5J94A

Human cathepsin k mutant c25s in complex with the allosteric effector nsc13345
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
223
structure length
223
Chain Sequence
YIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSSWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title A novel allosteric mechanism in the cysteine peptidase cathepsin K discovered by computational methods.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 67
structure length 223
sequence length 223
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2016-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 5j94A00
1HUCB 1O0EA 4G54A 3H89A 3IOQA 1VSNA 1STFE 2JQFR 1Y4HA 3USVA 4I04A 4W5BA 1KHQA 2DC8A 1U9QX 1ZIVA 4YYVA 2AIMA 1QMYA 3F5VA 3P5XA 4CZWA 3WXEA 1POPA 1TU6A 1EWOA 1VJVA 4PP2E 2E02A 1KFUL 3OISA 2FT2A 2AU1A 4FJCA 1EF7A 1F29A 4FK5A 1MDWA 2NQGA 2DCDA 1QOLA 2C0YA 4YV8A 1PCIA 3B79A 3H7DA 1U9VA 4PADA 4QBBA 2AUXA 2HHNA 2R6NA 2FYEA 3RVWA 4WA6A 1MIRA 1ITOA 1TL9A 4X6IA 1X9YA 3HHAA 4PP1A 2PBHA 4MZOA 2F7DA 2E00A 5J94A 3MORA 2Y6EA 3MTNA 1QXPA 3CH2X 3D6SA 3BWKA 2R9FA 1YK8A 2NQAA 4BS5A 5FPWA 3I3TA 3KWZA 2P7UA 3KFQA 3CH3X 3TNXA 3QJ3A 3V6CA 3RVVA 4OEMA 3HD3A 1S4VA 1TLOA 2R9CA 3PNRA 1QDQA 2DZYA 2OP3A 3BOWA 1ATKA 4QH6A 2ACTA 4QRVA 1EWPA 2DZZA 3HWNA 3P5UA 4Q8GA 3QSDA 3P5VA 1CV8A 4FIPA 3LXSA 1NL6A 1PPPA 1CJLA 4CDEB 5CVMA 2Y5BA 1NB3A 2DC9A 2G6DA 4YVAA 4I05A 2XU4A 3KX1A 1AU3A 2B1NA 2YJBA 1AIMA 3ZUAA 2F1GA 2OZ2A 3PBHA 2GHUA 3CBKA 5F02A 3KSEA 5EF4A 4P6GA 2YJCA 1F2BA 1MEGA 2XU5A 1KHPA 6PADA 2P0RA 5K16A 1ME4A 4BSQA 3KKUA 4N8WA 3V6EA 1CQDA 2E01A 5PADA 1PIPA 1CB5A 4MSXA 1THEA 2AYOA 1KFXL 1U9XA 1NLJA 2G7YA 3PW3A 3IMAA 1MS6A 1PPOA 2P86A 3WXGA 2R9MA 2CB5A 1CS8A 1CSBB 2CIOA 2HD5A 2DC6A 1AU2A 1A6RA 3BC3A 1AU0A 5A24A 3IUTA 1GLOA 4QRGA 4N79A 2DC7A 4KLBA 2AUZA 5CVNB 2JQGR 4YYQA 1DF0A 4RY2A 1CTEA 1SNKA 1KXRA 4MZSA 4YYWA 2AYNA 3KW9A 4X6HA 3OF9A 3IEJA 2FO5A 1YT7A 4CDFB 3O0UA 1AU4A 2G8JA 3I06A 4AXLA 1Q6KA 3S3RA 2DCBA 1PBHA 4W5CA 4HWYA 3OVXA 1NPZA 1PXVA 1PPNA 5EGWA 4OELA 2DJFB 3F75A 1FH0A 3RVXA 2NQIA 4QRXA 2PADA 3CBJA 3IHPA 4BPVA 4K7CA 1AECA 2BDLA 2G8EA 1EWLA 2HH5A 1EWMA 3OVZA 3S3QA 1AYVA 4YYRA 4PI3A 2VHFA 1BGOA 1Y08A 5CHTA 3E1ZB 1K3BB 2AVWA 2NQDB 1BQIA 4XUIA 4YYUA 3IV2A 2ARYA 2XU3A 1AYWA 3U8EA 3AI8A 3P5WA 3BPFA 3QT4A 3M99A 3H8CA 4BQVA 1BY8A 4XR7A 1BP4A 3MHSA 2GFOA 2DCCA 4Q8HA 1IWDA 3HHIA 4CDDB 4YYSA 2DJGB 2YJ8A 3K24A 1DEUA 1U9WA 2VHSA 2PNSA 4DMYA 1NQCA 2R9OA 2YJ2A 1ICFA 2IBIA 2XU1A 1GMYA 2YJ9A 3N3KA 1CPJA 2FRQA 4W4UA 3N3GA 3ERVA 1F2AA 1YALA 3K9MA 1ME3A 2E03A 1ZCMA 5CVOB 2R9NA 4N4ZA 1MEMA 3MHHA 3H6SA 2FQ9A 1SP4B 3N4CA 4I07A 2OULA 1PADA 1YK7A 3WXFA 2FRAA 2H7JA 3LFYA 5JA7A 2FUDA 1U5IA 4BS6A 9PAPA 3OF8A 2BDZA 3BPMA 1NB5A 3NHEA 3H8BA 4CDCB 1PPDA 1GECE 3GCBA 2AS8A 2O6XA 2ATOA 1CVZA 2DCAA 1YVBA 3KWBX 5JH3A 2HXZA 2WBFX 3K8UA 5CHVA 1MHWA 3BCNA 1PE6A 3PDFA 4P6EA 1M6DA 2PREA 1GCBA 4X6JA 2IPPB 4AXMA 1JQPA 3DF0A 1XKGA 3C9EA 8PCHA 3O1GA 4DMXA 2B1MA 7PCKA 4ZUXU 1AYUA 2FTDA 1F2CA
chains in the Genus database with same CATH superfamily
2FE8A 3TMPA 1HUCB 1O0EA 4G54A 3H89A 3IOQA 1VSNA 1STFE 4RKXA 2JQFR 3PHWA 1Y4HA 3USVA 4I04A 4W5BA 1KHQA 2J7QC 2JTCA 2DC8A 1U9QX 1ZIVA 4YYVA 2AIMA 1QMYA 3F5VA 3P5XA 4CZWA 3WXEA 1POPA 1TU6A 1EWOA 1VJVA 4PP2E 2E02A 1KFUL 3OISA 2FT2A 2AU1A 4FJCA 4A5UA 1EF7A 1F29A 4FK5A 4BOZA 1MDWA 2NQGA 2DCDA 1QOLA 2C0YA 4YV8A 1PCIA 3B79A 3H7DA 1U9VA 4PADA 4QBBA 4RF1A 2AUXA 4HXDB 2HHNA 2R6NA 2FYEA 3RVWA 4WA6A 1MIRA 1ITOA 1TL9A 4X6IA 1X9YA 3HHAA 4PP1A 3PRPA 2PBHA 4MZOA 2F7DA 2E00A 5J94A 3TRKA 3MORA 2Y6EA 3MTNA 1QXPA 3CH2X 3D6SA 3BWKA 2R9FA 1YK8A 4BOQA 2NQAA 4BS5A 5FPWA 3I3TA 3KWZA 4ZTBA 2P7UA 3KFQA 3CH3X 3TNXA 3QJ3A 3V6CA 3RVVA 4OEMA 3HD3A 1S4VA 1TLOA 2R9CA 3PNRA 1QDQA 2DZYA 2OP3A 3BOWA 1ATKA 4QH6A 2ACTA 4BOUA 4QRVA 1EWPA 2DZZA 1YZBA 3HWNA 3P5UA 4Q8GA 3QSDA 3P5VA 1CV8A 4FIPA 3LXSA 1NL6A 1PPPA 1CJLA 4CDEB 1PVJA 4OW0A 4IP3A 5CVMA 2Y5BA 1NB3A 2DC9A 2G6DA 4YVAA 4I05A 5EZSA 2XU4A 3KX1A 1AU3A 2B1NA 2YJBA 1AIMA 3ZUAA 2F1GA 2OZ2A 3PBHA 2GHUA 3CBKA 4OVZA 5F02A 3KSEA 5EF4A 4P6GA 2BTWB 2YJCA 1F2BA 4BOSA 3PT2A 1MEGA 2XU5A 1KHPA 6PADA 2P0RA 5K16A 1ME4A 4WURA 4BSQA 3KKUA 4N8WA 3V6EA 1CQDA 2E01A 5PADA 5JZEA 1PIPA 1CB5A 4MSXA 1THEA 2AYOA 4BOPA 1KFXL 1U9XA 1NLJA 2G7YA 3PW3A 3IMAA 3BBAA 1MS6A 1PPOA 2P86A 3WXGA 2R9MA 2CB5A 1CS8A 1CSBB 2CIOA 2HD5A 2DC6A 1AU2A 1A6RA 3BC3A 1AU0A 5A24A 3IUTA 4MM3B 1GLOA 2Z84A 4QRGA 3OQCA 4N79A 2DC7A 4KLBA 2AUZA 5CVNB 2JQGR 4YYQA 1DF0A 4RY2A 3RNVA 1CTEA 1SNKA 1KXRA 4MZSA 4YYWA 3ZNHA 3PHUA 3C0RA 2AYNA 3KW9A 4X6HA 3OF9A 3IEJA 2DOSA 2FO5A 1YT7A 1DKIA 4CDFB 3O0UA 3MP2A 1AU4A 2G8JA 3I06A 4AXLA 4D8EA 1Q6KA 3S3RA 2DCBA 1PBHA 4W5CA 4HWYA 3OVXA 1NPZA 4XZXA 1PXVA 1PPNA 5EGWA 4OELA 2DJFB 4P16A 3F75A 1FH0A 5EZQA 3RVXA 2NQIA 4QRXA 2PADA 3CBJA 3IHPA 4IUMA 4BPVA 4K7CA 1AECA 2BDLA 2G8EA 1EWLA 2HH5A 1EWMA 3OVZA 3S3QA 4D8BA 1AYVA 4YYRA 4PI3A 2VHFA 1BGOA 1Y08A 5CHTA 3E1ZB 1K3BB 2AVWA 2NQDB 1BQIA 4XUIA 4YYUA 2HWKA 3IV2A 2ARYA 2XU3A 3MJ5A 1AYWA 3U8EA 3AI8A 4MI7A 3P5WA 3PSEA 3BPFA 3BY4A 3QT4A 3IFUA 3M99A 3H8CA 4BQVA 1BY8A 4XR7A 1BP4A 3MHSA 2GFOA 2DCCA 4Q8HA 1IWDA 3W31A 3HHIA 4CDDB 4YYSA 2DJGB 2YJ8A 3K24A 1DEUA 3PRMA 1U9WA 2VHSA 2PNSA 2AGAA 4DMYA 1NQCA 2R9OA 2YJ2A 4R3DA 3PHXA 1ICFA 4GUAA 2IBIA 2XU1A 1GMYA 2YJ9A 3N3KA 2J7QA 1CPJA 2BTWA 2FRQA 4W4UA 3N3GA 3ERVA 1F2AA 1YALA 3K9MA 3B21A 5KO3A 1ME3A 2UZJA 2E03A 3W30A 1ZCMA 5CVOB 2R9NA 4N4ZA 1MEMA 3MHHA 3H6SA 2FQ9A 1SP4B 3N4CA 4I07A 2OULA 1PADA 1YK7A 1UKFA 2JRIA 4RF0A 3WXFA 4REZA 2FRAA 2H7JA 3LFYA 5JA7A 4OVZB 2FUDA 5E6JA 1U5IA 4BS6A 9PAPA 3OF8A 2BDZA 3BPMA 4PT5A 3E9SA 4RNAA 1NB5A 3NHEA 3H8BA 4CDCB 1PPDA 4M0WA 1GECE 3GCBA 2AS8A 2O6XA 2ATOA 1CVZA 2DCAA 1YVBA 3KWBX 3MTVA 5JH3A 2HXZA 2WBFX 3K8UA 4D8IA 5CHVA 1MHWA 2BU3A 1PE6A 3BCNA 3PDFA 4P6EA 1M6DA 3O65A 2PREA 3BB7A 1GCBA 4X6JA 2IPPB 4AXMA 1JQPA 3DF0A 1XKGA 3C9EA 8PCHA 3O1GA 4DMXA 2B1MA 7PCKA 4ZUXU 1AYUA 2FTDA 1F2CA
chains in the Genus database with same CATH topology
1HUCB 1O0EA 4G54A 3H89A 3IOQA 1VSNA 1STFE 2VFCA 2JQFR 1Y4HA 3USVA 4I04A 4W5BA 1KHQA 2DC8A 1U9QX 1ZIVA 4YYVA 2AIMA 1QMYA 3F5VA 3P5XA 4CZWA 3WXEA 1POPA 1TU6A 4GUZA 1EWOA 1VJVA 4PP2E 2E02A 1KFUL 3OISA 2FT2A 2AU1A 4FJCA 1EF7A 2VFBA 1F29A 4FK5A 1MDWA 2NQGA 2DCDA 1QOLA 2C0YA 4YV8A 1PCIA 3B79A 3H7DA 1U9VA 4PADA 4QBBA 2AUXA 2HHNA 2R6NA 2FYEA 3RVWA 4WA6A 1MIRA 1ITOA 1TL9A 4X6IA 1X9YA 3HHAA 4PP1A 2PBHA 4MZOA 2F7DA 4NV8A 2E00A 5J94A 3MORA 2Y6EA 3MTNA 1QXPA 3CH2X 4BGFA 3D6SA 3BWKA 2R9FA 1YK8A 2NQAA 4BS5A 5FPWA 2BSZA 3I3TA 3KWZA 2P7UA 3KFQA 3CH3X 3TNXA 3QJ3A 3V6CA 3RVVA 4OEMA 3HD3A 1S4VA 1TLOA 2R9CA 3PNRA 1QDQA 2DZYA 2OP3A 3BOWA 1ATKA 4QH6A 1W5RA 2ACTA 4QRVA 1EWPA 2DZZA 3HWNA 3P5UA 4Q8GA 3QSDA 3P5VA 1CV8A 4FIPA 3LXSA 1NL6A 1PPPA 1CJLA 4CDEB 5CVMA 2Y5BA 1NB3A 2DC9A 2G6DA 4YVAA 4I05A 2XU4A 3KX1A 1AU3A 2B1NA 2YJBA 1AIMA 3ZUAA 2F1GA 2OZ2A 3PBHA 2GHUA 3CBKA 5F02A 3KSEA 5EF4A 4P6GA 2YJCA 1F2BA 1MEGA 2XU5A 1KHPA 6PADA 2P0RA 5K16A 1ME4A 4BSQA 3KKUA 4N8WA 3V6EA 1CQDA 2E01A 5PADA 1PIPA 1CB5A 4MSXA 1THEA 2AYOA 1KFXL 1U9XA 1NLJA 2G7YA 3PW3A 3IMAA 1MS6A 1PPOA 1GX3A 2P86A 3WXGA 2R9MA 2CB5A 1CS8A 1CSBB 2CIOA 2HD5A 2DC6A 1AU2A 1A6RA 3BC3A 1AU0A 5A24A 3IUTA 3D9WA 1GLOA 4QRGA 4N79A 2DC7A 4KLBA 2AUZA 5CVNB 2JQGR 4YYQA 1DF0A 4RY2A 1CTEA 1SNKA 1KXRA 4MZSA 4YYWA 2AYNA 3KW9A 4X6HA 3OF9A 3IEJA 2FO5A 1YT7A 4CDFB 3O0UA 1AU4A 2G8JA 3I06A 4AXLA 1Q6KA 3S3RA 2DCBA 1PBHA 4W5CA 4HWYA 3OVXA 1NPZA 1PXVA 1PPNA 5EGWA 1W6FA 4OELA 2DJFB 3F75A 1FH0A 3RVXA 2NQIA 4QRXA 2PADA 3CBJA 3IHPA 4BPVA 4K7CA 1AECA 2BDLA 2G8EA 1EWLA 2HH5A 1EWMA 3OVZA 3S3QA 1AYVA 4YYRA 4PI3A 2VHFA 1BGOA 1Y08A 5CHTA 3E1ZB 1K3BB 2AVWA 2NQDB 1BQIA 4XUIA 4YYUA 3IV2A 2ARYA 2XU3A 1AYWA 3U8EA 3AI8A 4C5PA 3P5WA 3BPFA 3QT4A 3M99A 3H8CA 4BQVA 1BY8A 4XR7A 1BP4A 3MHSA 2GFOA 2DCCA 4Q8HA 1IWDA 3HHIA 4B55A 4CDDB 4YYSA 2DJGB 2YJ8A 3K24A 1DEUA 1U9WA 2VHSA 2PNSA 4DMYA 1NQCA 2R9OA 2YJ2A 1ICFA 2IBIA 2XU1A 1GMYA 2YJ9A 3N3KA 1CPJA 2FRQA 4W4UA 3N3GA 3ERVA 1F2AA 1YALA 3K9MA 1ME3A 2E03A 1ZCMA 5CVOB 2R9NA 4N4ZA 1MEMA 3MHHA 3H6SA 2FQ9A 1SP4B 3N4CA 1W4TA 4I07A 2OULA 1PADA 1YK7A 3LTWA 3WXFA 2FRAA 4NV7A 2H7JA 3LFYA 5JA7A 1E2TA 2FUDA 1U5IA 4BS6A 9PAPA 3OF8A 2BDZA 3BPMA 1NB5A 3NHEA 3H8BA 4CDCB 1PPDA 1GECE 3GCBA 2AS8A 2O6XA 2ATOA 1CVZA 2DCAA 1YVBA 3KWBX 5JH3A 2HXZA 2WBFX 3K8UA 5CHVA 1MHWA 3BCNA 1PE6A 3PDFA 4P6EA 1M6DA 2PREA 1GCBA 4X6JA 2IPPB 4AXMA 1JQPA 3DF0A 1XKGA 3C9EA 8PCHA 3O1GA 4DMXA 2B1MA 7PCKA 4ZUXU 1AYUA 2FTDA 1F2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HUC B;  1O0E A;  4G54 A;  3H89 A;  3IOQ A;  1VSN A;  1STF E;  2JQF R;  1Y4H A;  3USV A;  4I04 A;  4W5B A;  1KHQ A;  2DC8 A;  1U9Q X;  1ZIV A;  4YYV A;  2AIM A;  1QMY A;  3F5V A;  3P5X A;  4CZW A;  3WXE A;  1POP A;  1TU6 A;  1EWO A;  1VJV A;  4PP2 E;  2E02 A;  1KFU L;  3OIS A;  2FT2 A;  2AU1 A;  4FJC A;  1EF7 A;  1F29 A;  4FK5 A;  1MDW A;  2NQG A;  2DCD A;  1QOL A;  2C0Y A;  4YV8 A;  1PCI A;  3B79 A;  3H7D A;  1U9V A;  4PAD A;  4QBB A;  2AUX A;  2HHN A;  2R6N A;  2FYE A;  3RVW A;  4WA6 A;  1MIR A;  1ITO A;  1TL9 A;  4X6I A;  1X9Y A;  3HHA A;  4PP1 A;  2PBH A;  4MZO A;  2F7D A;  2E00 A;  5J94 A;  3MOR A;  2Y6E A;  3MTN A;  1QXP A;  3CH2 X;  3D6S A;  3BWK A;  2R9F A;  1YK8 A;  2NQA A;  4BS5 A;  5FPW A;  3I3T A;  3KWZ A;  2P7U A;  3KFQ A;  3CH3 X;  3TNX A;  3QJ3 A;  3V6C A;  3RVV A;  4OEM A;  3HD3 A;  1S4V A;  1TLO A;  2R9C A;  3PNR A;  1QDQ A;  2DZY A;  2OP3 A;  3BOW A;  1ATK A;  4QH6 A;  2ACT A;  4QRV A;  1EWP A;  2DZZ A;  3HWN A;  3P5U A;  4Q8G A;  3QSD A;  3P5V A;  1CV8 A;  4FIP A;  3LXS A;  1NL6 A;  1PPP A;  1CJL A;  4CDE B;  5CVM A;  2Y5B A;  1NB3 A;  2DC9 A;  2G6D A;  4YVA A;  4I05 A;  2XU4 A;  3KX1 A;  1AU3 A;  2B1N A;  2YJB A;  1AIM A;  3ZUA A;  2F1G A;  2OZ2 A;  3PBH A;  2GHU A;  3CBK A;  5F02 A;  3KSE A;  5EF4 A;  4P6G A;  2YJC A;  1F2B A;  1MEG A;  2XU5 A;  1KHP A;  6PAD A;  2P0R A;  5K16 A;  1ME4 A;  4BSQ A;  3KKU A;  4N8W A;  3V6E A;  1CQD A;  2E01 A;  5PAD A;  1PIP A;  1CB5 A;  4MSX A;  1THE A;  2AYO A;  1KFX L;  1U9X A;  1NLJ A;  2G7Y A;  3PW3 A;  3IMA A;  1MS6 A;  1PPO A;  2P86 A;  3WXG A;  2R9M A;  2CB5 A;  1CS8 A;  1CSB B;  2CIO A;  2HD5 A;  2DC6 A;  1AU2 A;  1A6R A;  3BC3 A;  1AU0 A;  5A24 A;  3IUT A;  1GLO A;  4QRG A;  4N79 A;  2DC7 A;  4KLB A;  2AUZ A;  5CVN B;  2JQG R;  4YYQ A;  1DF0 A;  4RY2 A;  1CTE A;  1SNK A;  1KXR A;  4MZS A;  4YYW A;  2AYN A;  3KW9 A;  4X6H A;  3OF9 A;  3IEJ A;  2FO5 A;  1YT7 A;  4CDF B;  3O0U A;  1AU4 A;  2G8J A;  3I06 A;  4AXL A;  1Q6K A;  3S3R A;  2DCB A;  1PBH A;  4W5C A;  4HWY A;  3OVX A;  1NPZ A;  1PXV A;  1PPN A;  5EGW A;  4OEL A;  2DJF B;  3F75 A;  1FH0 A;  3RVX A;  2NQI A;  4QRX A;  2PAD A;  3CBJ A;  3IHP A;  4BPV A;  4K7C A;  1AEC A;  2BDL A;  2G8E A;  1EWL A;  2HH5 A;  1EWM A;  3OVZ A;  3S3Q A;  1AYV A;  4YYR A;  4PI3 A;  2VHF A;  1BGO A;  1Y08 A;  5CHT A;  3E1Z B;  1K3B B;  2AVW A;  2NQD B;  1BQI A;  4XUI A;  4YYU A;  3IV2 A;  2ARY A;  2XU3 A;  1AYW A;  3U8E A;  3AI8 A;  3P5W A;  3BPF A;  3QT4 A;  3M99 A;  3H8C A;  4BQV A;  1BY8 A;  4XR7 A;  1BP4 A;  3MHS A;  2GFO A;  2DCC A;  4Q8H A;  1IWD A;  3HHI A;  4CDD B;  4YYS A;  2DJG B;  2YJ8 A;  3K24 A;  1DEU A;  1U9W A;  2VHS A;  2PNS A;  4DMY A;  1NQC A;  2R9O A;  2YJ2 A;  1ICF A;  2IBI A;  2XU1 A;  1GMY A;  2YJ9 A;  3N3K A;  1CPJ A;  2FRQ A;  4W4U A;  3N3G A;  3ERV A;  1F2A A;  1YAL A;  3K9M A;  1ME3 A;  2E03 A;  1ZCM A;  5CVO B;  2R9N A;  4N4Z A;  1MEM A;  3MHH A;  3H6S A;  2FQ9 A;  1SP4 B;  3N4C A;  4I07 A;  2OUL A;  1PAD A;  1YK7 A;  3WXF A;  2FRA A;  2H7J A;  3LFY A;  5JA7 A;  2FUD A;  1U5I A;  4BS6 A;  9PAP A;  3OF8 A;  2BDZ A;  3BPM A;  1NB5 A;  3NHE A;  3H8B A;  4CDC B;  1PPD A;  1GEC E;  3GCB A;  2AS8 A;  2O6X A;  2ATO A;  1CVZ A;  2DCA A;  1YVB A;  3KWB X;  5JH3 A;  2HXZ A;  2WBF X;  3K8U A;  5CHV A;  1MHW A;  3BCN A;  1PE6 A;  3PDF A;  4P6E A;  1M6D A;  2PRE A;  1GCB A;  4X6J A;  2IPP B;  4AXM A;  1JQP A;  3DF0 A;  1XKG A;  3C9E A;  8PCH A;  3O1G A;  4DMX A;  2B1M A;  7PCK A;  4ZUX U;  1AYU A;  2FTD A;  1F2C A; 
#chains in the Genus database with same CATH topology
 2FE8 A;  3TMP A;  1HUC B;  1O0E A;  4G54 A;  3H89 A;  3IOQ A;  1VSN A;  1STF E;  4RKX A;  2JQF R;  3PHW A;  1Y4H A;  3USV A;  4I04 A;  4W5B A;  1KHQ A;  2J7Q C;  2JTC A;  2DC8 A;  1U9Q X;  1ZIV A;  4YYV A;  2AIM A;  1QMY A;  3F5V A;  3P5X A;  4CZW A;  3WXE A;  1POP A;  1TU6 A;  1EWO A;  1VJV A;  4PP2 E;  2E02 A;  1KFU L;  3OIS A;  2FT2 A;  2AU1 A;  4FJC A;  4A5U A;  1EF7 A;  1F29 A;  4FK5 A;  4BOZ A;  1MDW A;  2NQG A;  2DCD A;  1QOL A;  2C0Y A;  4YV8 A;  1PCI A;  3B79 A;  3H7D A;  1U9V A;  4PAD A;  4QBB A;  4RF1 A;  2AUX A;  4HXD B;  2HHN A;  2R6N A;  2FYE A;  3RVW A;  4WA6 A;  1MIR A;  1ITO A;  1TL9 A;  4X6I A;  1X9Y A;  3HHA A;  4PP1 A;  3PRP A;  2PBH A;  4MZO A;  2F7D A;  2E00 A;  5J94 A;  3TRK A;  3MOR A;  2Y6E A;  3MTN A;  1QXP A;  3CH2 X;  3D6S A;  3BWK A;  2R9F A;  1YK8 A;  4BOQ A;  2NQA A;  4BS5 A;  5FPW A;  3I3T A;  3KWZ A;  4ZTB A;  2P7U A;  3KFQ A;  3CH3 X;  3TNX A;  3QJ3 A;  3V6C A;  3RVV A;  4OEM A;  3HD3 A;  1S4V A;  1TLO A;  2R9C A;  3PNR A;  1QDQ A;  2DZY A;  2OP3 A;  3BOW A;  1ATK A;  4QH6 A;  2ACT A;  4BOU A;  4QRV A;  1EWP A;  2DZZ A;  1YZB A;  3HWN A;  3P5U A;  4Q8G A;  3QSD A;  3P5V A;  1CV8 A;  4FIP A;  3LXS A;  1NL6 A;  1PPP A;  1CJL A;  4CDE B;  1PVJ A;  4OW0 A;  4IP3 A;  5CVM A;  2Y5B A;  1NB3 A;  2DC9 A;  2G6D A;  4YVA A;  4I05 A;  5EZS A;  2XU4 A;  3KX1 A;  1AU3 A;  2B1N A;  2YJB A;  1AIM A;  3ZUA A;  2F1G A;  2OZ2 A;  3PBH A;  2GHU A;  3CBK A;  4OVZ A;  5F02 A;  3KSE A;  5EF4 A;  4P6G A;  2BTW B;  2YJC A;  1F2B A;  4BOS A;  3PT2 A;  1MEG A;  2XU5 A;  1KHP A;  6PAD A;  2P0R A;  5K16 A;  1ME4 A;  4WUR A;  4BSQ A;  3KKU A;  4N8W A;  3V6E A;  1CQD A;  2E01 A;  5PAD A;  5JZE A;  1PIP A;  1CB5 A;  4MSX A;  1THE A;  2AYO A;  4BOP A;  1KFX L;  1U9X A;  1NLJ A;  2G7Y A;  3PW3 A;  3IMA A;  3BBA A;  1MS6 A;  1PPO A;  2P86 A;  3WXG A;  2R9M A;  2CB5 A;  1CS8 A;  1CSB B;  2CIO A;  2HD5 A;  2DC6 A;  1AU2 A;  1A6R A;  3BC3 A;  1AU0 A;  5A24 A;  3IUT A;  4MM3 B;  1GLO A;  2Z84 A;  4QRG A;  3OQC A;  4N79 A;  2DC7 A;  4KLB A;  2AUZ A;  5CVN B;  2JQG R;  4YYQ A;  1DF0 A;  4RY2 A;  3RNV A;  1CTE A;  1SNK A;  1KXR A;  4MZS A;  4YYW A;  3ZNH A;  3PHU A;  3C0R A;  2AYN A;  3KW9 A;  4X6H A;  3OF9 A;  3IEJ A;  2DOS A;  2FO5 A;  1YT7 A;  1DKI A;  4CDF B;  3O0U A;  3MP2 A;  1AU4 A;  2G8J A;  3I06 A;  4AXL A;  4D8E A;  1Q6K A;  3S3R A;  2DCB A;  1PBH A;  4W5C A;  4HWY A;  3OVX A;  1NPZ A;  4XZX A;  1PXV A;  1PPN A;  5EGW A;  4OEL A;  2DJF B;  4P16 A;  3F75 A;  1FH0 A;  5EZQ A;  3RVX A;  2NQI A;  4QRX A;  2PAD A;  3CBJ A;  3IHP A;  4IUM A;  4BPV A;  4K7C A;  1AEC A;  2BDL A;  2G8E A;  1EWL A;  2HH5 A;  1EWM A;  3OVZ A;  3S3Q A;  4D8B A;  1AYV A;  4YYR A;  4PI3 A;  2VHF A;  1BGO A;  1Y08 A;  5CHT A;  3E1Z B;  1K3B B;  2AVW A;  2NQD B;  1BQI A;  4XUI A;  4YYU A;  2HWK A;  3IV2 A;  2ARY A;  2XU3 A;  3MJ5 A;  1AYW A;  3U8E A;  3AI8 A;  4MI7 A;  3P5W A;  3PSE A;  3BPF A;  3BY4 A;  3QT4 A;  3IFU A;  3M99 A;  3H8C A;  4BQV A;  1BY8 A;  4XR7 A;  1BP4 A;  3MHS A;  2GFO A;  2DCC A;  4Q8H A;  1IWD A;  3W31 A;  3HHI A;  4CDD B;  4YYS A;  2DJG B;  2YJ8 A;  3K24 A;  1DEU A;  3PRM A;  1U9W A;  2VHS A;  2PNS A;  2AGA A;  4DMY A;  1NQC A;  2R9O A;  2YJ2 A;  4R3D A;  3PHX A;  1ICF A;  4GUA A;  2IBI A;  2XU1 A;  1GMY A;  2YJ9 A;  3N3K A;  2J7Q A;  1CPJ A;  2BTW A;  2FRQ A;  4W4U A;  3N3G A;  3ERV A;  1F2A A;  1YAL A;  3K9M A;  3B21 A;  5KO3 A;  1ME3 A;  2UZJ A;  2E03 A;  3W30 A;  1ZCM A;  5CVO B;  2R9N A;  4N4Z A;  1MEM A;  3MHH A;  3H6S A;  2FQ9 A;  1SP4 B;  3N4C A;  4I07 A;  2OUL A;  1PAD A;  1YK7 A;  1UKF A;  2JRI A;  4RF0 A;  3WXF A;  4REZ A;  2FRA A;  2H7J A;  3LFY A;  5JA7 A;  4OVZ B;  2FUD A;  5E6J A;  1U5I A;  4BS6 A;  9PAP A;  3OF8 A;  2BDZ A;  3BPM A;  4PT5 A;  3E9S A;  4RNA A;  1NB5 A;  3NHE A;  3H8B A;  4CDC B;  1PPD A;  4M0W A;  1GEC E;  3GCB A;  2AS8 A;  2O6X A;  2ATO A;  1CVZ A;  2DCA A;  1YVB A;  3KWB X;  3MTV A;  5JH3 A;  2HXZ A;  2WBF X;  3K8U A;  4D8I A;  5CHV A;  1MHW A;  2BU3 A;  1PE6 A;  3BCN A;  3PDF A;  4P6E A;  1M6D A;  3O65 A;  2PRE A;  3BB7 A;  1GCB A;  4X6J A;  2IPP B;  4AXM A;  1JQP A;  3DF0 A;  1XKG A;  3C9E A;  8PCH A;  3O1G A;  4DMX A;  2B1M A;  7PCK A;  4ZUX U;  1AYU A;  2FTD A;  1F2C A; 
#chains in the Genus database with same CATH homology
 1HUC B;  1O0E A;  4G54 A;  3H89 A;  3IOQ A;  1VSN A;  1STF E;  2VFC A;  2JQF R;  1Y4H A;  3USV A;  4I04 A;  4W5B A;  1KHQ A;  2DC8 A;  1U9Q X;  1ZIV A;  4YYV A;  2AIM A;  1QMY A;  3F5V A;  3P5X A;  4CZW A;  3WXE A;  1POP A;  1TU6 A;  4GUZ A;  1EWO A;  1VJV A;  4PP2 E;  2E02 A;  1KFU L;  3OIS A;  2FT2 A;  2AU1 A;  4FJC A;  1EF7 A;  2VFB A;  1F29 A;  4FK5 A;  1MDW A;  2NQG A;  2DCD A;  1QOL A;  2C0Y A;  4YV8 A;  1PCI A;  3B79 A;  3H7D A;  1U9V A;  4PAD A;  4QBB A;  2AUX A;  2HHN A;  2R6N A;  2FYE A;  3RVW A;  4WA6 A;  1MIR A;  1ITO A;  1TL9 A;  4X6I A;  1X9Y A;  3HHA A;  4PP1 A;  2PBH A;  4MZO A;  2F7D A;  4NV8 A;  2E00 A;  5J94 A;  3MOR A;  2Y6E A;  3MTN A;  1QXP A;  3CH2 X;  4BGF A;  3D6S A;  3BWK A;  2R9F A;  1YK8 A;  2NQA A;  4BS5 A;  5FPW A;  2BSZ A;  3I3T A;  3KWZ A;  2P7U A;  3KFQ A;  3CH3 X;  3TNX A;  3QJ3 A;  3V6C A;  3RVV A;  4OEM A;  3HD3 A;  1S4V A;  1TLO A;  2R9C A;  3PNR A;  1QDQ A;  2DZY A;  2OP3 A;  3BOW A;  1ATK A;  4QH6 A;  1W5R A;  2ACT A;  4QRV A;  1EWP A;  2DZZ A;  3HWN A;  3P5U A;  4Q8G A;  3QSD A;  3P5V A;  1CV8 A;  4FIP A;  3LXS A;  1NL6 A;  1PPP A;  1CJL A;  4CDE B;  5CVM A;  2Y5B A;  1NB3 A;  2DC9 A;  2G6D A;  4YVA A;  4I05 A;  2XU4 A;  3KX1 A;  1AU3 A;  2B1N A;  2YJB A;  1AIM A;  3ZUA A;  2F1G A;  2OZ2 A;  3PBH A;  2GHU A;  3CBK A;  5F02 A;  3KSE A;  5EF4 A;  4P6G A;  2YJC A;  1F2B A;  1MEG A;  2XU5 A;  1KHP A;  6PAD A;  2P0R A;  5K16 A;  1ME4 A;  4BSQ A;  3KKU A;  4N8W A;  3V6E A;  1CQD A;  2E01 A;  5PAD A;  1PIP A;  1CB5 A;  4MSX A;  1THE A;  2AYO A;  1KFX L;  1U9X A;  1NLJ A;  2G7Y A;  3PW3 A;  3IMA A;  1MS6 A;  1PPO A;  1GX3 A;  2P86 A;  3WXG A;  2R9M A;  2CB5 A;  1CS8 A;  1CSB B;  2CIO A;  2HD5 A;  2DC6 A;  1AU2 A;  1A6R A;  3BC3 A;  1AU0 A;  5A24 A;  3IUT A;  3D9W A;  1GLO A;  4QRG A;  4N79 A;  2DC7 A;  4KLB A;  2AUZ A;  5CVN B;  2JQG R;  4YYQ A;  1DF0 A;  4RY2 A;  1CTE A;  1SNK A;  1KXR A;  4MZS A;  4YYW A;  2AYN A;  3KW9 A;  4X6H A;  3OF9 A;  3IEJ A;  2FO5 A;  1YT7 A;  4CDF B;  3O0U A;  1AU4 A;  2G8J A;  3I06 A;  4AXL A;  1Q6K A;  3S3R A;  2DCB A;  1PBH A;  4W5C A;  4HWY A;  3OVX A;  1NPZ A;  1PXV A;  1PPN A;  5EGW A;  1W6F A;  4OEL A;  2DJF B;  3F75 A;  1FH0 A;  3RVX A;  2NQI A;  4QRX A;  2PAD A;  3CBJ A;  3IHP A;  4BPV A;  4K7C A;  1AEC A;  2BDL A;  2G8E A;  1EWL A;  2HH5 A;  1EWM A;  3OVZ A;  3S3Q A;  1AYV A;  4YYR A;  4PI3 A;  2VHF A;  1BGO A;  1Y08 A;  5CHT A;  3E1Z B;  1K3B B;  2AVW A;  2NQD B;  1BQI A;  4XUI A;  4YYU A;  3IV2 A;  2ARY A;  2XU3 A;  1AYW A;  3U8E A;  3AI8 A;  4C5P A;  3P5W A;  3BPF A;  3QT4 A;  3M99 A;  3H8C A;  4BQV A;  1BY8 A;  4XR7 A;  1BP4 A;  3MHS A;  2GFO A;  2DCC A;  4Q8H A;  1IWD A;  3HHI A;  4B55 A;  4CDD B;  4YYS A;  2DJG B;  2YJ8 A;  3K24 A;  1DEU A;  1U9W A;  2VHS A;  2PNS A;  4DMY A;  1NQC A;  2R9O A;  2YJ2 A;  1ICF A;  2IBI A;  2XU1 A;  1GMY A;  2YJ9 A;  3N3K A;  1CPJ A;  2FRQ A;  4W4U A;  3N3G A;  3ERV A;  1F2A A;  1YAL A;  3K9M A;  1ME3 A;  2E03 A;  1ZCM A;  5CVO B;  2R9N A;  4N4Z A;  1MEM A;  3MHH A;  3H6S A;  2FQ9 A;  1SP4 B;  3N4C A;  1W4T A;  4I07 A;  2OUL A;  1PAD A;  1YK7 A;  3LTW A;  3WXF A;  2FRA A;  4NV7 A;  2H7J A;  3LFY A;  5JA7 A;  1E2T A;  2FUD A;  1U5I A;  4BS6 A;  9PAP A;  3OF8 A;  2BDZ A;  3BPM A;  1NB5 A;  3NHE A;  3H8B A;  4CDC B;  1PPD A;  1GEC E;  3GCB A;  2AS8 A;  2O6X A;  2ATO A;  1CVZ A;  2DCA A;  1YVB A;  3KWB X;  5JH3 A;  2HXZ A;  2WBF X;  3K8U A;  5CHV A;  1MHW A;  3BCN A;  1PE6 A;  3PDF A;  4P6E A;  1M6D A;  2PRE A;  1GCB A;  4X6J A;  2IPP B;  4AXM A;  1JQP A;  3DF0 A;  1XKG A;  3C9E A;  8PCH A;  3O1G A;  4DMX A;  2B1M A;  7PCK A;  4ZUX U;  1AYU A;  2FTD A;  1F2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...