1EWMA

The cysteine protease cruzain bound to wrr-112
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
215
structure length
215
Chain Sequence
b'APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Cruzain bound to WRR-112
rcsb
molecule keywords CRUZAIN
source organism Trypanosoma cruzi
molecule tags Hydrolase/hydrolase inhibitor
total genus 63
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2000-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1ewmA00
3CH3X 3H6SA 3PNRA 4AXMA 1AECA 2AYOA 3BPFA 4PP2E 3H7DA 4WA6A 3IEJA 1CSBB 1DF0A 3BPMA 4XUIA 1YK8A 2BDLA 4X6JA 2XU1A 4W4UA 2P0RA 3N3GA 3HHIA 2YJCA 3ZUAA 1U9WA 1AU2A 4RY2A 3KX1A 2DJFB 3N4CA 1ICFA 1XKGA 1YVBA 4DMYA 1CVZA 5CHTA 4XR7A 1QXPA 4CDCB 3USVA 2R9OA 1ME4A 2NQGA 1EWMA 1AU0A 3HWNA 1PPNA 3H8BA 3QJ3A 1F2BA 4MZOA 3N3KA 3U8EA 1NPZA 3H8CA 2HXZA 2DC9A 3CH2X 4ZUXU 3F5VA 2FRQA 2PADA 3PBHA 1CTEA 3BWKA 3KKUA 2CB5A 2FT2A 1KHPA 2PBHA 5CVNB 1PE6A 3BCNA 6PADA 3P5WA 1BY8A 4Q8GA 1ATKA 2O6XA 3IV2A 2VHFA 2AUZA 4BS5A 2AVWA 1MHWA 2DJGB 4CDEB 3H89A 4YYSA 5JA7A 2FQ9A 2FRAA 5J94A 2DC8A 1PPPA 4QRVA 3P5XA 4I05A 1SNKA 2AIMA 3M99A 2ATOA 2Y5BA 3HD3A 4PP1A 3OF9A 1BGOA 1EWPA 1Q6KA 3O0UA 1BQIA 3NHEA 4N4ZA 4X6IA 2XU4A 3V6CA 2PREA 2R6NA 2E02A 1YALA 5EF4A 2R9NA 2ACTA 2HHNA 3D6SA 4X6HA 1AU4A 5JH3A 1NL6A 1S4VA 4BPVA 1CV8A 2G6DA 2NQAA 3BOWA 1F2AA 1A6RA 5A24A 1AYUA 2FUDA 3KWBX 1CPJA 3OISA 4FK5A 1PCIA 2F1GA 1F29A 3C9EA 3B79A 1CQDA 3I06A 1CJLA 4MSXA 3OVXA 1AU3A 2G8EA 3P5UA 2FTDA 3CBJA 1U9QX 3CBKA 2YJ9A 4W5BA 1AYWA 2HD5A 1YT7A 2YJ8A 3WXFA 1TU6A 4PI3A 4YYRA 5CVMA 1PBHA 2OZ2A 4KLBA 4CDFB 2P7UA 2NQIA 2P86A 2R9MA 2OP3A 1NB3A 3OVZA 3P5VA 2G8JA 2AS8A 2IPPB 4OELA 2B1MA 1PPOA 1ME3A 3QT4A 2DCBA 2NQDB 1NQCA 3ERVA 1NLJA 4QRGA 1THEA 2AU1A 1QOLA 2DZYA 1YK7A 1GCBA 2R9FA 3F75A 1Y08A 5CVOB 2DZZA 4K7CA 2AYNA 3RVWA 1EWOA 2DCDA 1MEMA 4PADA 2HH5A 3OF8A 2DC7A 3WXEA 4FIPA 1PXVA 3BC3A 1BP4A 3HHAA 2WBFX 3K24A 3PDFA 1PPDA 4YVAA 1NB5A 3RVXA 1KFXL 4MZSA 4OEMA 3K8UA 1K3BB 4P6EA 3IOQA 3MTNA 3S3QA 4BS6A 2AUXA 2R9CA 2DCAA 4G54A 2PNSA 1ZIVA 3I3TA 3KFQA 1CB5A 2JQGR 3RVVA 5F02A 1MS6A 1X9YA 2ARYA 3KSEA 2B1NA 4CZWA 4YYUA 2BDZA 9PAPA 2DC6A 1VJVA 1ITOA 3IMAA 1GECE 1DEUA 1PIPA 4N79A 1STFE 1MIRA 4P6GA 3K9MA 3GCBA 4QRXA 4AXLA 2YJBA 7PCKA 5PADA 1TLOA 1AIMA 1PADA 3DF0A 2XU5A 4CDDB 4I07A 4YYQA 3MORA 1U9XA 2VHSA 2C0YA 2H7JA 1SP4B 2OULA 1KXRA 2DCCA 2IBIA 4I04A 4QBBA 1MDWA 8PCHA 1ZCMA 1FH0A 3KWZA 2GFOA 1IWDA 1TL9A 5CHVA 1EF7A 3QSDA 3KW9A 2JQFR 2FYEA 3MHSA 4FJCA 4BQVA 2G7YA 2E01A 3TNXA 5K16A 3O1GA 3IUTA 2XU3A 2YJ2A 1JQPA 2E03A 3LFYA 2Y6EA 2GHUA 1KHQA 4YYVA 4W5CA 3LXSA 1EWLA 3PW3A 2CIOA 1U5IA 3AI8A 4N8WA 1HUCB 1O0EA 1POPA 1KFUL 3MHHA 1AYVA 1VSNA 1GLOA 4HWYA 3WXGA 1M6DA 3V6EA 1QMYA 1Y4HA 4YYWA 2F7DA 4Q8HA 1GMYA 5FPWA 4DMXA 1CS8A 3IHPA 1U9VA 5EGWA 1F2CA 1QDQA 4YV8A 2FO5A 3E1ZB 4BSQA 1MEGA 3S3RA 2E00A 4QH6A
chains in the Genus database with same CATH superfamily
3CH3X 3H6SA 3PNRA 1PVJA 4A5UA 4AXMA 1AECA 2AYOA 3BPFA 4PP2E 3H7DA 4WA6A 3IEJA 1CSBB 1DF0A 3BPMA 4XUIA 1YK8A 4BOPA 2BDLA 4X6JA 2XU1A 4W4UA 2P0RA 3N3GA 3HHIA 2YJCA 3ZUAA 1U9WA 4REZA 1AU2A 4RY2A 3KX1A 2DJFB 3N4CA 1ICFA 2J7QA 1XKGA 1YVBA 3MJ5A 4DMYA 3PHUA 1CVZA 5CHTA 4XR7A 1QXPA 4CDCB 3USVA 2R9OA 1ME4A 2NQGA 1EWMA 1AU0A 3HWNA 1PPNA 3H8BA 3QJ3A 1F2BA 4MZOA 3N3KA 3U8EA 1NPZA 3H8CA 2HXZA 2DC9A 3CH2X 4ZUXU 3F5VA 2FRQA 2PADA 3PBHA 1CTEA 3BWKA 4RNAA 3KKUA 2CB5A 2FT2A 1KHPA 2PBHA 3PRMA 5CVNB 1PE6A 3BCNA 6PADA 4OVZB 3P5WA 1BY8A 4IUMA 4Q8GA 1ATKA 1YZBA 2O6XA 4MI7A 3IV2A 2VHFA 2AUZA 4BS5A 2AVWA 1MHWA 5JZEA 2DJGB 4CDEB 3H89A 4YYSA 3PSEA 3BB7A 3BBAA 5JA7A 2FQ9A 2FRAA 5J94A 2DC8A 3BY4A 1PPPA 4HXDB 3MP2A 4QRVA 3P5XA 4I05A 1SNKA 2AIMA 3M99A 2ATOA 2Y5BA 3HD3A 4PP1A 3OF9A 3W31A 4D8EA 1BGOA 1EWPA 1Q6KA 3O0UA 1BQIA 4P16A 4D8IA 3NHEA 4N4ZA 4X6IA 2XU4A 3V6CA 2JTCA 2PREA 2R6NA 2E02A 1YALA 3OQCA 5EF4A 3TMPA 2JRIA 2R9NA 2ACTA 2HHNA 3D6SA 4X6HA 1AU4A 5JH3A 4ZTBA 1NL6A 1S4VA 4BPVA 1CV8A 2G6DA 2NQAA 3BOWA 4D8BA 1F2AA 1A6RA 5A24A 1AYUA 2FUDA 3PHWA 3KWBX 1CPJA 4RF1A 3OISA 4IP3A 4FK5A 1PCIA 2F1GA 1F29A 3C9EA 3B79A 1CQDA 3I06A 1CJLA 2BTWA 4MSXA 3OVXA 1AU3A 2G8EA 3P5UA 2BU3A 2HWKA 2FTDA 3CBJA 1U9QX 3CBKA 2YJ9A 4W5BA 2DOSA 1AYWA 2HD5A 1YT7A 2YJ8A 3WXFA 1TU6A 4PI3A 4YYRA 4RKXA 5CVMA 1PBHA 2OZ2A 4BOQA 4KLBA 4CDFB 2P7UA 2NQIA 2P86A 2R9MA 3MTVA 2OP3A 1NB3A 3OVZA 3P5VA 2G8JA 2AS8A 2IPPB 4OELA 4PT5A 2B1MA 1PPOA 4MM3B 1ME3A 3QT4A 2DCBA 2NQDB 1NQCA 3ERVA 1NLJA 4QRGA 5EZQA 1THEA 2AU1A 1QOLA 2DZYA 1YK7A 1GCBA 2R9FA 3F75A 1Y08A 5CVOB 2DZZA 4K7CA 4OW0A 4XZXA 2AYNA 3RVWA 1EWOA 2DCDA 1MEMA 4PADA 2HH5A 3OF8A 2Z84A 2DC7A 3WXEA 4FIPA 1PXVA 3BC3A 1BP4A 3HHAA 2WBFX 3K24A 3PDFA 1PPDA 4YVAA 3TRKA 1NB5A 3RVXA 4RF0A 1KFXL 4MZSA 4OEMA 3K8UA 1K3BB 4P6EA 3IOQA 1DKIA 3MTNA 3S3QA 4BS6A 2AUXA 2R9CA 2DCAA 4G54A 4BOUA 2PNSA 1ZIVA 3W30A 4WURA 3I3TA 1UKFA 3KFQA 1CB5A 2JQGR 3RVVA 4BOZA 4BOSA 5F02A 1MS6A 1X9YA 2ARYA 3KSEA 2B1NA 4CZWA 4YYUA 2BDZA 9PAPA 2DC6A 1VJVA 1ITOA 3IMAA 1GECE 1DEUA 1PIPA 4N79A 1STFE 1MIRA 4P6GA 3K9MA 4OVZA 3GCBA 4QRXA 4AXLA 2YJBA 7PCKA 3RNVA 3B21A 5PADA 1TLOA 2AGAA 1AIMA 1PADA 3DF0A 2XU5A 4CDDB 4I07A 4YYQA 3MORA 2BTWB 1U9XA 2VHSA 2C0YA 2H7JA 1SP4B 2OULA 1KXRA 4GUAA 2DCCA 2IBIA 4I04A 4QBBA 1MDWA 3PRPA 8PCHA 1ZCMA 1FH0A 3KWZA 2GFOA 3ZNHA 1IWDA 1TL9A 5CHVA 1EF7A 3QSDA 3KW9A 2JQFR 3MHSA 2FYEA 4FJCA 4BQVA 2G7YA 2E01A 3TNXA 5K16A 3O1GA 3E9SA 3IUTA 2XU3A 2YJ2A 1JQPA 2E03A 3LFYA 3PHXA 2Y6EA 2GHUA 1KHQA 3PT2A 4YYVA 4W5CA 3LXSA 1EWLA 3PW3A 4R3DA 2CIOA 1U5IA 3AI8A 5E6JA 2FE8A 4N8WA 1HUCB 1O0EA 5KO3A 1POPA 5EZSA 2J7QC 1KFUL 3MHHA 1AYVA 1VSNA 1GLOA 4HWYA 3WXGA 1M6DA 3V6EA 1QMYA 1Y4HA 3O65A 4YYWA 2F7DA 4Q8HA 1GMYA 3IFUA 5FPWA 4DMXA 4M0WA 1CS8A 3C0RA 3IHPA 1U9VA 5EGWA 1F2CA 1QDQA 4YV8A 2UZJA 2FO5A 3E1ZB 4BSQA 1MEGA 3S3RA 2E00A 4QH6A
chains in the Genus database with same CATH topology
3CH3X 3H6SA 3PNRA 4AXMA 3LTWA 1AECA 2AYOA 3BPFA 4PP2E 3H7DA 4WA6A 3IEJA 1CSBB 1DF0A 3BPMA 4XUIA 1YK8A 2BDLA 4X6JA 2XU1A 4W4UA 2VFCA 2P0RA 3N3GA 3HHIA 2YJCA 3ZUAA 1U9WA 1AU2A 4RY2A 3KX1A 2DJFB 3N4CA 4NV8A 1ICFA 1XKGA 1YVBA 4DMYA 1CVZA 5CHTA 4XR7A 1QXPA 4CDCB 3USVA 2R9OA 1ME4A 2NQGA 1EWMA 1AU0A 3HWNA 1PPNA 3H8BA 3QJ3A 1F2BA 4MZOA 3N3KA 3U8EA 1NPZA 3H8CA 2HXZA 2DC9A 3CH2X 4ZUXU 3F5VA 2FRQA 2PADA 3PBHA 1CTEA 3BWKA 3KKUA 2CB5A 2FT2A 1KHPA 2PBHA 5CVNB 1PE6A 3BCNA 6PADA 3P5WA 1BY8A 2VFBA 4Q8GA 1ATKA 2O6XA 3IV2A 2VHFA 2AUZA 4BS5A 2AVWA 1MHWA 2DJGB 4CDEB 3H89A 4YYSA 5JA7A 2FQ9A 2FRAA 5J94A 2DC8A 1PPPA 4QRVA 3P5XA 4I05A 1SNKA 2AIMA 3M99A 2ATOA 2Y5BA 3HD3A 4PP1A 3OF9A 1BGOA 1EWPA 1Q6KA 3O0UA 1BQIA 3NHEA 4N4ZA 4X6IA 2XU4A 3V6CA 2PREA 2R6NA 2E02A 1YALA 5EF4A 2R9NA 2ACTA 2HHNA 3D6SA 4X6HA 1AU4A 5JH3A 1NL6A 1S4VA 4BPVA 1CV8A 2G6DA 2NQAA 3BOWA 1F2AA 1A6RA 5A24A 1AYUA 2FUDA 3KWBX 1CPJA 3OISA 4FK5A 1PCIA 2F1GA 1F29A 3C9EA 3B79A 1CQDA 3I06A 1CJLA 4MSXA 3OVXA 1AU3A 2G8EA 3P5UA 2FTDA 3CBJA 1U9QX 3CBKA 2YJ9A 4W5BA 1AYWA 2HD5A 1YT7A 2YJ8A 3WXFA 1TU6A 4PI3A 4YYRA 5CVMA 1PBHA 2OZ2A 4NV7A 4KLBA 4CDFB 2P7UA 2NQIA 2P86A 2R9MA 2OP3A 1W4TA 1NB3A 3OVZA 3P5VA 2G8JA 2AS8A 2IPPB 4OELA 2B1MA 1PPOA 1ME3A 3QT4A 2DCBA 2NQDB 1NQCA 3ERVA 1NLJA 1W6FA 4QRGA 1THEA 2AU1A 1QOLA 2DZYA 1YK7A 1GCBA 2R9FA 1GX3A 3F75A 1Y08A 5CVOB 2DZZA 4K7CA 2AYNA 3RVWA 1EWOA 2DCDA 1MEMA 4PADA 2HH5A 3OF8A 2DC7A 3WXEA 4FIPA 1PXVA 3BC3A 1BP4A 3HHAA 2WBFX 3K24A 3PDFA 1PPDA 4YVAA 1NB5A 3RVXA 4BGFA 1KFXL 4B55A 4MZSA 4OEMA 3K8UA 1K3BB 4P6EA 3IOQA 3MTNA 3S3QA 4BS6A 2AUXA 2R9CA 2DCAA 4G54A 2PNSA 1ZIVA 3I3TA 3KFQA 1CB5A 2JQGR 3RVVA 4C5PA 5F02A 1MS6A 1X9YA 2ARYA 3KSEA 3D9WA 2B1NA 4CZWA 4YYUA 2BDZA 9PAPA 2DC6A 1VJVA 1ITOA 3IMAA 1GECE 1DEUA 1PIPA 4N79A 1STFE 1MIRA 4P6GA 3K9MA 3GCBA 4QRXA 4AXLA 2YJBA 7PCKA 5PADA 1TLOA 1AIMA 1PADA 3DF0A 2XU5A 4CDDB 4I07A 4YYQA 3MORA 1U9XA 2VHSA 2C0YA 2H7JA 1SP4B 2OULA 1KXRA 2BSZA 2DCCA 2IBIA 4I04A 4QBBA 1MDWA 8PCHA 1ZCMA 1FH0A 3KWZA 2GFOA 1IWDA 1TL9A 5CHVA 1EF7A 3QSDA 3KW9A 2JQFR 2FYEA 3MHSA 4FJCA 4BQVA 2G7YA 2E01A 3TNXA 5K16A 3O1GA 3IUTA 2XU3A 2YJ2A 1JQPA 2E03A 3LFYA 2Y6EA 2GHUA 1KHQA 4YYVA 4W5CA 1E2TA 3LXSA 1EWLA 3PW3A 2CIOA 1U5IA 3AI8A 4N8WA 1HUCB 1O0EA 1POPA 1KFUL 3MHHA 1AYVA 1VSNA 1GLOA 4HWYA 3WXGA 1M6DA 3V6EA 1QMYA 1Y4HA 4YYWA 2F7DA 4Q8HA 1GMYA 5FPWA 4DMXA 1CS8A 4GUZA 3IHPA 1W5RA 1U9VA 5EGWA 1F2CA 1QDQA 4YV8A 2FO5A 3E1ZB 4BSQA 1MEGA 3S3RA 2E00A 4QH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CH3 X;  3H6S A;  3PNR A;  4AXM A;  1AEC A;  2AYO A;  3BPF A;  4PP2 E;  3H7D A;  4WA6 A;  3IEJ A;  1CSB B;  1DF0 A;  3BPM A;  4XUI A;  1YK8 A;  2BDL A;  4X6J A;  2XU1 A;  4W4U A;  2P0R A;  3N3G A;  3HHI A;  2YJC A;  3ZUA A;  1U9W A;  1AU2 A;  4RY2 A;  3KX1 A;  2DJF B;  3N4C A;  1ICF A;  1XKG A;  1YVB A;  4DMY A;  1CVZ A;  5CHT A;  4XR7 A;  1QXP A;  4CDC B;  3USV A;  2R9O A;  1ME4 A;  2NQG A;  1EWM A;  1AU0 A;  3HWN A;  1PPN A;  3H8B A;  3QJ3 A;  1F2B A;  4MZO A;  3N3K A;  3U8E A;  1NPZ A;  3H8C A;  2HXZ A;  2DC9 A;  3CH2 X;  4ZUX U;  3F5V A;  2FRQ A;  2PAD A;  3PBH A;  1CTE A;  3BWK A;  3KKU A;  2CB5 A;  2FT2 A;  1KHP A;  2PBH A;  5CVN B;  1PE6 A;  3BCN A;  6PAD A;  3P5W A;  1BY8 A;  4Q8G A;  1ATK A;  2O6X A;  3IV2 A;  2VHF A;  2AUZ A;  4BS5 A;  2AVW A;  1MHW A;  2DJG B;  4CDE B;  3H89 A;  4YYS A;  5JA7 A;  2FQ9 A;  2FRA A;  5J94 A;  2DC8 A;  1PPP A;  4QRV A;  3P5X A;  4I05 A;  1SNK A;  2AIM A;  3M99 A;  2ATO A;  2Y5B A;  3HD3 A;  4PP1 A;  3OF9 A;  1BGO A;  1EWP A;  1Q6K A;  3O0U A;  1BQI A;  3NHE A;  4N4Z A;  4X6I A;  2XU4 A;  3V6C A;  2PRE A;  2R6N A;  2E02 A;  1YAL A;  5EF4 A;  2R9N A;  2ACT A;  2HHN A;  3D6S A;  4X6H A;  1AU4 A;  5JH3 A;  1NL6 A;  1S4V A;  4BPV A;  1CV8 A;  2G6D A;  2NQA A;  3BOW A;  1F2A A;  1A6R A;  5A24 A;  1AYU A;  2FUD A;  3KWB X;  1CPJ A;  3OIS A;  4FK5 A;  1PCI A;  2F1G A;  1F29 A;  3C9E A;  3B79 A;  1CQD A;  3I06 A;  1CJL A;  4MSX A;  3OVX A;  1AU3 A;  2G8E A;  3P5U A;  2FTD A;  3CBJ A;  1U9Q X;  3CBK A;  2YJ9 A;  4W5B A;  1AYW A;  2HD5 A;  1YT7 A;  2YJ8 A;  3WXF A;  1TU6 A;  4PI3 A;  4YYR A;  5CVM A;  1PBH A;  2OZ2 A;  4KLB A;  4CDF B;  2P7U A;  2NQI A;  2P86 A;  2R9M A;  2OP3 A;  1NB3 A;  3OVZ A;  3P5V A;  2G8J A;  2AS8 A;  2IPP B;  4OEL A;  2B1M A;  1PPO A;  1ME3 A;  3QT4 A;  2DCB A;  2NQD B;  1NQC A;  3ERV A;  1NLJ A;  4QRG A;  1THE A;  2AU1 A;  1QOL A;  2DZY A;  1YK7 A;  1GCB A;  2R9F A;  3F75 A;  1Y08 A;  5CVO B;  2DZZ A;  4K7C A;  2AYN A;  3RVW A;  1EWO A;  2DCD A;  1MEM A;  4PAD A;  2HH5 A;  3OF8 A;  2DC7 A;  3WXE A;  4FIP A;  1PXV A;  3BC3 A;  1BP4 A;  3HHA A;  2WBF X;  3K24 A;  3PDF A;  1PPD A;  4YVA A;  1NB5 A;  3RVX A;  1KFX L;  4MZS A;  4OEM A;  3K8U A;  1K3B B;  4P6E A;  3IOQ A;  3MTN A;  3S3Q A;  4BS6 A;  2AUX A;  2R9C A;  2DCA A;  4G54 A;  2PNS A;  1ZIV A;  3I3T A;  3KFQ A;  1CB5 A;  2JQG R;  3RVV A;  5F02 A;  1MS6 A;  1X9Y A;  2ARY A;  3KSE A;  2B1N A;  4CZW A;  4YYU A;  2BDZ A;  9PAP A;  2DC6 A;  1VJV A;  1ITO A;  3IMA A;  1GEC E;  1DEU A;  1PIP A;  4N79 A;  1STF E;  1MIR A;  4P6G A;  3K9M A;  3GCB A;  4QRX A;  4AXL A;  2YJB A;  7PCK A;  5PAD A;  1TLO A;  1AIM A;  1PAD A;  3DF0 A;  2XU5 A;  4CDD B;  4I07 A;  4YYQ A;  3MOR A;  1U9X A;  2VHS A;  2C0Y A;  2H7J A;  1SP4 B;  2OUL A;  1KXR A;  2DCC A;  2IBI A;  4I04 A;  4QBB A;  1MDW A;  8PCH A;  1ZCM A;  1FH0 A;  3KWZ A;  2GFO A;  1IWD A;  1TL9 A;  5CHV A;  1EF7 A;  3QSD A;  3KW9 A;  2JQF R;  2FYE A;  3MHS A;  4FJC A;  4BQV A;  2G7Y A;  2E01 A;  3TNX A;  5K16 A;  3O1G A;  3IUT A;  2XU3 A;  2YJ2 A;  1JQP A;  2E03 A;  3LFY A;  2Y6E A;  2GHU A;  1KHQ A;  4YYV A;  4W5C A;  3LXS A;  1EWL A;  3PW3 A;  2CIO A;  1U5I A;  3AI8 A;  4N8W A;  1HUC B;  1O0E A;  1POP A;  1KFU L;  3MHH A;  1AYV A;  1VSN A;  1GLO A;  4HWY A;  3WXG A;  1M6D A;  3V6E A;  1QMY A;  1Y4H A;  4YYW A;  2F7D A;  4Q8H A;  1GMY A;  5FPW A;  4DMX A;  1CS8 A;  3IHP A;  1U9V A;  5EGW A;  1F2C A;  1QDQ A;  4YV8 A;  2FO5 A;  3E1Z B;  4BSQ A;  1MEG A;  3S3R A;  2E00 A;  4QH6 A; 
#chains in the Genus database with same CATH topology
 3CH3 X;  3H6S A;  3PNR A;  1PVJ A;  4A5U A;  4AXM A;  1AEC A;  2AYO A;  3BPF A;  4PP2 E;  3H7D A;  4WA6 A;  3IEJ A;  1CSB B;  1DF0 A;  3BPM A;  4XUI A;  1YK8 A;  4BOP A;  2BDL A;  4X6J A;  2XU1 A;  4W4U A;  2P0R A;  3N3G A;  3HHI A;  2YJC A;  3ZUA A;  1U9W A;  4REZ A;  1AU2 A;  4RY2 A;  3KX1 A;  2DJF B;  3N4C A;  1ICF A;  2J7Q A;  1XKG A;  1YVB A;  3MJ5 A;  4DMY A;  3PHU A;  1CVZ A;  5CHT A;  4XR7 A;  1QXP A;  4CDC B;  3USV A;  2R9O A;  1ME4 A;  2NQG A;  1EWM A;  1AU0 A;  3HWN A;  1PPN A;  3H8B A;  3QJ3 A;  1F2B A;  4MZO A;  3N3K A;  3U8E A;  1NPZ A;  3H8C A;  2HXZ A;  2DC9 A;  3CH2 X;  4ZUX U;  3F5V A;  2FRQ A;  2PAD A;  3PBH A;  1CTE A;  3BWK A;  4RNA A;  3KKU A;  2CB5 A;  2FT2 A;  1KHP A;  2PBH A;  3PRM A;  5CVN B;  1PE6 A;  3BCN A;  6PAD A;  4OVZ B;  3P5W A;  1BY8 A;  4IUM A;  4Q8G A;  1ATK A;  1YZB A;  2O6X A;  4MI7 A;  3IV2 A;  2VHF A;  2AUZ A;  4BS5 A;  2AVW A;  1MHW A;  5JZE A;  2DJG B;  4CDE B;  3H89 A;  4YYS A;  3PSE A;  3BB7 A;  3BBA A;  5JA7 A;  2FQ9 A;  2FRA A;  5J94 A;  2DC8 A;  3BY4 A;  1PPP A;  4HXD B;  3MP2 A;  4QRV A;  3P5X A;  4I05 A;  1SNK A;  2AIM A;  3M99 A;  2ATO A;  2Y5B A;  3HD3 A;  4PP1 A;  3OF9 A;  3W31 A;  4D8E A;  1BGO A;  1EWP A;  1Q6K A;  3O0U A;  1BQI A;  4P16 A;  4D8I A;  3NHE A;  4N4Z A;  4X6I A;  2XU4 A;  3V6C A;  2JTC A;  2PRE A;  2R6N A;  2E02 A;  1YAL A;  3OQC A;  5EF4 A;  3TMP A;  2JRI A;  2R9N A;  2ACT A;  2HHN A;  3D6S A;  4X6H A;  1AU4 A;  5JH3 A;  4ZTB A;  1NL6 A;  1S4V A;  4BPV A;  1CV8 A;  2G6D A;  2NQA A;  3BOW A;  4D8B A;  1F2A A;  1A6R A;  5A24 A;  1AYU A;  2FUD A;  3PHW A;  3KWB X;  1CPJ A;  4RF1 A;  3OIS A;  4IP3 A;  4FK5 A;  1PCI A;  2F1G A;  1F29 A;  3C9E A;  3B79 A;  1CQD A;  3I06 A;  1CJL A;  2BTW A;  4MSX A;  3OVX A;  1AU3 A;  2G8E A;  3P5U A;  2BU3 A;  2HWK A;  2FTD A;  3CBJ A;  1U9Q X;  3CBK A;  2YJ9 A;  4W5B A;  2DOS A;  1AYW A;  2HD5 A;  1YT7 A;  2YJ8 A;  3WXF A;  1TU6 A;  4PI3 A;  4YYR A;  4RKX A;  5CVM A;  1PBH A;  2OZ2 A;  4BOQ A;  4KLB A;  4CDF B;  2P7U A;  2NQI A;  2P86 A;  2R9M A;  3MTV A;  2OP3 A;  1NB3 A;  3OVZ A;  3P5V A;  2G8J A;  2AS8 A;  2IPP B;  4OEL A;  4PT5 A;  2B1M A;  1PPO A;  4MM3 B;  1ME3 A;  3QT4 A;  2DCB A;  2NQD B;  1NQC A;  3ERV A;  1NLJ A;  4QRG A;  5EZQ A;  1THE A;  2AU1 A;  1QOL A;  2DZY A;  1YK7 A;  1GCB A;  2R9F A;  3F75 A;  1Y08 A;  5CVO B;  2DZZ A;  4K7C A;  4OW0 A;  4XZX A;  2AYN A;  3RVW A;  1EWO A;  2DCD A;  1MEM A;  4PAD A;  2HH5 A;  3OF8 A;  2Z84 A;  2DC7 A;  3WXE A;  4FIP A;  1PXV A;  3BC3 A;  1BP4 A;  3HHA A;  2WBF X;  3K24 A;  3PDF A;  1PPD A;  4YVA A;  3TRK A;  1NB5 A;  3RVX A;  4RF0 A;  1KFX L;  4MZS A;  4OEM A;  3K8U A;  1K3B B;  4P6E A;  3IOQ A;  1DKI A;  3MTN A;  3S3Q A;  4BS6 A;  2AUX A;  2R9C A;  2DCA A;  4G54 A;  4BOU A;  2PNS A;  1ZIV A;  3W30 A;  4WUR A;  3I3T A;  1UKF A;  3KFQ A;  1CB5 A;  2JQG R;  3RVV A;  4BOZ A;  4BOS A;  5F02 A;  1MS6 A;  1X9Y A;  2ARY A;  3KSE A;  2B1N A;  4CZW A;  4YYU A;  2BDZ A;  9PAP A;  2DC6 A;  1VJV A;  1ITO A;  3IMA A;  1GEC E;  1DEU A;  1PIP A;  4N79 A;  1STF E;  1MIR A;  4P6G A;  3K9M A;  4OVZ A;  3GCB A;  4QRX A;  4AXL A;  2YJB A;  7PCK A;  3RNV A;  3B21 A;  5PAD A;  1TLO A;  2AGA A;  1AIM A;  1PAD A;  3DF0 A;  2XU5 A;  4CDD B;  4I07 A;  4YYQ A;  3MOR A;  2BTW B;  1U9X A;  2VHS A;  2C0Y A;  2H7J A;  1SP4 B;  2OUL A;  1KXR A;  4GUA A;  2DCC A;  2IBI A;  4I04 A;  4QBB A;  1MDW A;  3PRP A;  8PCH A;  1ZCM A;  1FH0 A;  3KWZ A;  2GFO A;  3ZNH A;  1IWD A;  1TL9 A;  5CHV A;  1EF7 A;  3QSD A;  3KW9 A;  2JQF R;  3MHS A;  2FYE A;  4FJC A;  4BQV A;  2G7Y A;  2E01 A;  3TNX A;  5K16 A;  3O1G A;  3E9S A;  3IUT A;  2XU3 A;  2YJ2 A;  1JQP A;  2E03 A;  3LFY A;  3PHX A;  2Y6E A;  2GHU A;  1KHQ A;  3PT2 A;  4YYV A;  4W5C A;  3LXS A;  1EWL A;  3PW3 A;  4R3D A;  2CIO A;  1U5I A;  3AI8 A;  5E6J A;  2FE8 A;  4N8W A;  1HUC B;  1O0E A;  5KO3 A;  1POP A;  5EZS A;  2J7Q C;  1KFU L;  3MHH A;  1AYV A;  1VSN A;  1GLO A;  4HWY A;  3WXG A;  1M6D A;  3V6E A;  1QMY A;  1Y4H A;  3O65 A;  4YYW A;  2F7D A;  4Q8H A;  1GMY A;  3IFU A;  5FPW A;  4DMX A;  4M0W A;  1CS8 A;  3C0R A;  3IHP A;  1U9V A;  5EGW A;  1F2C A;  1QDQ A;  4YV8 A;  2UZJ A;  2FO5 A;  3E1Z B;  4BSQ A;  1MEG A;  3S3R A;  2E00 A;  4QH6 A; 
#chains in the Genus database with same CATH homology
 3CH3 X;  3H6S A;  3PNR A;  4AXM A;  3LTW A;  1AEC A;  2AYO A;  3BPF A;  4PP2 E;  3H7D A;  4WA6 A;  3IEJ A;  1CSB B;  1DF0 A;  3BPM A;  4XUI A;  1YK8 A;  2BDL A;  4X6J A;  2XU1 A;  4W4U A;  2VFC A;  2P0R A;  3N3G A;  3HHI A;  2YJC A;  3ZUA A;  1U9W A;  1AU2 A;  4RY2 A;  3KX1 A;  2DJF B;  3N4C A;  4NV8 A;  1ICF A;  1XKG A;  1YVB A;  4DMY A;  1CVZ A;  5CHT A;  4XR7 A;  1QXP A;  4CDC B;  3USV A;  2R9O A;  1ME4 A;  2NQG A;  1EWM A;  1AU0 A;  3HWN A;  1PPN A;  3H8B A;  3QJ3 A;  1F2B A;  4MZO A;  3N3K A;  3U8E A;  1NPZ A;  3H8C A;  2HXZ A;  2DC9 A;  3CH2 X;  4ZUX U;  3F5V A;  2FRQ A;  2PAD A;  3PBH A;  1CTE A;  3BWK A;  3KKU A;  2CB5 A;  2FT2 A;  1KHP A;  2PBH A;  5CVN B;  1PE6 A;  3BCN A;  6PAD A;  3P5W A;  1BY8 A;  2VFB A;  4Q8G A;  1ATK A;  2O6X A;  3IV2 A;  2VHF A;  2AUZ A;  4BS5 A;  2AVW A;  1MHW A;  2DJG B;  4CDE B;  3H89 A;  4YYS A;  5JA7 A;  2FQ9 A;  2FRA A;  5J94 A;  2DC8 A;  1PPP A;  4QRV A;  3P5X A;  4I05 A;  1SNK A;  2AIM A;  3M99 A;  2ATO A;  2Y5B A;  3HD3 A;  4PP1 A;  3OF9 A;  1BGO A;  1EWP A;  1Q6K A;  3O0U A;  1BQI A;  3NHE A;  4N4Z A;  4X6I A;  2XU4 A;  3V6C A;  2PRE A;  2R6N A;  2E02 A;  1YAL A;  5EF4 A;  2R9N A;  2ACT A;  2HHN A;  3D6S A;  4X6H A;  1AU4 A;  5JH3 A;  1NL6 A;  1S4V A;  4BPV A;  1CV8 A;  2G6D A;  2NQA A;  3BOW A;  1F2A A;  1A6R A;  5A24 A;  1AYU A;  2FUD A;  3KWB X;  1CPJ A;  3OIS A;  4FK5 A;  1PCI A;  2F1G A;  1F29 A;  3C9E A;  3B79 A;  1CQD A;  3I06 A;  1CJL A;  4MSX A;  3OVX A;  1AU3 A;  2G8E A;  3P5U A;  2FTD A;  3CBJ A;  1U9Q X;  3CBK A;  2YJ9 A;  4W5B A;  1AYW A;  2HD5 A;  1YT7 A;  2YJ8 A;  3WXF A;  1TU6 A;  4PI3 A;  4YYR A;  5CVM A;  1PBH A;  2OZ2 A;  4NV7 A;  4KLB A;  4CDF B;  2P7U A;  2NQI A;  2P86 A;  2R9M A;  2OP3 A;  1W4T A;  1NB3 A;  3OVZ A;  3P5V A;  2G8J A;  2AS8 A;  2IPP B;  4OEL A;  2B1M A;  1PPO A;  1ME3 A;  3QT4 A;  2DCB A;  2NQD B;  1NQC A;  3ERV A;  1NLJ A;  1W6F A;  4QRG A;  1THE A;  2AU1 A;  1QOL A;  2DZY A;  1YK7 A;  1GCB A;  2R9F A;  1GX3 A;  3F75 A;  1Y08 A;  5CVO B;  2DZZ A;  4K7C A;  2AYN A;  3RVW A;  1EWO A;  2DCD A;  1MEM A;  4PAD A;  2HH5 A;  3OF8 A;  2DC7 A;  3WXE A;  4FIP A;  1PXV A;  3BC3 A;  1BP4 A;  3HHA A;  2WBF X;  3K24 A;  3PDF A;  1PPD A;  4YVA A;  1NB5 A;  3RVX A;  4BGF A;  1KFX L;  4B55 A;  4MZS A;  4OEM A;  3K8U A;  1K3B B;  4P6E A;  3IOQ A;  3MTN A;  3S3Q A;  4BS6 A;  2AUX A;  2R9C A;  2DCA A;  4G54 A;  2PNS A;  1ZIV A;  3I3T A;  3KFQ A;  1CB5 A;  2JQG R;  3RVV A;  4C5P A;  5F02 A;  1MS6 A;  1X9Y A;  2ARY A;  3KSE A;  3D9W A;  2B1N A;  4CZW A;  4YYU A;  2BDZ A;  9PAP A;  2DC6 A;  1VJV A;  1ITO A;  3IMA A;  1GEC E;  1DEU A;  1PIP A;  4N79 A;  1STF E;  1MIR A;  4P6G A;  3K9M A;  3GCB A;  4QRX A;  4AXL A;  2YJB A;  7PCK A;  5PAD A;  1TLO A;  1AIM A;  1PAD A;  3DF0 A;  2XU5 A;  4CDD B;  4I07 A;  4YYQ A;  3MOR A;  1U9X A;  2VHS A;  2C0Y A;  2H7J A;  1SP4 B;  2OUL A;  1KXR A;  2BSZ A;  2DCC A;  2IBI A;  4I04 A;  4QBB A;  1MDW A;  8PCH A;  1ZCM A;  1FH0 A;  3KWZ A;  2GFO A;  1IWD A;  1TL9 A;  5CHV A;  1EF7 A;  3QSD A;  3KW9 A;  2JQF R;  2FYE A;  3MHS A;  4FJC A;  4BQV A;  2G7Y A;  2E01 A;  3TNX A;  5K16 A;  3O1G A;  3IUT A;  2XU3 A;  2YJ2 A;  1JQP A;  2E03 A;  3LFY A;  2Y6E A;  2GHU A;  1KHQ A;  4YYV A;  4W5C A;  1E2T A;  3LXS A;  1EWL A;  3PW3 A;  2CIO A;  1U5I A;  3AI8 A;  4N8W A;  1HUC B;  1O0E A;  1POP A;  1KFU L;  3MHH A;  1AYV A;  1VSN A;  1GLO A;  4HWY A;  3WXG A;  1M6D A;  3V6E A;  1QMY A;  1Y4H A;  4YYW A;  2F7D A;  4Q8H A;  1GMY A;  5FPW A;  4DMX A;  1CS8 A;  4GUZ A;  3IHP A;  1W5R A;  1U9V A;  5EGW A;  1F2C A;  1QDQ A;  4YV8 A;  2FO5 A;  3E1Z B;  4BSQ A;  1MEG A;  3S3R A;  2E00 A;  4QH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...