5J94A

Human cathepsin k mutant c25s in complex with the allosteric effector nsc13345
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
223
structure length
223
Chain Sequence
YIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSSWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel allosteric mechanism in the cysteine peptidase cathepsin K discovered by computational methods.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin K
total genus 67
structure length 223
sequence length 223
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2016-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 5j94A00
2XU5A 3V6EA 4RY2A 2NQDB 8PCHA 2F1GA 2XU3A 3I3TA 1KFUL 1ZCMA 2G7YA 1U9XA 2FQ9A 1ITOA 1DF0A 3IMAA 2BDLA 3BC3A 2G8EA 2BDZA 1VJVA 3V6CA 1QXPA 3HD3A 3OISA 1CB5A 2B1MA 1IWDA 1NPZA 1ME3A 3P5XA 2AVWA 4MZOA 2H7JA 4YV8A 6PADA 1MDWA 1BP4A 1MHWA 1BGOA 3ERVA 4Q8GA 1FH0A 1PE6A 1MIRA 2O6XA 1MEGA 4QRVA 1CTEA 3MORA 3WXGA 2WBFX 4YYQA 3NHEA 1K3BB 2AYOA 2IPPB 3KW9A 3OVZA 4CDFB 3H8CA 1O0EA 3WXEA 1AIMA 3O1GA 1AU4A 3OF8A 4CZWA 3H8BA 1NQCA 3CH3X 1QDQA 3BPMA 4P6GA 4BQVA 1PPPA 2DCDA 3H89A 2NQGA 1YK8A 4WA6A 4BS6A 2P0RA 2HD5A 4ZUXU 3HHIA 1SP4B 3RVWA 4PP1A 5JH3A 3RVVA 1HUCB 1YVBA 2YJCA 2Y6EA 2R9MA 2DZYA 4W4UA 4KLBA 1XKGA 4YYWA 1PBHA 1YK7A 2FRAA 1S4VA 1TLOA 5CHVA 2DC8A 1AYWA 1NB3A 2CIOA 3O0UA 3IV2A 1QMYA 2FUDA 4BPVA 2PBHA 1ME4A 4Q8HA 2XU1A 2OZ2A 3K9MA 3F75A 1VSNA 1PPDA 3HHAA 4PADA 4YVAA 3PW3A 3QSDA 1ICFA 3CBKA 2HXZA 2E00A 5CVNB 1Y4HA 1U5IA 1AU0A 5K16A 5PADA 2DC6A 3DF0A 2GHUA 3KKUA 2R9NA 1CSBB 2DJGB 1F29A 1CPJA 4CDCB 1YT7A 4I05A 4K7CA 1A6RA 1ZIVA 2PREA 3OVXA 1BQIA 3RVXA 2C0YA 3CBJA 1CS8A 1PADA 2G6DA 2FRQA 5CVMA 1AECA 2P86A 1Y08A 3HWNA 3KWBX 3ZUAA 1CJLA 4N79A 3MTNA 1QOLA 3N3GA 2YJ2A 5EF4A 2P7UA 3WXFA 1CQDA 3N3KA 3P5UA 2G8JA 2OULA 2ACTA 1EWLA 1PPOA 4BSQA 3H6SA 1DEUA 3QT4A 5J94A 1PCIA 2R9CA 3BOWA 5JA7A 1KFXL 1M6DA 2VHSA 2DCAA 3KFQA 3BPFA 2YJ8A 4W5BA 1POPA 4I04A 4FIPA 4MSXA 4X6HA 1JQPA 1MEMA 5EGWA 4FK5A 2PNSA 2GFOA 4FJCA 4YYRA 3PBHA 3MHHA 4CDEB 4AXMA 4QRXA 2E02A 3N4CA 2R6NA 4DMYA 1NL6A 3F5VA 3S3QA 1PPNA 3AI8A 2Y5BA 2AUZA 3C9EA 2YJ9A 5F02A 4P6EA 2DCCA 1PIPA 1YALA 3BWKA 4N8WA 4PI3A 3B79A 1F2AA 1Q6KA 1U9QX 2AUXA 2FO5A 1KHPA 2AU1A 2FT2A 3D6SA 3K8UA 1AYVA 1X9YA 2YJBA 4QRGA 2E03A 7PCKA 2DC7A 2IBIA 2FTDA 2NQAA 3CH2X 4YYUA 3M99A 2ARYA 2HHNA 3IOQA 1BY8A 4X6JA 4YYVA 2PADA 2DJFB 2JQGR 3LXSA 1NLJA 3IHPA 3KSEA 3TNXA 3LFYA 1KHQA 1F2BA 1GLOA 2VHFA 1ATKA 4AXLA 3IUTA 4OELA 3KWZA 2NQIA 1CV8A 2DCBA 4OEMA 1TL9A 4I07A 1GMYA 3USVA 4XUIA 1U9VA 1U9WA 2DC9A 3PNRA 3P5VA 2B1NA 2HH5A 1AU2A 4PP2E 5CVOB 4QH6A 3KX1A 1KXRA 4DMXA 3PDFA 3OF9A 2AIMA 4QBBA 3U8EA 2XU4A 1GCBA 2R9OA 4BS5A 1EWMA 1TU6A 1EWOA 4MZSA 3P5WA 4CDDB 4G54A 2CB5A 1EF7A 2F7DA 2FYEA 4HWYA 3IEJA 4XR7A 2OP3A 3I06A 1THEA 3K24A 2ATOA 1AYUA 2JQFR 3GCBA 1EWPA 1AU3A 1F2CA 1STFE 5CHTA 5A24A 4YYSA 1NB5A 1CVZA 3BCNA 2R9FA 3E1ZB 9PAPA 3QJ3A 1MS6A 3S3RA 4W5CA 3H7DA 5FPWA 3MHSA 1PXVA 2DZZA 2E01A 2AYNA 1SNKA 4X6IA 1GECE 2AS8A 4N4ZA
chains in the Genus database with same CATH superfamily
2XU5A 3V6EA 4RY2A 2NQDB 8PCHA 2F1GA 2XU3A 3TRKA 3I3TA 1KFUL 1ZCMA 3PHUA 2G7YA 5EZSA 1U9XA 2FQ9A 3PHXA 1ITOA 1DF0A 3IMAA 2BDLA 3BC3A 2G8EA 2BDZA 1VJVA 3V6CA 1QXPA 3HD3A 3OISA 1CB5A 2B1MA 1IWDA 1NPZA 1ME3A 3P5XA 2AVWA 4MZOA 4BOUA 3PSEA 2H7JA 4YV8A 6PADA 1MDWA 1BP4A 1MHWA 1BGOA 3ERVA 4Q8GA 1FH0A 1PE6A 1MIRA 2O6XA 1MEGA 4QRVA 1CTEA 3MORA 3WXGA 2WBFX 4YYQA 4D8EA 3NHEA 1K3BB 2AYOA 2IPPB 3KW9A 3OVZA 4CDFB 3H8CA 1O0EA 5E6JA 3WXEA 1AIMA 3O1GA 1AU4A 3OF8A 4CZWA 3H8BA 5EZQA 1NQCA 3CH3X 1QDQA 3BPMA 4P6GA 2J7QA 4ZTBA 4BQVA 4XZXA 1PPPA 2DCDA 3H89A 2NQGA 1YK8A 4WA6A 4BS6A 2P0RA 2HD5A 4ZUXU 3HHIA 1SP4B 3RVWA 4PP1A 5JH3A 3RVVA 1HUCB 1YVBA 2YJCA 4D8BA 2Y6EA 2R9MA 2DZYA 4R3DA 4W4UA 4KLBA 1XKGA 4YYWA 1PBHA 1YK7A 2FRAA 1S4VA 1TLOA 4HXDB 5CHVA 2DC8A 1AYWA 1NB3A 2CIOA 4BOPA 3O0UA 3IV2A 1QMYA 2FUDA 4BPVA 2PBHA 1ME4A 4Q8HA 4MM3B 2XU1A 2OZ2A 2BU3A 4IUMA 3K9MA 3F75A 1VSNA 4RKXA 1PPDA 3HHAA 4PADA 4YVAA 3PW3A 3QSDA 1ICFA 3CBKA 2HXZA 2E00A 3O65A 1Y4HA 5CVNB 1U5IA 1AU0A 5K16A 3C0RA 5PADA 2DC6A 3DF0A 2GHUA 5JZEA 1PVJA 3KKUA 2R9NA 1CSBB 2DJGB 1F29A 1CPJA 4RF0A 4CDCB 1YT7A 4I05A 4K7CA 1A6RA 1YZBA 1ZIVA 2JTCA 4REZA 3TMPA 2PREA 3OVXA 1BQIA 3RVXA 2C0YA 3CBJA 1CS8A 1DKIA 1PADA 2G6DA 2FRQA 2JRIA 4RNAA 5CVMA 4OVZA 1AECA 2P86A 1Y08A 4WURA 3HWNA 3KWBX 3ZUAA 1CJLA 4N79A 3MTNA 1QOLA 3N3GA 2YJ2A 2P7UA 5EF4A 3WXFA 1CQDA 3N3KA 3P5UA 2G8JA 2OULA 2ACTA 1EWLA 1PPOA 4BSQA 3H6SA 1DEUA 3ZNHA 3QT4A 5J94A 1PCIA 2R9CA 3BOWA 3OQCA 5JA7A 1KFXL 1M6DA 2VHSA 2DCAA 2DOSA 3KFQA 2HWKA 3BPFA 2YJ8A 4W5BA 1POPA 4I04A 4FIPA 3PT2A 4MSXA 4X6HA 1JQPA 3PRPA 4OW0A 3BBAA 1MEMA 5EGWA 4IP3A 2BTWA 4FK5A 2PNSA 2GFOA 4D8IA 4FJCA 4YYRA 3PHWA 3PBHA 3MHHA 4CDEB 4MI7A 4AXMA 4QRXA 2E02A 3N4CA 2R6NA 4DMYA 1NL6A 3F5VA 3S3QA 1PPNA 3AI8A 2Y5BA 2AUZA 3C9EA 3W31A 2YJ9A 5F02A 4P6EA 4BOQA 4P16A 2DCCA 1PIPA 1YALA 3MJ5A 3BWKA 4N8WA 4PI3A 3B79A 1F2AA 1Q6KA 1U9QX 2AUXA 2FO5A 1KHPA 2AU1A 2FT2A 3D6SA 3BY4A 3K8UA 1AYVA 1X9YA 2YJBA 4M0WA 4QRGA 2E03A 2FE8A 2J7QC 7PCKA 2DC7A 2IBIA 4BOZA 2FTDA 2NQAA 3CH2X 4YYUA 3M99A 2ARYA 2HHNA 3IOQA 1BY8A 4X6JA 4YYVA 2PADA 2DJFB 2JQGR 3LXSA 1NLJA 5KO3A 2AGAA 3IHPA 3KSEA 3W30A 3TNXA 3LFYA 1KHQA 1F2BA 1GLOA 2VHFA 2BTWB 1ATKA 3MTVA 4AXLA 3PRMA 3IUTA 4OELA 3KWZA 2NQIA 1CV8A 2DCBA 4OEMA 1TL9A 4I07A 4OVZB 3BB7A 1UKFA 1GMYA 3USVA 4XUIA 1U9VA 4BOSA 1U9WA 4RF1A 2DC9A 3IFUA 3PNRA 3P5VA 2B1NA 2HH5A 3MP2A 1AU2A 4PP2E 5CVOB 4QH6A 3KX1A 1KXRA 4A5UA 4DMXA 3PDFA 3OF9A 2AIMA 4QBBA 3U8EA 2XU4A 1GCBA 2R9OA 4BS5A 1EWMA 1TU6A 1EWOA 4MZSA 3P5WA 4CDDB 2UZJA 4G54A 2CB5A 1EF7A 2F7DA 4GUAA 2Z84A 2FYEA 4HWYA 4PT5A 3IEJA 4XR7A 2OP3A 3I06A 1THEA 3K24A 2ATOA 1AYUA 2JQFR 3GCBA 3B21A 1EWPA 1AU3A 1F2CA 1STFE 5CHTA 5A24A 4YYSA 1NB5A 1CVZA 3BCNA 2R9FA 3E1ZB 9PAPA 3QJ3A 1MS6A 3S3RA 4W5CA 3H7DA 5FPWA 3RNVA 3MHSA 1PXVA 2DZZA 2E01A 2AYNA 1SNKA 4X6IA 1GECE 2AS8A 4N4ZA 3E9SA
chains in the Genus database with same CATH topology
2XU5A 3V6EA 4RY2A 2NQDB 8PCHA 2F1GA 2XU3A 3I3TA 1KFUL 1ZCMA 2G7YA 1U9XA 2FQ9A 3D9WA 1ITOA 1DF0A 3IMAA 2BDLA 3BC3A 2G8EA 2BDZA 1VJVA 3V6CA 1QXPA 3HD3A 3OISA 1CB5A 2B1MA 1IWDA 1NPZA 1ME3A 3P5XA 2AVWA 4MZOA 2H7JA 4YV8A 6PADA 1MDWA 1BP4A 1MHWA 1BGOA 3ERVA 4Q8GA 1FH0A 1PE6A 1MIRA 2O6XA 1MEGA 4QRVA 1CTEA 3MORA 3WXGA 2WBFX 4YYQA 3NHEA 1K3BB 2AYOA 2IPPB 3KW9A 3OVZA 4CDFB 3H8CA 1O0EA 3WXEA 1AIMA 3O1GA 1AU4A 3OF8A 4CZWA 3H8BA 1NQCA 3CH3X 1QDQA 3BPMA 4P6GA 4BQVA 1PPPA 2DCDA 3H89A 2VFBA 2NQGA 1YK8A 4WA6A 4BS6A 2P0RA 2HD5A 1GX3A 4ZUXU 3HHIA 1SP4B 3RVWA 4PP1A 5JH3A 3RVVA 1HUCB 1YVBA 2YJCA 2Y6EA 2R9MA 2DZYA 4W4UA 4KLBA 1XKGA 4YYWA 1PBHA 1YK7A 2FRAA 1S4VA 1TLOA 5CHVA 2DC8A 1AYWA 1NB3A 2CIOA 3O0UA 3IV2A 1QMYA 2FUDA 4BPVA 2PBHA 1ME4A 4Q8HA 2XU1A 2OZ2A 3K9MA 3F75A 1VSNA 1PPDA 3HHAA 4PADA 4YVAA 3PW3A 3QSDA 1ICFA 3CBKA 2HXZA 2E00A 5CVNB 1Y4HA 1U5IA 1AU0A 5K16A 5PADA 2DC6A 3DF0A 2GHUA 3KKUA 1W4TA 2R9NA 1CSBB 2DJGB 1F29A 1CPJA 4CDCB 1YT7A 4I05A 4K7CA 1A6RA 1ZIVA 4NV8A 2PREA 3OVXA 1BQIA 3RVXA 2C0YA 3CBJA 1CS8A 1PADA 2G6DA 2FRQA 5CVMA 1AECA 2P86A 1Y08A 4GUZA 3HWNA 3KWBX 3ZUAA 1CJLA 4N79A 3MTNA 4NV7A 1QOLA 3N3GA 2YJ2A 5EF4A 2P7UA 3WXFA 1CQDA 3N3KA 3P5UA 2G8JA 2OULA 2ACTA 1EWLA 1PPOA 4BSQA 3H6SA 1DEUA 3QT4A 5J94A 1PCIA 2R9CA 3BOWA 5JA7A 1KFXL 1M6DA 2VHSA 2DCAA 3KFQA 3BPFA 2YJ8A 4W5BA 1POPA 4I04A 4FIPA 4MSXA 4X6HA 1JQPA 1MEMA 5EGWA 4FK5A 2PNSA 2GFOA 4FJCA 4BGFA 4YYRA 3PBHA 3MHHA 4CDEB 4AXMA 4QRXA 2E02A 3N4CA 2R6NA 4DMYA 1NL6A 3F5VA 3S3QA 1PPNA 3AI8A 2Y5BA 2AUZA 3C9EA 2YJ9A 5F02A 4P6EA 2VFCA 2DCCA 1PIPA 1YALA 3BWKA 4N8WA 4PI3A 3B79A 1F2AA 1Q6KA 1U9QX 2AUXA 2FO5A 1KHPA 2AU1A 2FT2A 3D6SA 3K8UA 1AYVA 1X9YA 2YJBA 4QRGA 2E03A 7PCKA 2DC7A 2IBIA 2FTDA 2NQAA 3CH2X 4YYUA 3M99A 2ARYA 2HHNA 3IOQA 3LTWA 1BY8A 1W5RA 4X6JA 4YYVA 2PADA 2DJFB 2JQGR 3LXSA 1NLJA 3IHPA 3KSEA 3TNXA 3LFYA 1KHQA 1F2BA 1GLOA 2VHFA 1ATKA 4C5PA 4AXLA 3IUTA 4OELA 3KWZA 2NQIA 1CV8A 2DCBA 4OEMA 1TL9A 4I07A 1GMYA 3USVA 4XUIA 2BSZA 1U9VA 1U9WA 2DC9A 3PNRA 3P5VA 2B1NA 1W6FA 2HH5A 1AU2A 4PP2E 5CVOB 4QH6A 3KX1A 1KXRA 4DMXA 3PDFA 3OF9A 2AIMA 4QBBA 3U8EA 2XU4A 1GCBA 2R9OA 4BS5A 1EWMA 1TU6A 1EWOA 4MZSA 3P5WA 4CDDB 4G54A 2CB5A 1EF7A 2F7DA 2FYEA 4HWYA 3IEJA 4XR7A 2OP3A 3I06A 1THEA 4B55A 3K24A 2ATOA 1AYUA 2JQFR 3GCBA 1EWPA 1AU3A 1F2CA 1STFE 5CHTA 5A24A 4YYSA 1NB5A 1CVZA 3BCNA 2R9FA 3E1ZB 9PAPA 3QJ3A 1MS6A 3S3RA 4W5CA 3H7DA 5FPWA 3MHSA 1PXVA 2DZZA 2E01A 2AYNA 1SNKA 4X6IA 1GECE 1E2TA 2AS8A 4N4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XU5 A;  3V6E A;  4RY2 A;  2NQD B;  8PCH A;  2F1G A;  2XU3 A;  3I3T A;  1KFU L;  1ZCM A;  2G7Y A;  1U9X A;  2FQ9 A;  1ITO A;  1DF0 A;  3IMA A;  2BDL A;  3BC3 A;  2G8E A;  2BDZ A;  1VJV A;  3V6C A;  1QXP A;  3HD3 A;  3OIS A;  1CB5 A;  2B1M A;  1IWD A;  1NPZ A;  1ME3 A;  3P5X A;  2AVW A;  4MZO A;  2H7J A;  4YV8 A;  6PAD A;  1MDW A;  1BP4 A;  1MHW A;  1BGO A;  3ERV A;  4Q8G A;  1FH0 A;  1PE6 A;  1MIR A;  2O6X A;  1MEG A;  4QRV A;  1CTE A;  3MOR A;  3WXG A;  2WBF X;  4YYQ A;  3NHE A;  1K3B B;  2AYO A;  2IPP B;  3KW9 A;  3OVZ A;  4CDF B;  3H8C A;  1O0E A;  3WXE A;  1AIM A;  3O1G A;  1AU4 A;  3OF8 A;  4CZW A;  3H8B A;  1NQC A;  3CH3 X;  1QDQ A;  3BPM A;  4P6G A;  4BQV A;  1PPP A;  2DCD A;  3H89 A;  2NQG A;  1YK8 A;  4WA6 A;  4BS6 A;  2P0R A;  2HD5 A;  4ZUX U;  3HHI A;  1SP4 B;  3RVW A;  4PP1 A;  5JH3 A;  3RVV A;  1HUC B;  1YVB A;  2YJC A;  2Y6E A;  2R9M A;  2DZY A;  4W4U A;  4KLB A;  1XKG A;  4YYW A;  1PBH A;  1YK7 A;  2FRA A;  1S4V A;  1TLO A;  5CHV A;  2DC8 A;  1AYW A;  1NB3 A;  2CIO A;  3O0U A;  3IV2 A;  1QMY A;  2FUD A;  4BPV A;  2PBH A;  1ME4 A;  4Q8H A;  2XU1 A;  2OZ2 A;  3K9M A;  3F75 A;  1VSN A;  1PPD A;  3HHA A;  4PAD A;  4YVA A;  3PW3 A;  3QSD A;  1ICF A;  3CBK A;  2HXZ A;  2E00 A;  5CVN B;  1Y4H A;  1U5I A;  1AU0 A;  5K16 A;  5PAD A;  2DC6 A;  3DF0 A;  2GHU A;  3KKU A;  2R9N A;  1CSB B;  2DJG B;  1F29 A;  1CPJ A;  4CDC B;  1YT7 A;  4I05 A;  4K7C A;  1A6R A;  1ZIV A;  2PRE A;  3OVX A;  1BQI A;  3RVX A;  2C0Y A;  3CBJ A;  1CS8 A;  1PAD A;  2G6D A;  2FRQ A;  5CVM A;  1AEC A;  2P86 A;  1Y08 A;  3HWN A;  3KWB X;  3ZUA A;  1CJL A;  4N79 A;  3MTN A;  1QOL A;  3N3G A;  2YJ2 A;  5EF4 A;  2P7U A;  3WXF A;  1CQD A;  3N3K A;  3P5U A;  2G8J A;  2OUL A;  2ACT A;  1EWL A;  1PPO A;  4BSQ A;  3H6S A;  1DEU A;  3QT4 A;  5J94 A;  1PCI A;  2R9C A;  3BOW A;  5JA7 A;  1KFX L;  1M6D A;  2VHS A;  2DCA A;  3KFQ A;  3BPF A;  2YJ8 A;  4W5B A;  1POP A;  4I04 A;  4FIP A;  4MSX A;  4X6H A;  1JQP A;  1MEM A;  5EGW A;  4FK5 A;  2PNS A;  2GFO A;  4FJC A;  4YYR A;  3PBH A;  3MHH A;  4CDE B;  4AXM A;  4QRX A;  2E02 A;  3N4C A;  2R6N A;  4DMY A;  1NL6 A;  3F5V A;  3S3Q A;  1PPN A;  3AI8 A;  2Y5B A;  2AUZ A;  3C9E A;  2YJ9 A;  5F02 A;  4P6E A;  2DCC A;  1PIP A;  1YAL A;  3BWK A;  4N8W A;  4PI3 A;  3B79 A;  1F2A A;  1Q6K A;  1U9Q X;  2AUX A;  2FO5 A;  1KHP A;  2AU1 A;  2FT2 A;  3D6S A;  3K8U A;  1AYV A;  1X9Y A;  2YJB A;  4QRG A;  2E03 A;  7PCK A;  2DC7 A;  2IBI A;  2FTD A;  2NQA A;  3CH2 X;  4YYU A;  3M99 A;  2ARY A;  2HHN A;  3IOQ A;  1BY8 A;  4X6J A;  4YYV A;  2PAD A;  2DJF B;  2JQG R;  3LXS A;  1NLJ A;  3IHP A;  3KSE A;  3TNX A;  3LFY A;  1KHQ A;  1F2B A;  1GLO A;  2VHF A;  1ATK A;  4AXL A;  3IUT A;  4OEL A;  3KWZ A;  2NQI A;  1CV8 A;  2DCB A;  4OEM A;  1TL9 A;  4I07 A;  1GMY A;  3USV A;  4XUI A;  1U9V A;  1U9W A;  2DC9 A;  3PNR A;  3P5V A;  2B1N A;  2HH5 A;  1AU2 A;  4PP2 E;  5CVO B;  4QH6 A;  3KX1 A;  1KXR A;  4DMX A;  3PDF A;  3OF9 A;  2AIM A;  4QBB A;  3U8E A;  2XU4 A;  1GCB A;  2R9O A;  4BS5 A;  1EWM A;  1TU6 A;  1EWO A;  4MZS A;  3P5W A;  4CDD B;  4G54 A;  2CB5 A;  1EF7 A;  2F7D A;  2FYE A;  4HWY A;  3IEJ A;  4XR7 A;  2OP3 A;  3I06 A;  1THE A;  3K24 A;  2ATO A;  1AYU A;  2JQF R;  3GCB A;  1EWP A;  1AU3 A;  1F2C A;  1STF E;  5CHT A;  5A24 A;  4YYS A;  1NB5 A;  1CVZ A;  3BCN A;  2R9F A;  3E1Z B;  9PAP A;  3QJ3 A;  1MS6 A;  3S3R A;  4W5C A;  3H7D A;  5FPW A;  3MHS A;  1PXV A;  2DZZ A;  2E01 A;  2AYN A;  1SNK A;  4X6I A;  1GEC E;  2AS8 A;  4N4Z A; 
#chains in the Genus database with same CATH topology
 2XU5 A;  3V6E A;  4RY2 A;  2NQD B;  8PCH A;  2F1G A;  2XU3 A;  3TRK A;  3I3T A;  1KFU L;  1ZCM A;  3PHU A;  2G7Y A;  5EZS A;  1U9X A;  2FQ9 A;  3PHX A;  1ITO A;  1DF0 A;  3IMA A;  2BDL A;  3BC3 A;  2G8E A;  2BDZ A;  1VJV A;  3V6C A;  1QXP A;  3HD3 A;  3OIS A;  1CB5 A;  2B1M A;  1IWD A;  1NPZ A;  1ME3 A;  3P5X A;  2AVW A;  4MZO A;  4BOU A;  3PSE A;  2H7J A;  4YV8 A;  6PAD A;  1MDW A;  1BP4 A;  1MHW A;  1BGO A;  3ERV A;  4Q8G A;  1FH0 A;  1PE6 A;  1MIR A;  2O6X A;  1MEG A;  4QRV A;  1CTE A;  3MOR A;  3WXG A;  2WBF X;  4YYQ A;  4D8E A;  3NHE A;  1K3B B;  2AYO A;  2IPP B;  3KW9 A;  3OVZ A;  4CDF B;  3H8C A;  1O0E A;  5E6J A;  3WXE A;  1AIM A;  3O1G A;  1AU4 A;  3OF8 A;  4CZW A;  3H8B A;  5EZQ A;  1NQC A;  3CH3 X;  1QDQ A;  3BPM A;  4P6G A;  2J7Q A;  4ZTB A;  4BQV A;  4XZX A;  1PPP A;  2DCD A;  3H89 A;  2NQG A;  1YK8 A;  4WA6 A;  4BS6 A;  2P0R A;  2HD5 A;  4ZUX U;  3HHI A;  1SP4 B;  3RVW A;  4PP1 A;  5JH3 A;  3RVV A;  1HUC B;  1YVB A;  2YJC A;  4D8B A;  2Y6E A;  2R9M A;  2DZY A;  4R3D A;  4W4U A;  4KLB A;  1XKG A;  4YYW A;  1PBH A;  1YK7 A;  2FRA A;  1S4V A;  1TLO A;  4HXD B;  5CHV A;  2DC8 A;  1AYW A;  1NB3 A;  2CIO A;  4BOP A;  3O0U A;  3IV2 A;  1QMY A;  2FUD A;  4BPV A;  2PBH A;  1ME4 A;  4Q8H A;  4MM3 B;  2XU1 A;  2OZ2 A;  2BU3 A;  4IUM A;  3K9M A;  3F75 A;  1VSN A;  4RKX A;  1PPD A;  3HHA A;  4PAD A;  4YVA A;  3PW3 A;  3QSD A;  1ICF A;  3CBK A;  2HXZ A;  2E00 A;  3O65 A;  1Y4H A;  5CVN B;  1U5I A;  1AU0 A;  5K16 A;  3C0R A;  5PAD A;  2DC6 A;  3DF0 A;  2GHU A;  5JZE A;  1PVJ A;  3KKU A;  2R9N A;  1CSB B;  2DJG B;  1F29 A;  1CPJ A;  4RF0 A;  4CDC B;  1YT7 A;  4I05 A;  4K7C A;  1A6R A;  1YZB A;  1ZIV A;  2JTC A;  4REZ A;  3TMP A;  2PRE A;  3OVX A;  1BQI A;  3RVX A;  2C0Y A;  3CBJ A;  1CS8 A;  1DKI A;  1PAD A;  2G6D A;  2FRQ A;  2JRI A;  4RNA A;  5CVM A;  4OVZ A;  1AEC A;  2P86 A;  1Y08 A;  4WUR A;  3HWN A;  3KWB X;  3ZUA A;  1CJL A;  4N79 A;  3MTN A;  1QOL A;  3N3G A;  2YJ2 A;  2P7U A;  5EF4 A;  3WXF A;  1CQD A;  3N3K A;  3P5U A;  2G8J A;  2OUL A;  2ACT A;  1EWL A;  1PPO A;  4BSQ A;  3H6S A;  1DEU A;  3ZNH A;  3QT4 A;  5J94 A;  1PCI A;  2R9C A;  3BOW A;  3OQC A;  5JA7 A;  1KFX L;  1M6D A;  2VHS A;  2DCA A;  2DOS A;  3KFQ A;  2HWK A;  3BPF A;  2YJ8 A;  4W5B A;  1POP A;  4I04 A;  4FIP A;  3PT2 A;  4MSX A;  4X6H A;  1JQP A;  3PRP A;  4OW0 A;  3BBA A;  1MEM A;  5EGW A;  4IP3 A;  2BTW A;  4FK5 A;  2PNS A;  2GFO A;  4D8I A;  4FJC A;  4YYR A;  3PHW A;  3PBH A;  3MHH A;  4CDE B;  4MI7 A;  4AXM A;  4QRX A;  2E02 A;  3N4C A;  2R6N A;  4DMY A;  1NL6 A;  3F5V A;  3S3Q A;  1PPN A;  3AI8 A;  2Y5B A;  2AUZ A;  3C9E A;  3W31 A;  2YJ9 A;  5F02 A;  4P6E A;  4BOQ A;  4P16 A;  2DCC A;  1PIP A;  1YAL A;  3MJ5 A;  3BWK A;  4N8W A;  4PI3 A;  3B79 A;  1F2A A;  1Q6K A;  1U9Q X;  2AUX A;  2FO5 A;  1KHP A;  2AU1 A;  2FT2 A;  3D6S A;  3BY4 A;  3K8U A;  1AYV A;  1X9Y A;  2YJB A;  4M0W A;  4QRG A;  2E03 A;  2FE8 A;  2J7Q C;  7PCK A;  2DC7 A;  2IBI A;  4BOZ A;  2FTD A;  2NQA A;  3CH2 X;  4YYU A;  3M99 A;  2ARY A;  2HHN A;  3IOQ A;  1BY8 A;  4X6J A;  4YYV A;  2PAD A;  2DJF B;  2JQG R;  3LXS A;  1NLJ A;  5KO3 A;  2AGA A;  3IHP A;  3KSE A;  3W30 A;  3TNX A;  3LFY A;  1KHQ A;  1F2B A;  1GLO A;  2VHF A;  2BTW B;  1ATK A;  3MTV A;  4AXL A;  3PRM A;  3IUT A;  4OEL A;  3KWZ A;  2NQI A;  1CV8 A;  2DCB A;  4OEM A;  1TL9 A;  4I07 A;  4OVZ B;  3BB7 A;  1UKF A;  1GMY A;  3USV A;  4XUI A;  1U9V A;  4BOS A;  1U9W A;  4RF1 A;  2DC9 A;  3IFU A;  3PNR A;  3P5V A;  2B1N A;  2HH5 A;  3MP2 A;  1AU2 A;  4PP2 E;  5CVO B;  4QH6 A;  3KX1 A;  1KXR A;  4A5U A;  4DMX A;  3PDF A;  3OF9 A;  2AIM A;  4QBB A;  3U8E A;  2XU4 A;  1GCB A;  2R9O A;  4BS5 A;  1EWM A;  1TU6 A;  1EWO A;  4MZS A;  3P5W A;  4CDD B;  2UZJ A;  4G54 A;  2CB5 A;  1EF7 A;  2F7D A;  4GUA A;  2Z84 A;  2FYE A;  4HWY A;  4PT5 A;  3IEJ A;  4XR7 A;  2OP3 A;  3I06 A;  1THE A;  3K24 A;  2ATO A;  1AYU A;  2JQF R;  3GCB A;  3B21 A;  1EWP A;  1AU3 A;  1F2C A;  1STF E;  5CHT A;  5A24 A;  4YYS A;  1NB5 A;  1CVZ A;  3BCN A;  2R9F A;  3E1Z B;  9PAP A;  3QJ3 A;  1MS6 A;  3S3R A;  4W5C A;  3H7D A;  5FPW A;  3RNV A;  3MHS A;  1PXV A;  2DZZ A;  2E01 A;  2AYN A;  1SNK A;  4X6I A;  1GEC E;  2AS8 A;  4N4Z A;  3E9S A; 
#chains in the Genus database with same CATH homology
 2XU5 A;  3V6E A;  4RY2 A;  2NQD B;  8PCH A;  2F1G A;  2XU3 A;  3I3T A;  1KFU L;  1ZCM A;  2G7Y A;  1U9X A;  2FQ9 A;  3D9W A;  1ITO A;  1DF0 A;  3IMA A;  2BDL A;  3BC3 A;  2G8E A;  2BDZ A;  1VJV A;  3V6C A;  1QXP A;  3HD3 A;  3OIS A;  1CB5 A;  2B1M A;  1IWD A;  1NPZ A;  1ME3 A;  3P5X A;  2AVW A;  4MZO A;  2H7J A;  4YV8 A;  6PAD A;  1MDW A;  1BP4 A;  1MHW A;  1BGO A;  3ERV A;  4Q8G A;  1FH0 A;  1PE6 A;  1MIR A;  2O6X A;  1MEG A;  4QRV A;  1CTE A;  3MOR A;  3WXG A;  2WBF X;  4YYQ A;  3NHE A;  1K3B B;  2AYO A;  2IPP B;  3KW9 A;  3OVZ A;  4CDF B;  3H8C A;  1O0E A;  3WXE A;  1AIM A;  3O1G A;  1AU4 A;  3OF8 A;  4CZW A;  3H8B A;  1NQC A;  3CH3 X;  1QDQ A;  3BPM A;  4P6G A;  4BQV A;  1PPP A;  2DCD A;  3H89 A;  2VFB A;  2NQG A;  1YK8 A;  4WA6 A;  4BS6 A;  2P0R A;  2HD5 A;  1GX3 A;  4ZUX U;  3HHI A;  1SP4 B;  3RVW A;  4PP1 A;  5JH3 A;  3RVV A;  1HUC B;  1YVB A;  2YJC A;  2Y6E A;  2R9M A;  2DZY A;  4W4U A;  4KLB A;  1XKG A;  4YYW A;  1PBH A;  1YK7 A;  2FRA A;  1S4V A;  1TLO A;  5CHV A;  2DC8 A;  1AYW A;  1NB3 A;  2CIO A;  3O0U A;  3IV2 A;  1QMY A;  2FUD A;  4BPV A;  2PBH A;  1ME4 A;  4Q8H A;  2XU1 A;  2OZ2 A;  3K9M A;  3F75 A;  1VSN A;  1PPD A;  3HHA A;  4PAD A;  4YVA A;  3PW3 A;  3QSD A;  1ICF A;  3CBK A;  2HXZ A;  2E00 A;  5CVN B;  1Y4H A;  1U5I A;  1AU0 A;  5K16 A;  5PAD A;  2DC6 A;  3DF0 A;  2GHU A;  3KKU A;  1W4T A;  2R9N A;  1CSB B;  2DJG B;  1F29 A;  1CPJ A;  4CDC B;  1YT7 A;  4I05 A;  4K7C A;  1A6R A;  1ZIV A;  4NV8 A;  2PRE A;  3OVX A;  1BQI A;  3RVX A;  2C0Y A;  3CBJ A;  1CS8 A;  1PAD A;  2G6D A;  2FRQ A;  5CVM A;  1AEC A;  2P86 A;  1Y08 A;  4GUZ A;  3HWN A;  3KWB X;  3ZUA A;  1CJL A;  4N79 A;  3MTN A;  4NV7 A;  1QOL A;  3N3G A;  2YJ2 A;  5EF4 A;  2P7U A;  3WXF A;  1CQD A;  3N3K A;  3P5U A;  2G8J A;  2OUL A;  2ACT A;  1EWL A;  1PPO A;  4BSQ A;  3H6S A;  1DEU A;  3QT4 A;  5J94 A;  1PCI A;  2R9C A;  3BOW A;  5JA7 A;  1KFX L;  1M6D A;  2VHS A;  2DCA A;  3KFQ A;  3BPF A;  2YJ8 A;  4W5B A;  1POP A;  4I04 A;  4FIP A;  4MSX A;  4X6H A;  1JQP A;  1MEM A;  5EGW A;  4FK5 A;  2PNS A;  2GFO A;  4FJC A;  4BGF A;  4YYR A;  3PBH A;  3MHH A;  4CDE B;  4AXM A;  4QRX A;  2E02 A;  3N4C A;  2R6N A;  4DMY A;  1NL6 A;  3F5V A;  3S3Q A;  1PPN A;  3AI8 A;  2Y5B A;  2AUZ A;  3C9E A;  2YJ9 A;  5F02 A;  4P6E A;  2VFC A;  2DCC A;  1PIP A;  1YAL A;  3BWK A;  4N8W A;  4PI3 A;  3B79 A;  1F2A A;  1Q6K A;  1U9Q X;  2AUX A;  2FO5 A;  1KHP A;  2AU1 A;  2FT2 A;  3D6S A;  3K8U A;  1AYV A;  1X9Y A;  2YJB A;  4QRG A;  2E03 A;  7PCK A;  2DC7 A;  2IBI A;  2FTD A;  2NQA A;  3CH2 X;  4YYU A;  3M99 A;  2ARY A;  2HHN A;  3IOQ A;  3LTW A;  1BY8 A;  1W5R A;  4X6J A;  4YYV A;  2PAD A;  2DJF B;  2JQG R;  3LXS A;  1NLJ A;  3IHP A;  3KSE A;  3TNX A;  3LFY A;  1KHQ A;  1F2B A;  1GLO A;  2VHF A;  1ATK A;  4C5P A;  4AXL A;  3IUT A;  4OEL A;  3KWZ A;  2NQI A;  1CV8 A;  2DCB A;  4OEM A;  1TL9 A;  4I07 A;  1GMY A;  3USV A;  4XUI A;  2BSZ A;  1U9V A;  1U9W A;  2DC9 A;  3PNR A;  3P5V A;  2B1N A;  1W6F A;  2HH5 A;  1AU2 A;  4PP2 E;  5CVO B;  4QH6 A;  3KX1 A;  1KXR A;  4DMX A;  3PDF A;  3OF9 A;  2AIM A;  4QBB A;  3U8E A;  2XU4 A;  1GCB A;  2R9O A;  4BS5 A;  1EWM A;  1TU6 A;  1EWO A;  4MZS A;  3P5W A;  4CDD B;  4G54 A;  2CB5 A;  1EF7 A;  2F7D A;  2FYE A;  4HWY A;  3IEJ A;  4XR7 A;  2OP3 A;  3I06 A;  1THE A;  4B55 A;  3K24 A;  2ATO A;  1AYU A;  2JQF R;  3GCB A;  1EWP A;  1AU3 A;  1F2C A;  1STF E;  5CHT A;  5A24 A;  4YYS A;  1NB5 A;  1CVZ A;  3BCN A;  2R9F A;  3E1Z B;  9PAP A;  3QJ3 A;  1MS6 A;  3S3R A;  4W5C A;  3H7D A;  5FPW A;  3MHS A;  1PXV A;  2DZZ A;  2E01 A;  2AYN A;  1SNK A;  4X6I A;  1GEC E;  1E2T A;  2AS8 A;  4N4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...