3KWZ A;  2F1G A;  4BQV A;  2PNS A;  1POP A;  1AYV A;  1NLJ A;  1QMY A;  2G8J A;  3OF8 A;  7PCK A;  2F7D A;  3P5W A;  5JZE A;  1X9Y A;  2XU4 A;  5EZQ A;  3CBK A;  5CHV A;  4XR7 A;  3C0R A;  1MIR A;  2HD5 A;  2G6D A;  3ZUA A;  4MZS A;  4MSX A;  3E9S A;  2JRI A;  3ZNH A;  3RNV A;  4YYQ A;  4WUR A;  3E1Z B;  3TRK A;  2PRE A;  4D8E A;  4P6G A;  5EF4 A;  3IEJ A;  3S3Q A;  1KFU L;  3N3G A;  1U9V A;  3USV A;  5K16 A;  1CS8 A;  1UKF A;  3K24 A;  1MHW A;  1NB5 A;  2OUL A;  2XU1 A;  1PPD A;  4XZX A;  4BOU A;  2VHF A;  3O1G A;  2AU1 A;  3V6E A;  1GMY A;  4R3D A;  1PCI A;  2PBH A;  1CB5 A;  5PAD A;  1ICF A;  1S4V A;  4D8B A;  4Q8G A;  3TNX A;  3MJ5 A;  4X6J A;  4AXM A;  1CSB B;  6PAD A;  4MM3 B;  3QJ3 A;  1MEM A;  4QRV A;  1K3B B;  4ZTB A;  1ZCM A;  3OIS A; 
#chains in the Genus database with same CATH homology
 1U9Q X;  3BOW A;  3MHH A;  1VSN A;  2E01 A;  5JH3 A;  3I06 A;  1A6R A;  3AI8 A;  2JQF R;  3RVV A;  1PPN A;  2R9N A;  5FPW A;  4W4U A;  3IOQ A;  2R9M A;  2R9C A;  2DZY A;  4K7C A;  3C9E A;  4W5C A;  2YJB A;  2B1N A;  1CJL A;  1THE A;  1EWM A;  2R9O A;  2YJC A;  2R9F A;  1VJV A;  1GCB A;  4N8W A;  3WXF A;  1ITO A;  1GX3 A;  2DCD A;  4QRG A;  1BP4 A;  4QBB A;  2YJ9 A;  4G54 A;  2H7J A;  1CQD A;  4ZUX U;  2ATO A;  3O0U A;  3D9W A;  1Y08 A;  5CHT A;  2GHU A;  1O0E A;  3WXE A;  3DF0 A;  4P6E A;  3QSD A;  3LFY A;  3LXS A;  1CPJ A;  1FH0 A;  3MHS A;  3BWK A;  1PPP A;  3RVW A;  1DF0 A;  2OP3 A;  2VFB A;  2CB5 A;  1PXV A;  2HH5 A;  4CZW A;  1ME4 A;  1YT7 A;  3HHA A;  1GEC E;  3K8U A;  1F2A A;  1JQP A;  3OVZ A;  1U5I A;  3MTN A;  1XKG A;  1EWL A;  3BC3 A;  1AYU A;  4X6H A;  3H89 A;  4BGF A;  2NQA A;  3H8C A;  4PI3 A;  4BS5 A;  4HWY A;  3M99 A;  1CV8 A;  1AYW A;  5EGW A;  3CBJ A;  4FK5 A;  4YYU A;  5CVO B;  3U8E A;  2DZZ A;  3PDF A;  4PP1 A;  3ERV A;  9PAP A;  1MEG A;  3I3T A;  2R6N A;  1W6F A;  1NPZ A;  4BSQ A;  1BY8 A;  2AYN A;  4I04 A;  2YJ2 A;  1KHQ A;  2DJG B;  1DEU A;  2DJF B;  2AIM A;  1QDQ A;  4PAD A;  4C5P A;  1F2C A;  3N4C A;  4RY2 A;  2DC8 A;  4W5B A;  1U9X A;  2JQG R;  2YJ8 A;  2P86 A;  1STF E;  2AVW A;  4CDD B;  2AUX A;  4CDF B;  4NV8 A;  2AUZ A;  5A24 A;  3V6C A;  3IUT A;  3F5V A;  1YAL A;  4MZO A;  2FTD A;  1F29 A;  4DMY A;  4YVA A;  2ACT A;  1YK7 A;  5F02 A;  5JA7 A;  4I05 A;  4BS6 A;  4BPV A;  1F2B A;  4XUI A;  1AU3 A;  1E2T A;  1HUC B;  2WBF X;  1PPO A;  4DMX A;  3KW9 A;  1TU6 A;  1AEC A;  1ME3 A;  3IHP A;  4FIP A;  2FT2 A;  1EWO A;  2E00 A;  2FUD A;  2XU3 A;  2NQG A;  3H8B A;  3KWB X;  4YYV A;  2BSZ A;  1AU2 A;  2DCA A;  5CVM A;  1KFX L;  2HHN A;  1KXR A;  3H7D A;  1BGO A;  4X6I A;  3BCN A;  5J94 A;  3BPM A;  2FO5 A;  1YK8 A;  3S3R A;  3D6S A;  2FYE A;  2FRA A;  3PW3 A;  4B55 A;  1CTE A;  3HHI A;  1ZIV A;  3NHE A;  1NB3 A;  3RVX A;  4WA6 A;  1AU4 A;  3GCB A;  2DC7 A;  2GFO A;  1NL6 A;  1MDW A;  2DCC A;  3P5X A;  1ATK A;  4YYR A;  1QOL A;  1EF7 A;  2E03 A;  4PP2 E;  4QRX A;  3P5V A;  2DC9 A;  3P5U A;  2BDZ A;  4N4Z A;  1Q6K A;  1AU0 A;  2B1M A;  4OEL A;  3CH2 X;  3OF9 A;  3QT4 A;  2IBI A;  1SNK A;  2G7Y A;  2ARY A;  2BDL A;  2OZ2 A;  4NV7 A;  3B79 A;  2NQD B;  2FRQ A;  2IPP B;  2NQI A;  4KLB A;  1SP4 B;  1Y4H A;  2FQ9 A;  4YYW A;  3CH3 X;  1CVZ A;  8PCH A;  3KKU A;  4N79 A;  1PIP A;  3F75 A;  1QXP A;  2Y6E A;  3HD3 A;  4YV8 A;  4AXL A;  3KSE A;  3H6S A;  1PE6 A;  1PAD A;  2Y5B A;  1TLO A;  3KX1 A;  1BQI A;  2AS8 A;  3OVX A;  1PBH A;  1GLO A;  2G8E A;  5CVN B;  1IWD A;  3KFQ A;  1NQC A;  3N3K A;  1MS6 A;  1YVB A;  4I07 A;  2O6X A;  3IV2 A;  2DCB A;  4Q8H A;  2E02 A;  2HXZ A;  4QH6 A;  1AIM A;  1TL9 A;  2P7U A;  2C0Y A;  1EWP A;  1KHP A;  2PAD A;  4GUZ A;  3K9M A;  4OEM A;  4CDC B;  3WXG A;  3MOR A;  2CIO A;  3HWN A;  4CDE B;  3PNR A;  1M6D A;  2AYO A;  2VHS A;  3BPF A;  1U9W A;  4YYS A;  2DC6 A;  4FJC A;  2P0R A;  3PBH A;  3IMA A;  2XU5 A;  3KWZ A;  2F1G A;  2VFC A;  4BQV A;  2PNS A;  1POP A;  1AYV A;  1NLJ A;  1QMY A;  2G8J A;  3OF8 A;  7PCK A;  2F7D A;  3P5W A;  1X9Y A;  2XU4 A;  3CBK A;  5CHV A;  4XR7 A;  1MIR A;  2HD5 A;  2G6D A;  3ZUA A;  4MZS A;  4MSX A;  4YYQ A;  3E1Z B;  2PRE A;  4P6G A;  5EF4 A;  3IEJ A;  3S3Q A;  1KFU L;  3LTW A;  3N3G A;  1U9V A;  3USV A;  5K16 A;  1CS8 A;  3K24 A;  1MHW A;  1NB5 A;  2OUL A;  2XU1 A;  1PPD A;  2VHF A;  3O1G A;  2AU1 A;  3V6E A;  1GMY A;  1PCI A;  2PBH A;  1CB5 A;  1W4T A;  5PAD A;  1ICF A;  1S4V A;  4Q8G A;  3TNX A;  4X6J A;  1W5R A;  4AXM A;  1CSB B;  6PAD A;  3QJ3 A;  1MEM A;  4QRV A;  1K3B B;  1ZCM A;  3OIS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...