2JQGR

Leader protease
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
167
structure length
167
Chain Sequence
MELTLYNGEKKTFYSRPNNHDNAWLNAILQLFRYVEEPFFDWVYSSPENLTLEAIKQLEDLTGLELHEGGPPALVIWNIKHLLHTGIGTASRPSEVCVVDGTDMCLADFHAGIFLKGQEHAVFACVTSNGWYAIDDEDFYPWTPDPSDVLVFVPYDQEPLNGEWKAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Genome polyprotein
publication title Investigating the Substrate Specificity and Oligomerisation of the Leader Protease of Foot and Mouth Disease Virus using NMR
pubmed doi rcsb
source organism Foot-and-mouth disease virus (strain o1)
total genus 26
structure length 167
sequence length 167
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2jqgR00
2OZ2A 3K9MA 2AS8A 1CV8A 2E01A 2PBHA 3M99A 3BPFA 3E1ZB 2XU1A 1NLJA 2NQAA 2G8EA 3H7DA 2HD5A 3H8BA 5FPWA 3QT4A 1PADA 1BP4A 3BOWA 3K24A 1GECE 1MS6A 2R9NA 2VHSA 4YVAA 3OISA 1KHPA 2FTDA 3CBKA 4BQVA 2GHUA 4K7CA 6PADA 5JH3A 3N3GA 1GCBA 2Y6EA 1SP4B 4YYRA 4G54A 1XKGA 3BWKA 2OP3A 2DC9A 3OVZA 4I04A 5CVNB 4QRVA 2ACTA 1KHQA 2JQFR 4AXLA 4DMYA 1CVZA 3S3QA 3QSDA 1FH0A 1YK7A 2NQGA 4BS5A 4PADA 2PNSA 4MZOA 1F29A 3U8EA 3D6SA 3N4CA 1PXVA 1STFE 1TL9A 4PP1A 4Q8HA 2XU5A 4MZSA 1CPJA 5EF4A 1MDWA 4P6GA 2PADA 1AYUA 4YYVA 1ICFA 4QRGA 1NL6A 1AU0A 2DCBA 2CB5A 1EWLA 3C9EA 4MSXA 2AU1A 1AU3A 1QOLA 2IPPB 2DCAA 1CQDA 1NQCA 1PPPA 5CVOB 1THEA 3B79A 2AUXA 7PCKA 4CZWA 3H6SA 4X6JA 2AYOA 1CTEA 1MEMA 3USVA 3P5WA 3KKUA 2G7YA 3OF8A 4W5BA 2DC7A 2C0YA 3V6EA 1A6RA 2ATOA 2FYEA 1QXPA 3IEJA 1AU4A 4I05A 1EWPA 4CDCB 2BDZA 3PDFA 2P7UA 1VSNA 1K3BB 4HWYA 2FRAA 2PREA 1ME3A 3HD3A 2DJGB 2BDLA 2H7JA 4W4UA 1O0EA 3MORA 1PPDA 2HXZA 5CVMA 5A24A 4QBBA 1NB5A 1GMYA 1ATKA 2OULA 4XR7A 4BSQA 1ME4A 2E02A 4YYWA 3PBHA 2NQIA 1PBHA 1QMYA 4XUIA 3HWNA 3GCBA 2YJ9A 1Y4HA 1AECA 2AIMA 3CBJA 4YYSA 3WXGA 1S4VA 1U9WA 1DEUA 3HHAA 4FK5A 1PIPA 4X6HA 3P5VA 4YYQA 3H89A 2XU3A 1AYVA 1U9QX 4N79A 1AU2A 1TLOA 1JQPA 2R9CA 2ARYA 3I06A 1IWDA 4BS6A 4P6EA 3F75A 3RVWA 1CSBB 1YK8A 3O0UA 2CIOA 2B1NA 1EF7A 4RY2A 1TU6A 4YYUA 1YVBA 1U9VA 3KFQA 3O1GA 5EGWA 1U9XA 1EWOA 8PCHA 3MTNA 2E00A 1SNKA 2R9OA 3ERVA 1F2AA 3TNXA 3KWZA 1QDQA 2AYNA 2O6XA 2DZZA 1Q6KA 2R6NA 2FO5A 3I3TA 1F2BA 2NQDB 2DCCA 1GLOA 1NPZA 4N4ZA 2Y5BA 1VJVA 2P0RA 3PW3A 2XU4A 3BCNA 1MIRA 3QJ3A 2JQGR 4OEMA 1ZIVA 5PADA 1AYWA 1KFUL 4OELA 3P5XA 5J94A 3ZUAA 2DJFB 4FJCA 2YJCA 2FRQA 1F2CA 4KLBA 2E03A 4PP2E 1YT7A 2DZYA 1CJLA 1CB5A 1NB3A 2DCDA 3KWBX 3KSEA 1BGOA 3N3KA 2G6DA 3IHPA 3IOQA 3P5UA 3WXFA 1YALA 4ZUXU 9PAPA 3F5VA 3CH2X 2P86A 3K8UA 3DF0A 2YJ2A 1POPA 3BC3A 4I07A 5JA7A 5F02A 1MEGA 3CH3X 2HH5A 1ZCMA 2IBIA 2F7DA 4QRXA 2G8JA 1ITOA 1BY8A 2YJBA 4CDEB 2R9MA 1KXRA 3OVXA 4AXMA 5K16A 2WBFX 5CHTA 1PE6A 3PNRA 3H8CA 1MHWA 3AI8A 5CHVA 4FIPA 4BPVA 3KW9A 2R9FA 3LXSA 3WXEA 2YJ8A 3RVVA 2FT2A 3IMAA 3S3RA 1Y08A 2F1GA 1M6DA 4WA6A 1HUCB 1U5IA 4X6IA 3IV2A 3IUTA 4W5CA 1CS8A 4CDDB 3KX1A 4YV8A 3BPMA 4PI3A 2FUDA 2B1MA 4N8WA 3NHEA 1EWMA 1PPOA 1DF0A 1BQIA 1PCIA 1X9YA 4CDFB 2DC6A 3MHHA 3MHSA 3OF9A 2AUZA 2DC8A 2GFOA 1KFXL 3V6CA 1AIMA 2FQ9A 2AVWA 3HHIA 3LFYA 2VHFA 4QH6A 2HHNA 1PPNA 3RVXA 4DMXA 4Q8GA
chains in the Genus database with same CATH superfamily
2OZ2A 3K9MA 3O65A 2AS8A 1CV8A 2E01A 2PBHA 3M99A 3BPFA 3IFUA 5E6JA 3E1ZB 2XU1A 4M0WA 3BY4A 1NLJA 2NQAA 2G8EA 3H7DA 4MI7A 2HD5A 3H8BA 5FPWA 3QT4A 1PADA 1BP4A 3BOWA 4D8IA 3K24A 1GECE 1MS6A 2R9NA 4IUMA 4D8EA 3W30A 2VHSA 4YVAA 3OISA 1KHPA 2FTDA 3CBKA 4BQVA 2GHUA 4K7CA 6PADA 5JH3A 3N3GA 1GCBA 2Y6EA 1SP4B 4YYRA 4RF1A 4RNAA 4G54A 1XKGA 3BWKA 2OP3A 2DC9A 3OVZA 4I04A 5CVNB 4QRVA 2ACTA 1KHQA 2JQFR 4AXLA 4DMYA 1CVZA 4RKXA 3S3QA 2DOSA 3QSDA 1FH0A 1YK7A 2NQGA 4BS5A 4PADA 2PNSA 4MZOA 1F29A 3U8EA 1PVJA 3D6SA 3N4CA 1PXVA 1STFE 3W31A 1TL9A 4IP3A 4PP1A 4Q8HA 2XU5A 4MZSA 1CPJA 5EF4A 1MDWA 4P6GA 2PADA 1AYUA 4YYVA 3RNVA 1ICFA 4QRGA 1NL6A 3ZNHA 1AU0A 2DCBA 2J7QA 2CB5A 1EWLA 3C9EA 4MSXA 2AU1A 1AU3A 1QOLA 2IPPB 2DCAA 1CQDA 1NQCA 1PPPA 5CVOB 1THEA 3B79A 2AUXA 7PCKA 4CZWA 3H6SA 4X6JA 2AYOA 1CTEA 1MEMA 2J7QC 3USVA 3P5WA 2BTWA 4D8BA 3KKUA 2G7YA 3OF8A 4W5BA 2DC7A 2C0YA 3V6EA 3TMPA 3MP2A 1A6RA 2ATOA 2FYEA 1QXPA 3IEJA 1AU4A 4I05A 1EWPA 4CDCB 2BDZA 3PDFA 2P7UA 1VSNA 1K3BB 4HWYA 2FRAA 2PREA 1ME3A 3HD3A 2DJGB 2BDLA 2H7JA 4W4UA 1O0EA 3MORA 1PPDA 2HXZA 5CVMA 3PHUA 5A24A 4QBBA 1NB5A 1GMYA 1ATKA 2OULA 4XR7A 4BSQA 1ME4A 2E02A 4YYWA 3PBHA 2NQIA 1PBHA 1QMYA 2AGAA 3BB7A 4XUIA 3HWNA 3GCBA 2YJ9A 1Y4HA 1AECA 2AIMA 3CBJA 4YYSA 3WXGA 2JTCA 2UZJA 1S4VA 1U9WA 1DEUA 3PHXA 3HHAA 4FK5A 1PIPA 4X6HA 1YZBA 3P5VA 4YYQA 3H89A 2XU3A 1AYVA 1U9QX 4N79A 1AU2A 5JZEA 1TLOA 1JQPA 2R9CA 2JRIA 2ARYA 3MJ5A 4OVZB 3I06A 1IWDA 4BS6A 4P6EA 3F75A 3RVWA 1CSBB 1YK8A 3O0UA 2CIOA 2B1NA 1EF7A 4RY2A 1TU6A 4YYUA 1YVBA 1U9VA 3KFQA 3O1GA 5EGWA 1U9XA 3BBAA 1EWOA 8PCHA 3MTNA 2E00A 1SNKA 2R9OA 4BOUA 3ERVA 1F2AA 3TNXA 3KWZA 1QDQA 2AYNA 2O6XA 2DZZA 1Q6KA 2R6NA 4BOZA 2FO5A 3I3TA 1F2BA 2NQDB 2DCCA 1GLOA 1NPZA 4N4ZA 2Y5BA 1VJVA 2P0RA 3PW3A 2XU4A 3BCNA 4RF0A 1MIRA 3QJ3A 2JQGR 4OEMA 1ZIVA 5PADA 3PHWA 1AYWA 1KFUL 4OELA 3P5XA 5J94A 3PRMA 3ZUAA 2DJFB 4FJCA 2YJCA 2FRQA 1F2CA 4KLBA 2E03A 4PP2E 1YT7A 2DZYA 1CJLA 1CB5A 1NB3A 2DCDA 3KWBX 3KSEA 1BGOA 3N3KA 2G6DA 3B21A 3IHPA 3IOQA 3P5UA 3WXFA 1YALA 2BU3A 4ZUXU 4XZXA 9PAPA 3PT2A 3F5VA 3CH2X 2P86A 3K8UA 4REZA 3C0RA 3DF0A 3E9SA 4BOPA 2YJ2A 1POPA 3BC3A 4I07A 5JA7A 5F02A 1MEGA 3CH3X 2HH5A 1ZCMA 2IBIA 2F7DA 4QRXA 2G8JA 4P16A 1ITOA 1BY8A 4A5UA 4OW0A 2YJBA 4CDEB 4WURA 2R9MA 1KXRA 3OVXA 2Z84A 4AXMA 5K16A 2WBFX 5CHTA 1PE6A 3PNRA 1DKIA 3H8CA 1MHWA 3AI8A 5CHVA 4FIPA 4BPVA 3KW9A 2R9FA 3LXSA 5EZQA 3WXEA 2YJ8A 3RVVA 2FT2A 3MTVA 1UKFA 3IMAA 3S3RA 2BTWB 1Y08A 3PSEA 2F1GA 1M6DA 4WA6A 1HUCB 1U5IA 4X6IA 3OQCA 3IV2A 3IUTA 3PRPA 4BOQA 4W5CA 4R3DA 1CS8A 4CDDB 3TRKA 3KX1A 4YV8A 3BPMA 4PI3A 2FUDA 5KO3A 2B1MA 4N8WA 3NHEA 1EWMA 2FE8A 1PPOA 1DF0A 1BQIA 1PCIA 2HWKA 1X9YA 4CDFB 2DC6A 3MHHA 3MHSA 3OF9A 2AUZA 2DC8A 4BOSA 4OVZA 2GFOA 1KFXL 5EZSA 3V6CA 4DMXA 4HXDB 1AIMA 2FQ9A 2AVWA 3HHIA 3LFYA 4PT5A 2VHFA 4QH6A 2HHNA 1PPNA 4ZTBA 4MM3B 3RVXA 4GUAA 4Q8GA
chains in the Genus database with same CATH topology
2OZ2A 3K9MA 2AS8A 1CV8A 2E01A 2PBHA 3M99A 3BPFA 3E1ZB 2XU1A 1NLJA 2NQAA 2G8EA 3H7DA 2HD5A 3H8BA 5FPWA 3QT4A 1PADA 1BP4A 3BOWA 4C5PA 3K24A 1GECE 1MS6A 2R9NA 2VHSA 4YVAA 3OISA 1KHPA 2FTDA 3CBKA 4BQVA 2GHUA 4K7CA 6PADA 5JH3A 3N3GA 1GCBA 2Y6EA 1SP4B 4YYRA 4G54A 1XKGA 3BWKA 2OP3A 2DC9A 3OVZA 4I04A 5CVNB 4QRVA 2ACTA 1KHQA 2JQFR 4AXLA 4DMYA 1CVZA 3S3QA 3QSDA 1FH0A 1YK7A 2NQGA 4BS5A 4PADA 2PNSA 4MZOA 1F29A 3U8EA 3D6SA 3N4CA 1PXVA 1STFE 1TL9A 4PP1A 4Q8HA 2XU5A 4MZSA 1CPJA 5EF4A 1MDWA 1W6FA 4P6GA 2PADA 1AYUA 4YYVA 1ICFA 4QRGA 1NL6A 1AU0A 2DCBA 2CB5A 1EWLA 3C9EA 4MSXA 2AU1A 1AU3A 1QOLA 2IPPB 2DCAA 1CQDA 1NQCA 1PPPA 5CVOB 1THEA 2VFCA 3B79A 2AUXA 7PCKA 4CZWA 2VFBA 3H6SA 4X6JA 2AYOA 1CTEA 1MEMA 3USVA 3P5WA 3LTWA 3KKUA 2G7YA 3OF8A 4W5BA 2DC7A 2C0YA 3V6EA 1A6RA 2ATOA 2FYEA 1QXPA 3IEJA 1AU4A 4I05A 1EWPA 4BGFA 4CDCB 2BDZA 3PDFA 4GUZA 2P7UA 1VSNA 1K3BB 4HWYA 2FRAA 2PREA 1ME3A 3HD3A 2DJGB 2BDLA 2H7JA 4W4UA 1O0EA 3MORA 1PPDA 2HXZA 5CVMA 5A24A 4QBBA 1NB5A 1GMYA 1ATKA 2OULA 4XR7A 4BSQA 1ME4A 2E02A 4YYWA 3PBHA 2NQIA 1PBHA 1QMYA 4XUIA 3HWNA 3GCBA 2YJ9A 1Y4HA 1AECA 2AIMA 3CBJA 4YYSA 3WXGA 1S4VA 1U9WA 1DEUA 3HHAA 4FK5A 1PIPA 4X6HA 3P5VA 4B55A 4YYQA 3H89A 2XU3A 1AYVA 1U9QX 4N79A 1AU2A 1TLOA 1JQPA 2R9CA 2ARYA 3I06A 1IWDA 4BS6A 4P6EA 3F75A 3RVWA 1CSBB 1YK8A 3O0UA 2CIOA 2B1NA 1EF7A 4RY2A 1TU6A 4YYUA 1YVBA 1U9VA 3KFQA 2BSZA 3O1GA 5EGWA 1U9XA 1EWOA 8PCHA 3MTNA 2E00A 1SNKA 2R9OA 3ERVA 1F2AA 3TNXA 3KWZA 1QDQA 2AYNA 2O6XA 2DZZA 1Q6KA 2R6NA 2FO5A 3I3TA 1F2BA 2NQDB 2DCCA 1GLOA 1NPZA 4N4ZA 2Y5BA 1VJVA 2P0RA 3PW3A 2XU4A 3BCNA 1MIRA 3QJ3A 2JQGR 4OEMA 1ZIVA 5PADA 1AYWA 1KFUL 4OELA 1GX3A 3P5XA 4NV7A 5J94A 3ZUAA 2DJFB 4FJCA 2YJCA 2FRQA 1F2CA 4KLBA 2E03A 4PP2E 1YT7A 2DZYA 1CJLA 1CB5A 1NB3A 2DCDA 3KWBX 3KSEA 1BGOA 3N3KA 2G6DA 3IHPA 3IOQA 3P5UA 3WXFA 1YALA 4ZUXU 9PAPA 3F5VA 3CH2X 2P86A 3K8UA 3D9WA 3DF0A 2YJ2A 1POPA 3BC3A 4I07A 5JA7A 5F02A 1MEGA 3CH3X 2HH5A 1ZCMA 2IBIA 2F7DA 4QRXA 2G8JA 1ITOA 1BY8A 2YJBA 4CDEB 2R9MA 1KXRA 3OVXA 4AXMA 1W5RA 5K16A 2WBFX 5CHTA 1PE6A 3PNRA 3H8CA 1MHWA 3AI8A 5CHVA 4FIPA 4BPVA 3KW9A 2R9FA 3LXSA 3WXEA 2YJ8A 3RVVA 2FT2A 3IMAA 3S3RA 1Y08A 2F1GA 1M6DA 4WA6A 1HUCB 1U5IA 4X6IA 3IV2A 3IUTA 4W5CA 1CS8A 4CDDB 1W4TA 3KX1A 4YV8A 3BPMA 4PI3A 2FUDA 2B1MA 4N8WA 3NHEA 1EWMA 1PPOA 1DF0A 1BQIA 1PCIA 1X9YA 4CDFB 2DC6A 3MHHA 3MHSA 3OF9A 2AUZA 2DC8A 4NV8A 2GFOA 1KFXL 3V6CA 1AIMA 2FQ9A 2AVWA 3HHIA 3LFYA 2VHFA 4QH6A 2HHNA 1PPNA 1E2TA 3RVXA 4DMXA 4Q8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OZ2 A;  3K9M A;  2AS8 A;  1CV8 A;  2E01 A;  2PBH A;  3M99 A;  3BPF A;  3E1Z B;  2XU1 A;  1NLJ A;  2NQA A;  2G8E A;  3H7D A;  2HD5 A;  3H8B A;  5FPW A;  3QT4 A;  1PAD A;  1BP4 A;  3BOW A;  3K24 A;  1GEC E;  1MS6 A;  2R9N A;  2VHS A;  4YVA A;  3OIS A;  1KHP A;  2FTD A;  3CBK A;  4BQV A;  2GHU A;  4K7C A;  6PAD A;  5JH3 A;  3N3G A;  1GCB A;  2Y6E A;  1SP4 B;  4YYR A;  4G54 A;  1XKG A;  3BWK A;  2OP3 A;  2DC9 A;  3OVZ A;  4I04 A;  5CVN B;  4QRV A;  2ACT A;  1KHQ A;  2JQF R;  4AXL A;  4DMY A;  1CVZ A;  3S3Q A;  3QSD A;  1FH0 A;  1YK7 A;  2NQG A;  4BS5 A;  4PAD A;  2PNS A;  4MZO A;  1F29 A;  3U8E A;  3D6S A;  3N4C A;  1PXV A;  1STF E;  1TL9 A;  4PP1 A;  4Q8H A;  2XU5 A;  4MZS A;  1CPJ A;  5EF4 A;  1MDW A;  4P6G A;  2PAD A;  1AYU A;  4YYV A;  1ICF A;  4QRG A;  1NL6 A;  1AU0 A;  2DCB A;  2CB5 A;  1EWL A;  3C9E A;  4MSX A;  2AU1 A;  1AU3 A;  1QOL A;  2IPP B;  2DCA A;  1CQD A;  1NQC A;  1PPP A;  5CVO B;  1THE A;  3B79 A;  2AUX A;  7PCK A;  4CZW A;  3H6S A;  4X6J A;  2AYO A;  1CTE A;  1MEM A;  3USV A;  3P5W A;  3KKU A;  2G7Y A;  3OF8 A;  4W5B A;  2DC7 A;  2C0Y A;  3V6E A;  1A6R A;  2ATO A;  2FYE A;  1QXP A;  3IEJ A;  1AU4 A;  4I05 A;  1EWP A;  4CDC B;  2BDZ A;  3PDF A;  2P7U A;  1VSN A;  1K3B B;  4HWY A;  2FRA A;  2PRE A;  1ME3 A;  3HD3 A;  2DJG B;  2BDL A;  2H7J A;  4W4U A;  1O0E A;  3MOR A;  1PPD A;  2HXZ A;  5CVM A;  5A24 A;  4QBB A;  1NB5 A;  1GMY A;  1ATK A;  2OUL A;  4XR7 A;  4BSQ A;  1ME4 A;  2E02 A;  4YYW A;  3PBH A;  2NQI A;  1PBH A;  1QMY A;  4XUI A;  3HWN A;  3GCB A;  2YJ9 A;  1Y4H A;  1AEC A;  2AIM A;  3CBJ A;  4YYS A;  3WXG A;  1S4V A;  1U9W A;  1DEU A;  3HHA A;  4FK5 A;  1PIP A;  4X6H A;  3P5V A;  4YYQ A;  3H89 A;  2XU3 A;  1AYV A;  1U9Q X;  4N79 A;  1AU2 A;  1TLO A;  1JQP A;  2R9C A;  2ARY A;  3I06 A;  1IWD A;  4BS6 A;  4P6E A;  3F75 A;  3RVW A;  1CSB B;  1YK8 A;  3O0U A;  2CIO A;  2B1N A;  1EF7 A;  4RY2 A;  1TU6 A;  4YYU A;  1YVB A;  1U9V A;  3KFQ A;  3O1G A;  5EGW A;  1U9X A;  1EWO A;  8PCH A;  3MTN A;  2E00 A;  1SNK A;  2R9O A;  3ERV A;  1F2A A;  3TNX A;  3KWZ A;  1QDQ A;  2AYN A;  2O6X A;  2DZZ A;  1Q6K A;  2R6N A;  2FO5 A;  3I3T A;  1F2B A;  2NQD B;  2DCC A;  1GLO A;  1NPZ A;  4N4Z A;  2Y5B A;  1VJV A;  2P0R A;  3PW3 A;  2XU4 A;  3BCN A;  1MIR A;  3QJ3 A;  2JQG R;  4OEM A;  1ZIV A;  5PAD A;  1AYW A;  1KFU L;  4OEL A;  3P5X A;  5J94 A;  3ZUA A;  2DJF B;  4FJC A;  2YJC A;  2FRQ A;  1F2C A;  4KLB A;  2E03 A;  4PP2 E;  1YT7 A;  2DZY A;  1CJL A;  1CB5 A;  1NB3 A;  2DCD A;  3KWB X;  3KSE A;  1BGO A;  3N3K A;  2G6D A;  3IHP A;  3IOQ A;  3P5U A;  3WXF A;  1YAL A;  4ZUX U;  9PAP A;  3F5V A;  3CH2 X;  2P86 A;  3K8U A;  3DF0 A;  2YJ2 A;  1POP A;  3BC3 A;  4I07 A;  5JA7 A;  5F02 A;  1MEG A;  3CH3 X;  2HH5 A;  1ZCM A;  2IBI A;  2F7D A;  4QRX A;  2G8J A;  1ITO A;  1BY8 A;  2YJB A;  4CDE B;  2R9M A;  1KXR A;  3OVX A;  4AXM A;  5K16 A;  2WBF X;  5CHT A;  1PE6 A;  3PNR A;  3H8C A;  1MHW A;  3AI8 A;  5CHV A;  4FIP A;  4BPV A;  3KW9 A;  2R9F A;  3LXS A;  3WXE A;  2YJ8 A;  3RVV A;  2FT2 A;  3IMA A;  3S3R A;  1Y08 A;  2F1G A;  1M6D A;  4WA6 A;  1HUC B;  1U5I A;  4X6I A;  3IV2 A;  3IUT A;  4W5C A;  1CS8 A;  4CDD B;  3KX1 A;  4YV8 A;  3BPM A;  4PI3 A;  2FUD A;  2B1M A;  4N8W A;  3NHE A;  1EWM A;  1PPO A;  1DF0 A;  1BQI A;  1PCI A;  1X9Y A;  4CDF B;  2DC6 A;  3MHH A;  3MHS A;  3OF9 A;  2AUZ A;  2DC8 A;  2GFO A;  1KFX L;  3V6C A;  1AIM A;  2FQ9 A;  2AVW A;  3HHI A;  3LFY A;  2VHF A;  4QH6 A;  2HHN A;  1PPN A;  3RVX A;  4DMX A;  4Q8G A; 
#chains in the Genus database with same CATH topology
 2OZ2 A;  3K9M A;  3O65 A;  2AS8 A;  1CV8 A;  2E01 A;  2PBH A;  3M99 A;  3BPF A;  3IFU A;  5E6J A;  3E1Z B;  2XU1 A;  4M0W A;  3BY4 A;  1NLJ A;  2NQA A;  2G8E A;  3H7D A;  4MI7 A;  2HD5 A;  3H8B A;  5FPW A;  3QT4 A;  1PAD A;  1BP4 A;  3BOW A;  4D8I A;  3K24 A;  1GEC E;  1MS6 A;  2R9N A;  4IUM A;  4D8E A;  3W30 A;  2VHS A;  4YVA A;  3OIS A;  1KHP A;  2FTD A;  3CBK A;  4BQV A;  2GHU A;  4K7C A;  6PAD A;  5JH3 A;  3N3G A;  1GCB A;  2Y6E A;  1SP4 B;  4YYR A;  4RF1 A;  4RNA A;  4G54 A;  1XKG A;  3BWK A;  2OP3 A;  2DC9 A;  3OVZ A;  4I04 A;  5CVN B;  4QRV A;  2ACT A;  1KHQ A;  2JQF R;  4AXL A;  4DMY A;  1CVZ A;  4RKX A;  3S3Q A;  2DOS A;  3QSD A;  1FH0 A;  1YK7 A;  2NQG A;  4BS5 A;  4PAD A;  2PNS A;  4MZO A;  1F29 A;  3U8E A;  1PVJ A;  3D6S A;  3N4C A;  1PXV A;  1STF E;  3W31 A;  1TL9 A;  4IP3 A;  4PP1 A;  4Q8H A;  2XU5 A;  4MZS A;  1CPJ A;  5EF4 A;  1MDW A;  4P6G A;  2PAD A;  1AYU A;  4YYV A;  3RNV A;  1ICF A;  4QRG A;  1NL6 A;  3ZNH A;  1AU0 A;  2DCB A;  2J7Q A;  2CB5 A;  1EWL A;  3C9E A;  4MSX A;  2AU1 A;  1AU3 A;  1QOL A;  2IPP B;  2DCA A;  1CQD A;  1NQC A;  1PPP A;  5CVO B;  1THE A;  3B79 A;  2AUX A;  7PCK A;  4CZW A;  3H6S A;  4X6J A;  2AYO A;  1CTE A;  1MEM A;  2J7Q C;  3USV A;  3P5W A;  2BTW A;  4D8B A;  3KKU A;  2G7Y A;  3OF8 A;  4W5B A;  2DC7 A;  2C0Y A;  3V6E A;  3TMP A;  3MP2 A;  1A6R A;  2ATO A;  2FYE A;  1QXP A;  3IEJ A;  1AU4 A;  4I05 A;  1EWP A;  4CDC B;  2BDZ A;  3PDF A;  2P7U A;  1VSN A;  1K3B B;  4HWY A;  2FRA A;  2PRE A;  1ME3 A;  3HD3 A;  2DJG B;  2BDL A;  2H7J A;  4W4U A;  1O0E A;  3MOR A;  1PPD A;  2HXZ A;  5CVM A;  3PHU A;  5A24 A;  4QBB A;  1NB5 A;  1GMY A;  1ATK A;  2OUL A;  4XR7 A;  4BSQ A;  1ME4 A;  2E02 A;  4YYW A;  3PBH A;  2NQI A;  1PBH A;  1QMY A;  2AGA A;  3BB7 A;  4XUI A;  3HWN A;  3GCB A;  2YJ9 A;  1Y4H A;  1AEC A;  2AIM A;  3CBJ A;  4YYS A;  3WXG A;  2JTC A;  2UZJ A;  1S4V A;  1U9W A;  1DEU A;  3PHX A;  3HHA A;  4FK5 A;  1PIP A;  4X6H A;  1YZB A;  3P5V A;  4YYQ A;  3H89 A;  2XU3 A;  1AYV A;  1U9Q X;  4N79 A;  1AU2 A;  5JZE A;  1TLO A;  1JQP A;  2R9C A;  2JRI A;  2ARY A;  3MJ5 A;  4OVZ B;  3I06 A;  1IWD A;  4BS6 A;  4P6E A;  3F75 A;  3RVW A;  1CSB B;  1YK8 A;  3O0U A;  2CIO A;  2B1N A;  1EF7 A;  4RY2 A;  1TU6 A;  4YYU A;  1YVB A;  1U9V A;  3KFQ A;  3O1G A;  5EGW A;  1U9X A;  3BBA A;  1EWO A;  8PCH A;  3MTN A;  2E00 A;  1SNK A;  2R9O A;  4BOU A;  3ERV A;  1F2A A;  3TNX A;  3KWZ A;  1QDQ A;  2AYN A;  2O6X A;  2DZZ A;  1Q6K A;  2R6N A;  4BOZ A;  2FO5 A;  3I3T A;  1F2B A;  2NQD B;  2DCC A;  1GLO A;  1NPZ A;  4N4Z A;  2Y5B A;  1VJV A;  2P0R A;  3PW3 A;  2XU4 A;  3BCN A;  4RF0 A;  1MIR A;  3QJ3 A;  2JQG R;  4OEM A;  1ZIV A;  5PAD A;  3PHW A;  1AYW A;  1KFU L;  4OEL A;  3P5X A;  5J94 A;  3PRM A;  3ZUA A;  2DJF B;  4FJC A;  2YJC A;  2FRQ A;  1F2C A;  4KLB A;  2E03 A;  4PP2 E;  1YT7 A;  2DZY A;  1CJL A;  1CB5 A;  1NB3 A;  2DCD A;  3KWB X;  3KSE A;  1BGO A;  3N3K A;  2G6D A;  3B21 A;  3IHP A;  3IOQ A;  3P5U A;  3WXF A;  1YAL A;  2BU3 A;  4ZUX U;  4XZX A;  9PAP A;  3PT2 A;  3F5V A;  3CH2 X;  2P86 A;  3K8U A;  4REZ A;  3C0R A;  3DF0 A;  3E9S A;  4BOP A;  2YJ2 A;  1POP A;  3BC3 A;  4I07 A;  5JA7 A;  5F02 A;  1MEG A;  3CH3 X;  2HH5 A;  1ZCM A;  2IBI A;  2F7D A;  4QRX A;  2G8J A;  4P16 A;  1ITO A;  1BY8 A;  4A5U A;  4OW0 A;  2YJB A;  4CDE B;  4WUR A;  2R9M A;  1KXR A;  3OVX A;  2Z84 A;  4AXM A;  5K16 A;  2WBF X;  5CHT A;  1PE6 A;  3PNR A;  1DKI A;  3H8C A;  1MHW A;  3AI8 A;  5CHV A;  4FIP A;  4BPV A;  3KW9 A;  2R9F A;  3LXS A;  5EZQ A;  3WXE A;  2YJ8 A;  3RVV A;  2FT2 A;  3MTV A;  1UKF A;  3IMA A;  3S3R A;  2BTW B;  1Y08 A;  3PSE A;  2F1G A;  1M6D A;  4WA6 A;  1HUC B;  1U5I A;  4X6I A;  3OQC A;  3IV2 A;  3IUT A;  3PRP A;  4BOQ A;  4W5C A;  4R3D A;  1CS8 A;  4CDD B;  3TRK A;  3KX1 A;  4YV8 A;  3BPM A;  4PI3 A;  2FUD A;  5KO3 A;  2B1M A;  4N8W A;  3NHE A;  1EWM A;  2FE8 A;  1PPO A;  1DF0 A;  1BQI A;  1PCI A;  2HWK A;  1X9Y A;  4CDF B;  2DC6 A;  3MHH A;  3MHS A;  3OF9 A;  2AUZ A;  2DC8 A;  4BOS A;  4OVZ A;  2GFO A;  1KFX L;  5EZS A;  3V6C A;  4DMX A;  4HXD B;  1AIM A;  2FQ9 A;  2AVW A;  3HHI A;  3LFY A;  4PT5 A;  2VHF A;  4QH6 A;  2HHN A;  1PPN A;  4ZTB A;  4MM3 B;  3RVX A;  4GUA A;  4Q8G A; 
#chains in the Genus database with same CATH homology
 2OZ2 A;  3K9M A;  2AS8 A;  1CV8 A;  2E01 A;  2PBH A;  3M99 A;  3BPF A;  3E1Z B;  2XU1 A;  1NLJ A;  2NQA A;  2G8E A;  3H7D A;  2HD5 A;  3H8B A;  5FPW A;  3QT4 A;  1PAD A;  1BP4 A;  3BOW A;  4C5P A;  3K24 A;  1GEC E;  1MS6 A;  2R9N A;  2VHS A;  4YVA A;  3OIS A;  1KHP A;  2FTD A;  3CBK A;  4BQV A;  2GHU A;  4K7C A;  6PAD A;  5JH3 A;  3N3G A;  1GCB A;  2Y6E A;  1SP4 B;  4YYR A;  4G54 A;  1XKG A;  3BWK A;  2OP3 A;  2DC9 A;  3OVZ A;  4I04 A;  5CVN B;  4QRV A;  2ACT A;  1KHQ A;  2JQF R;  4AXL A;  4DMY A;  1CVZ A;  3S3Q A;  3QSD A;  1FH0 A;  1YK7 A;  2NQG A;  4BS5 A;  4PAD A;  2PNS A;  4MZO A;  1F29 A;  3U8E A;  3D6S A;  3N4C A;  1PXV A;  1STF E;  1TL9 A;  4PP1 A;  4Q8H A;  2XU5 A;  4MZS A;  1CPJ A;  5EF4 A;  1MDW A;  1W6F A;  4P6G A;  2PAD A;  1AYU A;  4YYV A;  1ICF A;  4QRG A;  1NL6 A;  1AU0 A;  2DCB A;  2CB5 A;  1EWL A;  3C9E A;  4MSX A;  2AU1 A;  1AU3 A;  1QOL A;  2IPP B;  2DCA A;  1CQD A;  1NQC A;  1PPP A;  5CVO B;  1THE A;  2VFC A;  3B79 A;  2AUX A;  7PCK A;  4CZW A;  2VFB A;  3H6S A;  4X6J A;  2AYO A;  1CTE A;  1MEM A;  3USV A;  3P5W A;  3LTW A;  3KKU A;  2G7Y A;  3OF8 A;  4W5B A;  2DC7 A;  2C0Y A;  3V6E A;  1A6R A;  2ATO A;  2FYE A;  1QXP A;  3IEJ A;  1AU4 A;  4I05 A;  1EWP A;  4BGF A;  4CDC B;  2BDZ A;  3PDF A;  4GUZ A;  2P7U A;  1VSN A;  1K3B B;  4HWY A;  2FRA A;  2PRE A;  1ME3 A;  3HD3 A;  2DJG B;  2BDL A;  2H7J A;  4W4U A;  1O0E A;  3MOR A;  1PPD A;  2HXZ A;  5CVM A;  5A24 A;  4QBB A;  1NB5 A;  1GMY A;  1ATK A;  2OUL A;  4XR7 A;  4BSQ A;  1ME4 A;  2E02 A;  4YYW A;  3PBH A;  2NQI A;  1PBH A;  1QMY A;  4XUI A;  3HWN A;  3GCB A;  2YJ9 A;  1Y4H A;  1AEC A;  2AIM A;  3CBJ A;  4YYS A;  3WXG A;  1S4V A;  1U9W A;  1DEU A;  3HHA A;  4FK5 A;  1PIP A;  4X6H A;  3P5V A;  4B55 A;  4YYQ A;  3H89 A;  2XU3 A;  1AYV A;  1U9Q X;  4N79 A;  1AU2 A;  1TLO A;  1JQP A;  2R9C A;  2ARY A;  3I06 A;  1IWD A;  4BS6 A;  4P6E A;  3F75 A;  3RVW A;  1CSB B;  1YK8 A;  3O0U A;  2CIO A;  2B1N A;  1EF7 A;  4RY2 A;  1TU6 A;  4YYU A;  1YVB A;  1U9V A;  3KFQ A;  2BSZ A;  3O1G A;  5EGW A;  1U9X A;  1EWO A;  8PCH A;  3MTN A;  2E00 A;  1SNK A;  2R9O A;  3ERV A;  1F2A A;  3TNX A;  3KWZ A;  1QDQ A;  2AYN A;  2O6X A;  2DZZ A;  1Q6K A;  2R6N A;  2FO5 A;  3I3T A;  1F2B A;  2NQD B;  2DCC A;  1GLO A;  1NPZ A;  4N4Z A;  2Y5B A;  1VJV A;  2P0R A;  3PW3 A;  2XU4 A;  3BCN A;  1MIR A;  3QJ3 A;  2JQG R;  4OEM A;  1ZIV A;  5PAD A;  1AYW A;  1KFU L;  4OEL A;  1GX3 A;  3P5X A;  4NV7 A;  5J94 A;  3ZUA A;  2DJF B;  4FJC A;  2YJC A;  2FRQ A;  1F2C A;  4KLB A;  2E03 A;  4PP2 E;  1YT7 A;  2DZY A;  1CJL A;  1CB5 A;  1NB3 A;  2DCD A;  3KWB X;  3KSE A;  1BGO A;  3N3K A;  2G6D A;  3IHP A;  3IOQ A;  3P5U A;  3WXF A;  1YAL A;  4ZUX U;  9PAP A;  3F5V A;  3CH2 X;  2P86 A;  3K8U A;  3D9W A;  3DF0 A;  2YJ2 A;  1POP A;  3BC3 A;  4I07 A;  5JA7 A;  5F02 A;  1MEG A;  3CH3 X;  2HH5 A;  1ZCM A;  2IBI A;  2F7D A;  4QRX A;  2G8J A;  1ITO A;  1BY8 A;  2YJB A;  4CDE B;  2R9M A;  1KXR A;  3OVX A;  4AXM A;  1W5R A;  5K16 A;  2WBF X;  5CHT A;  1PE6 A;  3PNR A;  3H8C A;  1MHW A;  3AI8 A;  5CHV A;  4FIP A;  4BPV A;  3KW9 A;  2R9F A;  3LXS A;  3WXE A;  2YJ8 A;  3RVV A;  2FT2 A;  3IMA A;  3S3R A;  1Y08 A;  2F1G A;  1M6D A;  4WA6 A;  1HUC B;  1U5I A;  4X6I A;  3IV2 A;  3IUT A;  4W5C A;  1CS8 A;  4CDD B;  1W4T A;  3KX1 A;  4YV8 A;  3BPM A;  4PI3 A;  2FUD A;  2B1M A;  4N8W A;  3NHE A;  1EWM A;  1PPO A;  1DF0 A;  1BQI A;  1PCI A;  1X9Y A;  4CDF B;  2DC6 A;  3MHH A;  3MHS A;  3OF9 A;  2AUZ A;  2DC8 A;  4NV8 A;  2GFO A;  1KFX L;  3V6C A;  1AIM A;  2FQ9 A;  2AVW A;  3HHI A;  3LFY A;  2VHF A;  4QH6 A;  2HHN A;  1PPN A;  1E2T A;  3RVX A;  4DMX A;  4Q8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...