5J94A

Human cathepsin k mutant c25s in complex with the allosteric effector nsc13345
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
223
structure length
223
Chain Sequence
b'YIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSSWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title A novel allosteric mechanism in the cysteine peptidase cathepsin K discovered by computational methods.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 67
structure length 223
sequence length 223
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2016-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 5j94A00
1KHPA 2R9FA 2AS8A 1Q6KA 3S3QA 2VHSA 2E02A 2XU4A 4W5CA 2HXZA 1U5IA 1AYWA 2G8JA 5CVMA 4MZOA 2DJFB 2ARYA 3KX1A 4HWYA 3HD3A 2FUDA 1PBHA 3KKUA 3P5UA 4CDFB 3H6SA 2GFOA 2DJGB 2PBHA 1NQCA 1POPA 2IBIA 1EWOA 2ATOA 3E1ZB 2XU1A 3MHSA 5K16A 3F5VA 3TNXA 3O0UA 2AU1A 2F7DA 4W4UA 3DF0A 1DF0A 1S4VA 3P5XA 4BS6A 3PDFA 3H8CA 4K7CA 8PCHA 1YVBA 2AUXA 1ZCMA 2IPPB 4YYUA 3I06A 4N8WA 1VSNA 1MDWA 1AU0A 3WXFA 1IWDA 3GCBA 4YYVA 3KSEA 1ITOA 4CZWA 1QOLA 3OF9A 3S3RA 1GLOA 1NPZA 2NQIA 1PPPA 3RVWA 4W5BA 3HHIA 1BQIA 3H89A 3K24A 4P6EA 4I04A 5FPWA 7PCKA 2E01A 2E00A 4FJCA 1AYVA 4N79A 3LFYA 3BC3A 1AU3A 1FH0A 4YYWA 1GCBA 2G6DA 3N3GA 4YYQA 3KW9A 4QRGA 3CH2X 1JQPA 3I3TA 2E03A 1AIMA 5EGWA 4X6IA 3BPMA 2PADA 9PAPA 1AU4A 2AVWA 1CS8A 2Y6EA 3PBHA 5PADA 2YJ2A 1GECE 4PI3A 3WXEA 1NB3A 2FQ9A 1O0EA 4AXMA 4OELA 4YV8A 2C0YA 4DMYA 5JH3A 1KXRA 1ME3A 1YT7A 3QJ3A 2AYNA 4PADA 1AU2A 3USVA 5EF4A 4XUIA 4Q8GA 3P5VA 3AI8A 2WBFX 2BDZA 3IV2A 4XR7A 1PPOA 1BP4A 4CDEB 4FIPA 2YJBA 5CVOB 4ZUXU 4I05A 1AYUA 2R9MA 1U9VA 3MORA 2YJ8A 4X6HA 3KWBX 3PNRA 1BY8A 2O6XA 1CB5A 4X6JA 4YYRA 2P86A 1ZIVA 1THEA 2FYEA 2F1GA 3N3KA 1MIRA 2DZZA 3CBKA 2BDLA 1CPJA 1PPDA 3MHHA 1U9XA 4QH6A 3IOQA 4BPVA 2DCCA 3RVXA 1HUCB 2FRAA 3F75A 3HWNA 4P6GA 3K8UA 3BPFA 1STFE 1MHWA 3LXSA 4AXLA 4MZSA 2R6NA 3IMAA 1EF7A 3IEJA 1PE6A 3OVZA 5CVNB 3V6CA 1CSBB 2XU3A 2CIOA 1A6RA 2R9CA 1CVZA 4KLBA 4WA6A 1QXPA 4BQVA 3RVVA 3IUTA 1NL6A 1K3BB 2CB5A 3PW3A 2NQAA 3M99A 3KFQA 3ZUAA 4PP1A 3CH3X 2NQDB 4OEMA 1CV8A 3ERVA 1NB5A 1F2BA 1U9WA 3BOWA 2AIMA 1Y4HA 3U8EA 4CDDB 4DMXA 2YJCA 1EWMA 1GMYA 1YALA 2DCDA 3OISA 4BS5A 1BGOA 2H7JA 5CHVA 4RY2A 5JA7A 1F2AA 2DC9A 4CDCB 2FTDA 4QBBA 4YVAA 1F2CA 4QRXA 1KFUL 1TLOA 2GHUA 3QT4A 3NHEA 3HHAA 1PADA 2Y5BA 3K9MA 3QSDA 2B1NA 1MEGA 1AECA 2R9OA 4BSQA 2HD5A 2PREA 1CTEA 2HH5A 5A24A 4QRVA 2HHNA 1PXVA 1XKGA 1PIPA 1YK7A 1EWLA 5F02A 4I07A 3P5WA 1YK8A 1KFXL 2ACTA 4PP2E 2AUZA 2JQGR 3H7DA 4MSXA 2DC6A 3KWZA 3N4CA 2FO5A 3D6SA 2P0RA 1ME4A 2AYOA 3C9EA 1EWPA 1F29A 1VJVA 1CQDA 2DCBA 1NLJA 1MEMA 3V6EA 2R9NA 3CBJA 3BWKA 1U9QX 1TU6A 1M6DA 6PADA 1SP4B 4YYSA 3OVXA 3B79A 1QDQA 1ICFA 1QMYA 2DC7A 2DZYA 2DCAA 4N4ZA 3WXGA 2PNSA 2VHFA 1SNKA 2G8EA 2NQGA 1CJLA 2DC8A 2B1MA 2FT2A 3MTNA 4G54A 1Y08A 2G7YA 2XU5A 3O1GA 2OP3A 2P7UA 4Q8HA 4FK5A 2OULA 1KHQA 1PCIA 1MS6A 3IHPA 1ATKA 5J94A 3OF8A 2OZ2A 1X9YA 5CHTA 3H8BA 1PPNA 1TL9A 1DEUA 2YJ9A 2JQFR 3BCNA 2FRQA
chains in the Genus database with same CATH superfamily
4RF0A 1KHPA 2R9FA 2AS8A 1Q6KA 4WURA 3S3QA 2VHSA 2E02A 2XU4A 4W5CA 2HXZA 1U5IA 1AYWA 2G8JA 5CVMA 4MZOA 2DJFB 2ARYA 3KX1A 3MTVA 2J7QC 4HWYA 3HD3A 2FUDA 1PBHA 3KKUA 3P5UA 4CDFB 3PRMA 3H6SA 2GFOA 2BTWA 5KO3A 2DJGB 2PBHA 1NQCA 1POPA 2IBIA 1EWOA 2ATOA 3E1ZB 2XU1A 3MHSA 5K16A 3F5VA 3TNXA 3O0UA 2AU1A 2F7DA 4W4UA 3DF0A 1DF0A 1S4VA 3P5XA 4BS6A 3PDFA 3RNVA 4MM3B 3H8CA 4K7CA 8PCHA 3E9SA 1YVBA 2AUXA 3OQCA 1ZCMA 5EZQA 2IPPB 4YYUA 3I06A 3W31A 4N8WA 1VSNA 1MDWA 1AU0A 2UZJA 3WXFA 4A5UA 4HXDB 1IWDA 4BOSA 3GCBA 4YYVA 3KSEA 1ITOA 4CZWA 1QOLA 3OF9A 4ZTBA 3S3RA 1GLOA 1NPZA 3BY4A 2NQIA 1PPPA 3RVWA 4W5BA 3HHIA 1BQIA 3H89A 3K24A 4P6EA 2JTCA 4I04A 5FPWA 4BOUA 7PCKA 3PHUA 2E01A 2E00A 4FJCA 1AYVA 4N79A 3LFYA 3BC3A 1AU3A 1FH0A 4YYWA 1GCBA 2G6DA 3N3GA 4YYQA 3KW9A 2AGAA 4QRGA 3CH2X 1JQPA 3I3TA 2E03A 1AIMA 2Z84A 5EGWA 4X6IA 3BPMA 2PADA 9PAPA 1AU4A 2AVWA 1DKIA 1CS8A 4RF1A 3MJ5A 2Y6EA 4PT5A 3PBHA 4IUMA 5PADA 2YJ2A 1GECE 4PI3A 3WXEA 1NB3A 2FQ9A 1O0EA 4AXMA 4OELA 4YV8A 2C0YA 4DMYA 5JH3A 1KXRA 1ME3A 3PSEA 1YT7A 3QJ3A 2AYNA 4PADA 1AU2A 3USVA 5EF4A 4XUIA 4Q8GA 3P5VA 3AI8A 2WBFX 2BDZA 3IV2A 4XR7A 1PPOA 1BP4A 4CDEB 4FIPA 2YJBA 2BU3A 5CVOB 4ZUXU 4I05A 1AYUA 2R9MA 1U9VA 3MORA 2YJ8A 4X6HA 4RKXA 3KWBX 3PHWA 3PNRA 1BY8A 4REZA 2O6XA 1CB5A 3C0RA 3O65A 4X6JA 4YYRA 2P86A 1ZIVA 1THEA 2FYEA 2F1GA 3N3KA 1MIRA 2DZZA 3CBKA 2BDLA 1CPJA 1PPDA 3MHHA 1U9XA 4QH6A 3IOQA 4BPVA 2DCCA 3RVXA 1HUCB 2FRAA 3F75A 3HWNA 4P6GA 3K8UA 3BPFA 2DOSA 1STFE 1MHWA 3LXSA 4AXLA 4MZSA 2R6NA 3IMAA 1EF7A 3IEJA 1PE6A 3OVZA 5CVNB 3V6CA 1CSBB 2XU3A 2CIOA 1A6RA 2R9CA 1CVZA 4KLBA 4D8EA 4WA6A 1QXPA 4BQVA 3RVVA 3IUTA 4BOPA 1NL6A 1K3BB 2CB5A 3PW3A 2NQAA 3M99A 3KFQA 3ZUAA 3B21A 4PP1A 3CH3X 2NQDB 4OEMA 1CV8A 3ERVA 1NB5A 4D8IA 1F2BA 1U9WA 3BOWA 2AIMA 1Y4HA 3U8EA 5E6JA 4CDDB 4DMXA 2YJCA 1EWMA 4BOQA 5EZSA 1GMYA 1YALA 2DCDA 3OISA 4BS5A 1BGOA 2H7JA 5CHVA 2HWKA 4RY2A 5JA7A 1F2AA 2DC9A 4CDCB 2FTDA 4QBBA 4YVAA 1F2CA 4QRXA 1KFUL 1TLOA 4RNAA 4OW0A 1PVJA 2GHUA 3QT4A 4R3DA 1YZBA 3NHEA 3HHAA 1PADA 2Y5BA 3K9MA 3QSDA 2B1NA 1MEGA 1AECA 2R9OA 5JZEA 3W30A 4BSQA 2HD5A 2PREA 2J7QA 1CTEA 2HH5A 5A24A 4QRVA 4D8BA 2JRIA 2HHNA 3MP2A 1PXVA 1XKGA 1PIPA 1YK7A 1EWLA 5F02A 4I07A 3P5WA 1YK8A 1KFXL 2ACTA 4PP2E 2AUZA 2JQGR 3IFUA 4OVZB 3H7DA 4MSXA 2DC6A 3KWZA 3N4CA 2FO5A 3D6SA 2P0RA 1ME4A 2AYOA 3C9EA 1EWPA 1F29A 1VJVA 1CQDA 2DCBA 1NLJA 2FE8A 1UKFA 1MEMA 3V6EA 2R9NA 4IP3A 3CBJA 3BWKA 4MI7A 1U9QX 4BOZA 3PHXA 1TU6A 1M6DA 6PADA 1SP4B 4YYSA 3OVXA 3B79A 1QDQA 1ICFA 1QMYA 2DC7A 2DZYA 2DCAA 4N4ZA 4P16A 3WXGA 2PNSA 2VHFA 1SNKA 3TRKA 2G8EA 2NQGA 1CJLA 2DC8A 3PRPA 2B1MA 4M0WA 2FT2A 3MTNA 3BBAA 3PT2A 3ZNHA 4G54A 4OVZA 1Y08A 2G7YA 2XU5A 3O1GA 2OP3A 2P7UA 4Q8HA 3BB7A 4FK5A 2BTWB 3TMPA 2OULA 1KHQA 1PCIA 1MS6A 3IHPA 1ATKA 5J94A 3OF8A 2OZ2A 4XZXA 1X9YA 5CHTA 3H8BA 1PPNA 1TL9A 1DEUA 2YJ9A 2JQFR 3BCNA 2FRQA 4GUAA
chains in the Genus database with same CATH topology
1KHPA 2R9FA 2AS8A 1Q6KA 3S3QA 2VHSA 2E02A 2XU4A 4W5CA 2HXZA 1U5IA 1AYWA 2G8JA 5CVMA 4MZOA 2DJFB 2ARYA 3KX1A 2VFBA 4HWYA 3HD3A 2FUDA 1PBHA 3KKUA 3P5UA 4CDFB 3H6SA 2GFOA 2DJGB 2PBHA 1NQCA 1POPA 2IBIA 1EWOA 2ATOA 3E1ZB 2XU1A 3MHSA 5K16A 3F5VA 3TNXA 3O0UA 2AU1A 2F7DA 4W4UA 3DF0A 1DF0A 1S4VA 3P5XA 4BS6A 3PDFA 3H8CA 4K7CA 8PCHA 1YVBA 2AUXA 1ZCMA 2IPPB 4YYUA 3I06A 4N8WA 1VSNA 1MDWA 1AU0A 3WXFA 1IWDA 3GCBA 4YYVA 3KSEA 1ITOA 4CZWA 1QOLA 3OF9A 3S3RA 1GLOA 1NPZA 4C5PA 2NQIA 1PPPA 3RVWA 4W5BA 3HHIA 1BQIA 3H89A 3K24A 4P6EA 4I04A 5FPWA 7PCKA 2E01A 2E00A 4FJCA 1AYVA 4N79A 3LFYA 3BC3A 1AU3A 1FH0A 4YYWA 1GCBA 2G6DA 3N3GA 4YYQA 3KW9A 4QRGA 3CH2X 1JQPA 3I3TA 2E03A 1AIMA 5EGWA 4X6IA 3BPMA 2PADA 9PAPA 1AU4A 2AVWA 1CS8A 2Y6EA 3PBHA 5PADA 2YJ2A 1GECE 4PI3A 3WXEA 1NB3A 2FQ9A 1O0EA 4AXMA 4OELA 4YV8A 2C0YA 4DMYA 5JH3A 1KXRA 1ME3A 1YT7A 3QJ3A 2AYNA 4PADA 1AU2A 3USVA 5EF4A 4XUIA 4Q8GA 3P5VA 3AI8A 2WBFX 2BDZA 3IV2A 4XR7A 1PPOA 1BP4A 4CDEB 4FIPA 2YJBA 2VFCA 5CVOB 4ZUXU 4I05A 1AYUA 2R9MA 1U9VA 3MORA 2YJ8A 4X6HA 3KWBX 3PNRA 1BY8A 2O6XA 1CB5A 4X6JA 4YYRA 2P86A 1ZIVA 1THEA 2FYEA 2F1GA 3N3KA 1MIRA 2DZZA 3CBKA 2BDLA 1CPJA 1PPDA 3MHHA 1U9XA 4QH6A 3IOQA 4BPVA 2DCCA 3RVXA 1HUCB 2FRAA 3F75A 3HWNA 4P6GA 3K8UA 3BPFA 1STFE 1MHWA 3LXSA 4AXLA 4MZSA 2R6NA 3IMAA 1EF7A 3IEJA 1PE6A 3OVZA 5CVNB 3V6CA 1CSBB 2XU3A 2CIOA 1A6RA 2R9CA 1CVZA 4KLBA 4WA6A 1QXPA 4BQVA 3RVVA 3IUTA 1NL6A 1K3BB 2CB5A 3PW3A 2NQAA 3M99A 4GUZA 3KFQA 3ZUAA 4PP1A 3CH3X 2NQDB 4OEMA 1CV8A 3ERVA 1NB5A 1F2BA 1U9WA 3BOWA 2AIMA 1Y4HA 3U8EA 4CDDB 4DMXA 2YJCA 1EWMA 1GMYA 1YALA 2DCDA 3OISA 4BS5A 1BGOA 2H7JA 5CHVA 4RY2A 5JA7A 1F2AA 2DC9A 4CDCB 2FTDA 4QBBA 3LTWA 4YVAA 1F2CA 4QRXA 1KFUL 1TLOA 2GHUA 3QT4A 3NHEA 3HHAA 1PADA 2Y5BA 3K9MA 3QSDA 2B1NA 1MEGA 1AECA 2R9OA 4BSQA 2HD5A 2PREA 1CTEA 1GX3A 2HH5A 5A24A 1W6FA 4QRVA 4NV8A 2HHNA 1PXVA 1XKGA 1PIPA 1YK7A 1EWLA 5F02A 4I07A 3P5WA 1YK8A 1KFXL 2ACTA 4PP2E 2AUZA 1W4TA 2JQGR 4BGFA 3H7DA 4MSXA 2DC6A 3KWZA 3N4CA 2FO5A 3D6SA 4NV7A 2P0RA 1ME4A 2AYOA 4B55A 3C9EA 1EWPA 1F29A 1VJVA 1CQDA 2DCBA 1NLJA 1MEMA 3V6EA 2R9NA 3CBJA 3BWKA 1U9QX 1TU6A 1W5RA 1M6DA 3D9WA 6PADA 1SP4B 4YYSA 3OVXA 3B79A 1QDQA 1ICFA 1QMYA 2DC7A 2DZYA 2DCAA 4N4ZA 3WXGA 2PNSA 2VHFA 1SNKA 2BSZA 2G8EA 2NQGA 1CJLA 2DC8A 2B1MA 2FT2A 3MTNA 4G54A 1Y08A 2G7YA 2XU5A 3O1GA 2OP3A 2P7UA 4Q8HA 4FK5A 1E2TA 2OULA 1KHQA 1PCIA 1MS6A 3IHPA 1ATKA 5J94A 3OF8A 2OZ2A 1X9YA 5CHTA 3H8BA 1PPNA 1TL9A 1DEUA 2YJ9A 2JQFR 3BCNA 2FRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KHP A;  2R9F A;  2AS8 A;  1Q6K A;  3S3Q A;  2VHS A;  2E02 A;  2XU4 A;  4W5C A;  2HXZ A;  1U5I A;  1AYW A;  2G8J A;  5CVM A;  4MZO A;  2DJF B;  2ARY A;  3KX1 A;  4HWY A;  3HD3 A;  2FUD A;  1PBH A;  3KKU A;  3P5U A;  4CDF B;  3H6S A;  2GFO A;  2DJG B;  2PBH A;  1NQC A;  1POP A;  2IBI A;  1EWO A;  2ATO A;  3E1Z B;  2XU1 A;  3MHS A;  5K16 A;  3F5V A;  3TNX A;  3O0U A;  2AU1 A;  2F7D A;  4W4U A;  3DF0 A;  1DF0 A;  1S4V A;  3P5X A;  4BS6 A;  3PDF A;  3H8C A;  4K7C A;  8PCH A;  1YVB A;  2AUX A;  1ZCM A;  2IPP B;  4YYU A;  3I06 A;  4N8W A;  1VSN A;  1MDW A;  1AU0 A;  3WXF A;  1IWD A;  3GCB A;  4YYV A;  3KSE A;  1ITO A;  4CZW A;  1QOL A;  3OF9 A;  3S3R A;  1GLO A;  1NPZ A;  2NQI A;  1PPP A;  3RVW A;  4W5B A;  3HHI A;  1BQI A;  3H89 A;  3K24 A;  4P6E A;  4I04 A;  5FPW A;  7PCK A;  2E01 A;  2E00 A;  4FJC A;  1AYV A;  4N79 A;  3LFY A;  3BC3 A;  1AU3 A;  1FH0 A;  4YYW A;  1GCB A;  2G6D A;  3N3G A;  4YYQ A;  3KW9 A;  4QRG A;  3CH2 X;  1JQP A;  3I3T A;  2E03 A;  1AIM A;  5EGW A;  4X6I A;  3BPM A;  2PAD A;  9PAP A;  1AU4 A;  2AVW A;  1CS8 A;  2Y6E A;  3PBH A;  5PAD A;  2YJ2 A;  1GEC E;  4PI3 A;  3WXE A;  1NB3 A;  2FQ9 A;  1O0E A;  4AXM A;  4OEL A;  4YV8 A;  2C0Y A;  4DMY A;  5JH3 A;  1KXR A;  1ME3 A;  1YT7 A;  3QJ3 A;  2AYN A;  4PAD A;  1AU2 A;  3USV A;  5EF4 A;  4XUI A;  4Q8G A;  3P5V A;  3AI8 A;  2WBF X;  2BDZ A;  3IV2 A;  4XR7 A;  1PPO A;  1BP4 A;  4CDE B;  4FIP A;  2YJB A;  5CVO B;  4ZUX U;  4I05 A;  1AYU A;  2R9M A;  1U9V A;  3MOR A;  2YJ8 A;  4X6H A;  3KWB X;  3PNR A;  1BY8 A;  2O6X A;  1CB5 A;  4X6J A;  4YYR A;  2P86 A;  1ZIV A;  1THE A;  2FYE A;  2F1G A;  3N3K A;  1MIR A;  2DZZ A;  3CBK A;  2BDL A;  1CPJ A;  1PPD A;  3MHH A;  1U9X A;  4QH6 A;  3IOQ A;  4BPV A;  2DCC A;  3RVX A;  1HUC B;  2FRA A;  3F75 A;  3HWN A;  4P6G A;  3K8U A;  3BPF A;  1STF E;  1MHW A;  3LXS A;  4AXL A;  4MZS A;  2R6N A;  3IMA A;  1EF7 A;  3IEJ A;  1PE6 A;  3OVZ A;  5CVN B;  3V6C A;  1CSB B;  2XU3 A;  2CIO A;  1A6R A;  2R9C A;  1CVZ A;  4KLB A;  4WA6 A;  1QXP A;  4BQV A;  3RVV A;  3IUT A;  1NL6 A;  1K3B B;  2CB5 A;  3PW3 A;  2NQA A;  3M99 A;  3KFQ A;  3ZUA A;  4PP1 A;  3CH3 X;  2NQD B;  4OEM A;  1CV8 A;  3ERV A;  1NB5 A;  1F2B A;  1U9W A;  3BOW A;  2AIM A;  1Y4H A;  3U8E A;  4CDD B;  4DMX A;  2YJC A;  1EWM A;  1GMY A;  1YAL A;  2DCD A;  3OIS A;  4BS5 A;  1BGO A;  2H7J A;  5CHV A;  4RY2 A;  5JA7 A;  1F2A A;  2DC9 A;  4CDC B;  2FTD A;  4QBB A;  4YVA A;  1F2C A;  4QRX A;  1KFU L;  1TLO A;  2GHU A;  3QT4 A;  3NHE A;  3HHA A;  1PAD A;  2Y5B A;  3K9M A;  3QSD A;  2B1N A;  1MEG A;  1AEC A;  2R9O A;  4BSQ A;  2HD5 A;  2PRE A;  1CTE A;  2HH5 A;  5A24 A;  4QRV A;  2HHN A;  1PXV A;  1XKG A;  1PIP A;  1YK7 A;  1EWL A;  5F02 A;  4I07 A;  3P5W A;  1YK8 A;  1KFX L;  2ACT A;  4PP2 E;  2AUZ A;  2JQG R;  3H7D A;  4MSX A;  2DC6 A;  3KWZ A;  3N4C A;  2FO5 A;  3D6S A;  2P0R A;  1ME4 A;  2AYO A;  3C9E A;  1EWP A;  1F29 A;  1VJV A;  1CQD A;  2DCB A;  1NLJ A;  1MEM A;  3V6E A;  2R9N A;  3CBJ A;  3BWK A;  1U9Q X;  1TU6 A;  1M6D A;  6PAD A;  1SP4 B;  4YYS A;  3OVX A;  3B79 A;  1QDQ A;  1ICF A;  1QMY A;  2DC7 A;  2DZY A;  2DCA A;  4N4Z A;  3WXG A;  2PNS A;  2VHF A;  1SNK A;  2G8E A;  2NQG A;  1CJL A;  2DC8 A;  2B1M A;  2FT2 A;  3MTN A;  4G54 A;  1Y08 A;  2G7Y A;  2XU5 A;  3O1G A;  2OP3 A;  2P7U A;  4Q8H A;  4FK5 A;  2OUL A;  1KHQ A;  1PCI A;  1MS6 A;  3IHP A;  1ATK A;  5J94 A;  3OF8 A;  2OZ2 A;  1X9Y A;  5CHT A;  3H8B A;  1PPN A;  1TL9 A;  1DEU A;  2YJ9 A;  2JQF R;  3BCN A;  2FRQ A; 
#chains in the Genus database with same CATH topology
 4RF0 A;  1KHP A;  2R9F A;  2AS8 A;  1Q6K A;  4WUR A;  3S3Q A;  2VHS A;  2E02 A;  2XU4 A;  4W5C A;  2HXZ A;  1U5I A;  1AYW A;  2G8J A;  5CVM A;  4MZO A;  2DJF B;  2ARY A;  3KX1 A;  3MTV A;  2J7Q C;  4HWY A;  3HD3 A;  2FUD A;  1PBH A;  3KKU A;  3P5U A;  4CDF B;  3PRM A;  3H6S A;  2GFO A;  2BTW A;  5KO3 A;  2DJG B;  2PBH A;  1NQC A;  1POP A;  2IBI A;  1EWO A;  2ATO A;  3E1Z B;  2XU1 A;  3MHS A;  5K16 A;  3F5V A;  3TNX A;  3O0U A;  2AU1 A;  2F7D A;  4W4U A;  3DF0 A;  1DF0 A;  1S4V A;  3P5X A;  4BS6 A;  3PDF A;  3RNV A;  4MM3 B;  3H8C A;  4K7C A;  8PCH A;  3E9S A;  1YVB A;  2AUX A;  3OQC A;  1ZCM A;  5EZQ A;  2IPP B;  4YYU A;  3I06 A;  3W31 A;  4N8W A;  1VSN A;  1MDW A;  1AU0 A;  2UZJ A;  3WXF A;  4A5U A;  4HXD B;  1IWD A;  4BOS A;  3GCB A;  4YYV A;  3KSE A;  1ITO A;  4CZW A;  1QOL A;  3OF9 A;  4ZTB A;  3S3R A;  1GLO A;  1NPZ A;  3BY4 A;  2NQI A;  1PPP A;  3RVW A;  4W5B A;  3HHI A;  1BQI A;  3H89 A;  3K24 A;  4P6E A;  2JTC A;  4I04 A;  5FPW A;  4BOU A;  7PCK A;  3PHU A;  2E01 A;  2E00 A;  4FJC A;  1AYV A;  4N79 A;  3LFY A;  3BC3 A;  1AU3 A;  1FH0 A;  4YYW A;  1GCB A;  2G6D A;  3N3G A;  4YYQ A;  3KW9 A;  2AGA A;  4QRG A;  3CH2 X;  1JQP A;  3I3T A;  2E03 A;  1AIM A;  2Z84 A;  5EGW A;  4X6I A;  3BPM A;  2PAD A;  9PAP A;  1AU4 A;  2AVW A;  1DKI A;  1CS8 A;  4RF1 A;  3MJ5 A;  2Y6E A;  4PT5 A;  3PBH A;  4IUM A;  5PAD A;  2YJ2 A;  1GEC E;  4PI3 A;  3WXE A;  1NB3 A;  2FQ9 A;  1O0E A;  4AXM A;  4OEL A;  4YV8 A;  2C0Y A;  4DMY A;  5JH3 A;  1KXR A;  1ME3 A;  3PSE A;  1YT7 A;  3QJ3 A;  2AYN A;  4PAD A;  1AU2 A;  3USV A;  5EF4 A;  4XUI A;  4Q8G A;  3P5V A;  3AI8 A;  2WBF X;  2BDZ A;  3IV2 A;  4XR7 A;  1PPO A;  1BP4 A;  4CDE B;  4FIP A;  2YJB A;  2BU3 A;  5CVO B;  4ZUX U;  4I05 A;  1AYU A;  2R9M A;  1U9V A;  3MOR A;  2YJ8 A;  4X6H A;  4RKX A;  3KWB X;  3PHW A;  3PNR A;  1BY8 A;  4REZ A;  2O6X A;  1CB5 A;  3C0R A;  3O65 A;  4X6J A;  4YYR A;  2P86 A;  1ZIV A;  1THE A;  2FYE A;  2F1G A;  3N3K A;  1MIR A;  2DZZ A;  3CBK A;  2BDL A;  1CPJ A;  1PPD A;  3MHH A;  1U9X A;  4QH6 A;  3IOQ A;  4BPV A;  2DCC A;  3RVX A;  1HUC B;  2FRA A;  3F75 A;  3HWN A;  4P6G A;  3K8U A;  3BPF A;  2DOS A;  1STF E;  1MHW A;  3LXS A;  4AXL A;  4MZS A;  2R6N A;  3IMA A;  1EF7 A;  3IEJ A;  1PE6 A;  3OVZ A;  5CVN B;  3V6C A;  1CSB B;  2XU3 A;  2CIO A;  1A6R A;  2R9C A;  1CVZ A;  4KLB A;  4D8E A;  4WA6 A;  1QXP A;  4BQV A;  3RVV A;  3IUT A;  4BOP A;  1NL6 A;  1K3B B;  2CB5 A;  3PW3 A;  2NQA A;  3M99 A;  3KFQ A;  3ZUA A;  3B21 A;  4PP1 A;  3CH3 X;  2NQD B;  4OEM A;  1CV8 A;  3ERV A;  1NB5 A;  4D8I A;  1F2B A;  1U9W A;  3BOW A;  2AIM A;  1Y4H A;  3U8E A;  5E6J A;  4CDD B;  4DMX A;  2YJC A;  1EWM A;  4BOQ A;  5EZS A;  1GMY A;  1YAL A;  2DCD A;  3OIS A;  4BS5 A;  1BGO A;  2H7J A;  5CHV A;  2HWK A;  4RY2 A;  5JA7 A;  1F2A A;  2DC9 A;  4CDC B;  2FTD A;  4QBB A;  4YVA A;  1F2C A;  4QRX A;  1KFU L;  1TLO A;  4RNA A;  4OW0 A;  1PVJ A;  2GHU A;  3QT4 A;  4R3D A;  1YZB A;  3NHE A;  3HHA A;  1PAD A;  2Y5B A;  3K9M A;  3QSD A;  2B1N A;  1MEG A;  1AEC A;  2R9O A;  5JZE A;  3W30 A;  4BSQ A;  2HD5 A;  2PRE A;  2J7Q A;  1CTE A;  2HH5 A;  5A24 A;  4QRV A;  4D8B A;  2JRI A;  2HHN A;  3MP2 A;  1PXV A;  1XKG A;  1PIP A;  1YK7 A;  1EWL A;  5F02 A;  4I07 A;  3P5W A;  1YK8 A;  1KFX L;  2ACT A;  4PP2 E;  2AUZ A;  2JQG R;  3IFU A;  4OVZ B;  3H7D A;  4MSX A;  2DC6 A;  3KWZ A;  3N4C A;  2FO5 A;  3D6S A;  2P0R A;  1ME4 A;  2AYO A;  3C9E A;  1EWP A;  1F29 A;  1VJV A;  1CQD A;  2DCB A;  1NLJ A;  2FE8 A;  1UKF A;  1MEM A;  3V6E A;  2R9N A;  4IP3 A;  3CBJ A;  3BWK A;  4MI7 A;  1U9Q X;  4BOZ A;  3PHX A;  1TU6 A;  1M6D A;  6PAD A;  1SP4 B;  4YYS A;  3OVX A;  3B79 A;  1QDQ A;  1ICF A;  1QMY A;  2DC7 A;  2DZY A;  2DCA A;  4N4Z A;  4P16 A;  3WXG A;  2PNS A;  2VHF A;  1SNK A;  3TRK A;  2G8E A;  2NQG A;  1CJL A;  2DC8 A;  3PRP A;  2B1M A;  4M0W A;  2FT2 A;  3MTN A;  3BBA A;  3PT2 A;  3ZNH A;  4G54 A;  4OVZ A;  1Y08 A;  2G7Y A;  2XU5 A;  3O1G A;  2OP3 A;  2P7U A;  4Q8H A;  3BB7 A;  4FK5 A;  2BTW B;  3TMP A;  2OUL A;  1KHQ A;  1PCI A;  1MS6 A;  3IHP A;  1ATK A;  5J94 A;  3OF8 A;  2OZ2 A;  4XZX A;  1X9Y A;  5CHT A;  3H8B A;  1PPN A;  1TL9 A;  1DEU A;  2YJ9 A;  2JQF R;  3BCN A;  2FRQ A;  4GUA A; 
#chains in the Genus database with same CATH homology
 1KHP A;  2R9F A;  2AS8 A;  1Q6K A;  3S3Q A;  2VHS A;  2E02 A;  2XU4 A;  4W5C A;  2HXZ A;  1U5I A;  1AYW A;  2G8J A;  5CVM A;  4MZO A;  2DJF B;  2ARY A;  3KX1 A;  2VFB A;  4HWY A;  3HD3 A;  2FUD A;  1PBH A;  3KKU A;  3P5U A;  4CDF B;  3H6S A;  2GFO A;  2DJG B;  2PBH A;  1NQC A;  1POP A;  2IBI A;  1EWO A;  2ATO A;  3E1Z B;  2XU1 A;  3MHS A;  5K16 A;  3F5V A;  3TNX A;  3O0U A;  2AU1 A;  2F7D A;  4W4U A;  3DF0 A;  1DF0 A;  1S4V A;  3P5X A;  4BS6 A;  3PDF A;  3H8C A;  4K7C A;  8PCH A;  1YVB A;  2AUX A;  1ZCM A;  2IPP B;  4YYU A;  3I06 A;  4N8W A;  1VSN A;  1MDW A;  1AU0 A;  3WXF A;  1IWD A;  3GCB A;  4YYV A;  3KSE A;  1ITO A;  4CZW A;  1QOL A;  3OF9 A;  3S3R A;  1GLO A;  1NPZ A;  4C5P A;  2NQI A;  1PPP A;  3RVW A;  4W5B A;  3HHI A;  1BQI A;  3H89 A;  3K24 A;  4P6E A;  4I04 A;  5FPW A;  7PCK A;  2E01 A;  2E00 A;  4FJC A;  1AYV A;  4N79 A;  3LFY A;  3BC3 A;  1AU3 A;  1FH0 A;  4YYW A;  1GCB A;  2G6D A;  3N3G A;  4YYQ A;  3KW9 A;  4QRG A;  3CH2 X;  1JQP A;  3I3T A;  2E03 A;  1AIM A;  5EGW A;  4X6I A;  3BPM A;  2PAD A;  9PAP A;  1AU4 A;  2AVW A;  1CS8 A;  2Y6E A;  3PBH A;  5PAD A;  2YJ2 A;  1GEC E;  4PI3 A;  3WXE A;  1NB3 A;  2FQ9 A;  1O0E A;  4AXM A;  4OEL A;  4YV8 A;  2C0Y A;  4DMY A;  5JH3 A;  1KXR A;  1ME3 A;  1YT7 A;  3QJ3 A;  2AYN A;  4PAD A;  1AU2 A;  3USV A;  5EF4 A;  4XUI A;  4Q8G A;  3P5V A;  3AI8 A;  2WBF X;  2BDZ A;  3IV2 A;  4XR7 A;  1PPO A;  1BP4 A;  4CDE B;  4FIP A;  2YJB A;  2VFC A;  5CVO B;  4ZUX U;  4I05 A;  1AYU A;  2R9M A;  1U9V A;  3MOR A;  2YJ8 A;  4X6H A;  3KWB X;  3PNR A;  1BY8 A;  2O6X A;  1CB5 A;  4X6J A;  4YYR A;  2P86 A;  1ZIV A;  1THE A;  2FYE A;  2F1G A;  3N3K A;  1MIR A;  2DZZ A;  3CBK A;  2BDL A;  1CPJ A;  1PPD A;  3MHH A;  1U9X A;  4QH6 A;  3IOQ A;  4BPV A;  2DCC A;  3RVX A;  1HUC B;  2FRA A;  3F75 A;  3HWN A;  4P6G A;  3K8U A;  3BPF A;  1STF E;  1MHW A;  3LXS A;  4AXL A;  4MZS A;  2R6N A;  3IMA A;  1EF7 A;  3IEJ A;  1PE6 A;  3OVZ A;  5CVN B;  3V6C A;  1CSB B;  2XU3 A;  2CIO A;  1A6R A;  2R9C A;  1CVZ A;  4KLB A;  4WA6 A;  1QXP A;  4BQV A;  3RVV A;  3IUT A;  1NL6 A;  1K3B B;  2CB5 A;  3PW3 A;  2NQA A;  3M99 A;  4GUZ A;  3KFQ A;  3ZUA A;  4PP1 A;  3CH3 X;  2NQD B;  4OEM A;  1CV8 A;  3ERV A;  1NB5 A;  1F2B A;  1U9W A;  3BOW A;  2AIM A;  1Y4H A;  3U8E A;  4CDD B;  4DMX A;  2YJC A;  1EWM A;  1GMY A;  1YAL A;  2DCD A;  3OIS A;  4BS5 A;  1BGO A;  2H7J A;  5CHV A;  4RY2 A;  5JA7 A;  1F2A A;  2DC9 A;  4CDC B;  2FTD A;  4QBB A;  3LTW A;  4YVA A;  1F2C A;  4QRX A;  1KFU L;  1TLO A;  2GHU A;  3QT4 A;  3NHE A;  3HHA A;  1PAD A;  2Y5B A;  3K9M A;  3QSD A;  2B1N A;  1MEG A;  1AEC A;  2R9O A;  4BSQ A;  2HD5 A;  2PRE A;  1CTE A;  1GX3 A;  2HH5 A;  5A24 A;  1W6F A;  4QRV A;  4NV8 A;  2HHN A;  1PXV A;  1XKG A;  1PIP A;  1YK7 A;  1EWL A;  5F02 A;  4I07 A;  3P5W A;  1YK8 A;  1KFX L;  2ACT A;  4PP2 E;  2AUZ A;  1W4T A;  2JQG R;  4BGF A;  3H7D A;  4MSX A;  2DC6 A;  3KWZ A;  3N4C A;  2FO5 A;  3D6S A;  4NV7 A;  2P0R A;  1ME4 A;  2AYO A;  4B55 A;  3C9E A;  1EWP A;  1F29 A;  1VJV A;  1CQD A;  2DCB A;  1NLJ A;  1MEM A;  3V6E A;  2R9N A;  3CBJ A;  3BWK A;  1U9Q X;  1TU6 A;  1W5R A;  1M6D A;  3D9W A;  6PAD A;  1SP4 B;  4YYS A;  3OVX A;  3B79 A;  1QDQ A;  1ICF A;  1QMY A;  2DC7 A;  2DZY A;  2DCA A;  4N4Z A;  3WXG A;  2PNS A;  2VHF A;  1SNK A;  2BSZ A;  2G8E A;  2NQG A;  1CJL A;  2DC8 A;  2B1M A;  2FT2 A;  3MTN A;  4G54 A;  1Y08 A;  2G7Y A;  2XU5 A;  3O1G A;  2OP3 A;  2P7U A;  4Q8H A;  4FK5 A;  1E2T A;  2OUL A;  1KHQ A;  1PCI A;  1MS6 A;  3IHP A;  1ATK A;  5J94 A;  3OF8 A;  2OZ2 A;  1X9Y A;  5CHT A;  3H8B A;  1PPN A;  1TL9 A;  1DEU A;  2YJ9 A;  2JQF R;  3BCN A;  2FRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...