3H6SA

Structure of clitocypin - cathepsin v complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
221
structure length
220
Chain Sequence
b'LPKSVDWRKKGYVTPVKNQKQCGSWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICKYRPENSVAQDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSDNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin L2
publication title Versatile loops in mycocypins inhibit three protease families.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 70
structure length 220
sequence length 221
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.43: Cathepsin V.
pdb deposition date 2009-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3h6sA00
1KHPA 3OVXA 2E00A 3LXSA 3MORA 1Q6KA 3IEJA 4WA6A 3HD3A 5F02A 1CQDA 3N3GA 4YYVA 2G8JA 2YJBA 3O1GA 3P5WA 3I3TA 1PBHA 1O0EA 1STFE 2F1GA 3F75A 3OF9A 4OELA 3P5XA 4XR7A 3MHHA 3PW3A 5EF4A 4PADA 3H7DA 4N4ZA 4CZWA 1U9VA 1VSNA 2E03A 1ITOA 2DCDA 1POPA 9PAPA 1DEUA 1GCBA 3RVVA 1TU6A 5K16A 4CDFB 1AIMA 5JA7A 3CH3X 1CS8A 3K8UA 2P0RA 3DF0A 4HWYA 3K9MA 3BOWA 2HH5A 1ME4A 2FT2A 4QRXA 3IUTA 2NQAA 3CBKA 2AYOA 3BCNA 3BWKA 3CBJA 4P6GA 4BS6A 5A24A 1MEGA 1YALA 2XU1A 1NB5A 2PBHA 4Q8HA 4BSQA 2G6DA 7PCKA 3P5UA 5FPWA 2C0YA 1U5IA 2DZZA 3PBHA 1XKGA 1HUCB 2FYEA 2FTDA 1EWMA 4PP1A 3OVZA 4G54A 3PDFA 1GLOA 2ATOA 2P86A 1VJVA 1CTEA 1S4VA 1QDQA 1CB5A 2IPPB 4FIPA 2DC6A 4X6JA 2AIMA 2JQGR 4BPVA 3IHPA 1SP4B 3S3QA 1QMYA 3BPMA 2ACTA 2WBFX 3KWZA 3KSEA 5PADA 2IBIA 4YYWA 1PCIA 2VHSA 1PPDA 1ICFA 1PADA 2AYNA 1KXRA 2YJCA 3HHAA 1F2CA 1YT7A 2FRAA 4AXMA 1EF7A 1CJLA 1Y08A 2AU1A 3CH2X 1JQPA 1DF0A 1NPZA 5EGWA 4I04A 3P5VA 3OF8A 2PNSA 2DZYA 4K7CA 2YJ8A 1U9QX 3KX1A 3F5VA 4YYRA 1AU3A 3KKUA 1SNKA 2AUXA 1NL6A 1BGOA 2R9CA 2XU4A 2E01A 3QSDA 4MSXA 3ZUAA 3QT4A 3E1ZB 4I05A 2Y6EA 2OULA 1MIRA 3IMAA 1NLJA 2CB5A 2OZ2A 3MTNA 3H8BA 4RY2A 1U9WA 2GFOA 2H7JA 1KFXL 2NQIA 1IWDA 3KFQA 4DMYA 1KFUL 3BC3A 3H8CA 1F2AA 4CDDB 4PI3A 2Y5BA 3H89A 4AXLA 3BPFA 1BQIA 1EWPA 2FO5A 1EWOA 3NHEA 4YV8A 1QOLA 2R9NA 1ZCMA 1BY8A 4XUIA 2R6NA 3D6SA 3N3KA 2G7YA 4W5BA 2DC9A 1GMYA 1THEA 4MZSA 2AVWA 1FH0A 3M99A 4CDCB 2AS8A 3WXEA 1A6RA 3PNRA 2DC7A 2HD5A 4QH6A 2XU3A 1MS6A 2R9FA 3GCBA 3K24A 3U8EA 4YVAA 3WXFA 2AUZA 1CV8A 1K3BB 1NQCA 3C9EA 2B1MA 2R9MA 3HWNA 4W4UA 2JQFR 1TLOA 4YYSA 4P6EA 1PXVA 4Q8GA 2HXZA 4CDEB 1AU4A 1Y4HA 3V6CA 4N79A 1AYVA 2ARYA 1YVBA 3B79A 3I06A 3RVWA 1AECA 4KLBA 1X9YA 1U9XA 3USVA 1ME3A 5JH3A 1M6DA 3O0UA 2YJ2A 2B1NA 4W5CA 2HHNA 1PE6A 2DCCA 2DC8A 2FUDA 2GHUA 4X6IA 1AU2A 2BDZA 4DMXA 3H6SA 4X6HA 1YK7A 1F29A 2PREA 3LFYA 4FJCA 2YJ9A 5CVMA 3TNXA 3IV2A 1CVZA 1YK8A 3WXGA 3MHSA 2DJFB 1AYUA 2F7DA 2R9OA 3S3RA 1BP4A 4OEMA 3KWBX 6PADA 4ZUXU 2CIOA 3KW9A 3V6EA 5J94A 1PIPA 4QBBA 8PCHA 2DCBA 2NQGA 2E02A 3ERVA 1AYWA 2VHFA 2O6XA 3QJ3A 1F2BA 2PADA 4YYUA 2NQDB 2BDLA 4MZOA 1PPOA 3IOQA 2OP3A 5CHVA 1CSBB 5CHTA 1MHWA 4QRGA 4BS5A 4BQVA 3N4CA 1ATKA 2P7UA 1EWLA 3RVXA 1QXPA 4N8WA 1AU0A 1GECE 2XU5A 3OISA 4PP2E 4FK5A 1TL9A 2DCAA 4YYQA 1NB3A 1CPJA 1ZIVA 5CVOB 2FQ9A 1MEMA 2FRQA 1PPPA 1KHQA 2G8EA 3HHIA 1MDWA 4I07A 4QRVA 2DJGB 1PPNA 3AI8A 5CVNB
chains in the Genus database with same CATH superfamily
1KHPA 3OVXA 3TMPA 2E00A 3LXSA 3MORA 5EZSA 1Q6KA 2DOSA 3IEJA 4WA6A 3HD3A 3PHXA 5F02A 1CQDA 4P16A 3N3GA 1UKFA 4YYVA 2G8JA 2YJBA 3O1GA 2BTWA 3P5WA 3I3TA 1PBHA 1O0EA 3C0RA 1STFE 2F1GA 3F75A 3OF9A 4OELA 3P5XA 4XR7A 3MHHA 3PW3A 5EF4A 4PADA 3H7DA 4N4ZA 4CZWA 1U9VA 5EZQA 1VSNA 3IFUA 2E03A 1ITOA 2DCDA 1POPA 9PAPA 1DEUA 1GCBA 3RVVA 1TU6A 5K16A 4CDFB 1AIMA 5JA7A 3CH3X 1CS8A 3K8UA 3PSEA 2P0RA 4M0WA 3DF0A 4HWYA 3K9MA 4XZXA 3BOWA 2HH5A 3PHWA 4RKXA 1ME4A 2FT2A 4QRXA 3IUTA 2NQAA 4WURA 3CBKA 2AYOA 3BCNA 3BWKA 3CBJA 4P6GA 4BS6A 5A24A 1MEGA 1YALA 2XU1A 1NB5A 2PBHA 4Q8HA 4BSQA 2G6DA 7PCKA 3P5UA 4OVZA 5FPWA 2C0YA 1U5IA 1PVJA 2DZZA 3PBHA 1XKGA 4GUAA 1HUCB 2FYEA 2FTDA 1EWMA 4PP1A 4PT5A 3OVZA 4G54A 3PDFA 1GLOA 2ATOA 2P86A 1VJVA 1CTEA 2AGAA 1S4VA 1QDQA 1CB5A 2IPPB 4FIPA 2DC6A 4X6JA 2AIMA 2JQGR 4BPVA 4D8BA 3IHPA 1SP4B 4IP3A 4D8IA 3S3QA 1QMYA 3BPMA 2ACTA 1DKIA 3TRKA 2WBFX 3KWZA 3KSEA 5PADA 3OQCA 2IBIA 3BY4A 4YYWA 1PCIA 2VHSA 1PPDA 1ICFA 1PADA 2AYNA 1KXRA 2YJCA 3HHAA 1F2CA 1YT7A 2JTCA 4BOQA 2FRAA 4AXMA 4OVZB 1EF7A 1CJLA 1Y08A 2AU1A 3CH2X 4BOUA 1JQPA 1DF0A 1NPZA 5EGWA 4I04A 3P5VA 3OF8A 2PNSA 2DZYA 4K7CA 2YJ8A 1U9QX 3KX1A 3F5VA 5CVNB 4YYRA 1AU3A 3KKUA 1SNKA 2AUXA 1NL6A 1BGOA 2R9CA 2XU4A 2E01A 3QSDA 4MSXA 3ZUAA 3QT4A 3E1ZB 3MTVA 4I05A 2Y6EA 2OULA 1MIRA 3IMAA 1NLJA 2CB5A 2OZ2A 3MTNA 3H8BA 4RY2A 1U9WA 2GFOA 2H7JA 1KFXL 2HWKA 2NQIA 1IWDA 3KFQA 4DMYA 1KFUL 3BC3A 3H8CA 1F2AA 4CDDB 4PI3A 2Y5BA 3H89A 4AXLA 3BPFA 1BQIA 1EWPA 2FO5A 1EWOA 3NHEA 4YV8A 1QOLA 2R9NA 1ZCMA 1BY8A 4OW0A 4XUIA 2R6NA 3D6SA 3N3KA 2G7YA 4W5BA 4A5UA 2DC9A 1GMYA 1THEA 4MZSA 2AVWA 1FH0A 3M99A 4CDCB 2AS8A 3WXEA 1A6RA 3PNRA 2DC7A 3PT2A 2HD5A 5JZEA 4BOSA 3BB7A 3B21A 4QH6A 2XU3A 3W31A 1MS6A 2J7QC 2R9FA 3GCBA 3K24A 3U8EA 4YVAA 4MM3B 3WXFA 2AUZA 1CV8A 1K3BB 1NQCA 3C9EA 2B1MA 2R9MA 3HWNA 4W4UA 2JQFR 1TLOA 4YYSA 4P6EA 1PXVA 4Q8GA 2HXZA 4CDEB 1AU4A 1YZBA 3PRMA 1Y4HA 3RNVA 3V6CA 4N79A 1AYVA 2ARYA 1YVBA 3B79A 3I06A 3RVWA 1AECA 4KLBA 1X9YA 1U9XA 2JRIA 3USVA 1ME3A 5JH3A 1M6DA 3O0UA 2YJ2A 4IUMA 3PRPA 2B1NA 4R3DA 4W5CA 2HHNA 1PE6A 2DCCA 2DC8A 4MI7A 2FUDA 2GHUA 4BOZA 4X6IA 1AU2A 3MJ5A 2BDZA 4DMXA 3H6SA 4X6HA 1YK7A 1F29A 5E6JA 2PREA 3LFYA 4FJCA 2J7QA 2YJ9A 5CVMA 5KO3A 3TNXA 3IV2A 1CVZA 4RF1A 1YK8A 3WXGA 3MHSA 2DJFB 1AYUA 2F7DA 2R9OA 3S3RA 1BP4A 4OEMA 3KWBX 4RNAA 3BBAA 6PADA 4ZUXU 2CIOA 3KW9A 3V6EA 5J94A 1PIPA 4QBBA 4BOPA 8PCHA 2DCBA 2NQGA 2E02A 3ERVA 1AYWA 4D8EA 2UZJA 2VHFA 2O6XA 3QJ3A 1F2BA 2BTWB 2PADA 4YYUA 2NQDB 4RF0A 2BDLA 4MZOA 1PPOA 3IOQA 2OP3A 4REZA 5CHVA 3MP2A 1CSBB 5CHTA 1MHWA 4QRGA 3E9SA 3PHUA 4BS5A 4BQVA 3N4CA 1ATKA 2P7UA 1EWLA 3RVXA 1QXPA 4ZTBA 3ZNHA 4N8WA 1AU0A 1GECE 2XU5A 3OISA 4PP2E 4FK5A 1TL9A 2DCAA 4YYQA 1NB3A 1CPJA 1ZIVA 2FE8A 3O65A 5CVOB 2FQ9A 1MEMA 2FRQA 1PPPA 1KHQA 2G8EA 3HHIA 3W30A 1MDWA 4I07A 4QRVA 2DJGB 1PPNA 2Z84A 3AI8A 2BU3A 4HXDB
chains in the Genus database with same CATH topology
1KHPA 3OVXA 2E00A 3LXSA 3MORA 1Q6KA 3IEJA 4WA6A 3HD3A 5F02A 1CQDA 3N3GA 4BGFA 4YYVA 2G8JA 2YJBA 3O1GA 3P5WA 3I3TA 1PBHA 1O0EA 1STFE 2F1GA 3F75A 3OF9A 4OELA 3P5XA 4XR7A 3MHHA 3PW3A 5EF4A 4PADA 3H7DA 4N4ZA 4CZWA 1U9VA 1VSNA 2E03A 1ITOA 2DCDA 1POPA 9PAPA 1DEUA 1GCBA 3RVVA 1TU6A 5K16A 4CDFB 1AIMA 5JA7A 3CH3X 1CS8A 3K8UA 2P0RA 3DF0A 4HWYA 3K9MA 3BOWA 2HH5A 1ME4A 2FT2A 4QRXA 3IUTA 2NQAA 3CBKA 2AYOA 3BCNA 3BWKA 3CBJA 4P6GA 4BS6A 5A24A 1MEGA 1YALA 2XU1A 1GX3A 1NB5A 2PBHA 4Q8HA 4BSQA 2G6DA 7PCKA 3P5UA 5FPWA 2C0YA 1U5IA 2DZZA 3PBHA 1XKGA 1HUCB 2FYEA 2FTDA 1EWMA 4PP1A 3OVZA 4G54A 3PDFA 1GLOA 2ATOA 2P86A 1VJVA 1CTEA 1S4VA 1QDQA 1CB5A 2IPPB 4FIPA 2DC6A 4X6JA 2AIMA 2JQGR 4BPVA 3IHPA 1SP4B 3S3QA 1QMYA 3BPMA 2ACTA 2WBFX 3KWZA 3KSEA 5PADA 2IBIA 4YYWA 1PCIA 2VHSA 1PPDA 1ICFA 1PADA 2AYNA 1KXRA 2YJCA 3HHAA 1F2CA 1YT7A 4NV7A 2FRAA 4AXMA 3LTWA 1EF7A 1CJLA 1Y08A 2AU1A 3CH2X 1JQPA 1DF0A 1NPZA 5EGWA 4I04A 3P5VA 3OF8A 2PNSA 2DZYA 4K7CA 2YJ8A 4C5PA 1U9QX 3KX1A 3F5VA 4YYRA 1AU3A 3KKUA 1SNKA 2AUXA 1NL6A 1BGOA 2R9CA 2XU4A 2E01A 3QSDA 4MSXA 3ZUAA 3QT4A 3E1ZB 4I05A 2Y6EA 2OULA 1MIRA 3IMAA 1NLJA 2CB5A 2OZ2A 3MTNA 3H8BA 4RY2A 1U9WA 2GFOA 2H7JA 1KFXL 2NQIA 1IWDA 3KFQA 4DMYA 1E2TA 1KFUL 3BC3A 3H8CA 2VFCA 1F2AA 4CDDB 4PI3A 2Y5BA 3H89A 4AXLA 3BPFA 1BQIA 1EWPA 1W4TA 2FO5A 1EWOA 3NHEA 2BSZA 4YV8A 1QOLA 2R9NA 1ZCMA 1BY8A 4XUIA 2R6NA 3D6SA 3N3KA 2G7YA 1W6FA 4W5BA 2DC9A 1GMYA 1THEA 4MZSA 2AVWA 1FH0A 3M99A 2VFBA 4CDCB 2AS8A 3WXEA 1A6RA 3PNRA 2DC7A 2HD5A 4QH6A 2XU3A 1MS6A 2R9FA 3GCBA 3K24A 3U8EA 4YVAA 3WXFA 2AUZA 1CV8A 1K3BB 1NQCA 3C9EA 2B1MA 2R9MA 3HWNA 4W4UA 2JQFR 1TLOA 4YYSA 4P6EA 1PXVA 4Q8GA 2HXZA 4CDEB 1AU4A 1Y4HA 3V6CA 4N79A 1AYVA 2ARYA 1YVBA 3B79A 3I06A 3RVWA 1AECA 4KLBA 1X9YA 1U9XA 3USVA 1ME3A 5JH3A 1M6DA 3O0UA 2YJ2A 2B1NA 3D9WA 4W5CA 2HHNA 1PE6A 4NV8A 2DCCA 2DC8A 2FUDA 2GHUA 4X6IA 1AU2A 2BDZA 4DMXA 3H6SA 4X6HA 1YK7A 1F29A 2PREA 3LFYA 4FJCA 2YJ9A 5CVMA 3TNXA 3IV2A 1CVZA 1YK8A 3WXGA 3MHSA 2DJFB 1AYUA 2F7DA 2R9OA 3S3RA 1BP4A 4OEMA 3KWBX 6PADA 4ZUXU 2CIOA 3KW9A 3V6EA 5J94A 1PIPA 4QBBA 4B55A 8PCHA 2DCBA 2NQGA 2E02A 3ERVA 1AYWA 2VHFA 2O6XA 3QJ3A 1F2BA 2PADA 4YYUA 1W5RA 2NQDB 2BDLA 4MZOA 1PPOA 3IOQA 2OP3A 5CHVA 1CSBB 5CHTA 1MHWA 4QRGA 4BS5A 4BQVA 3N4CA 4GUZA 1ATKA 2P7UA 1EWLA 3RVXA 1QXPA 4N8WA 1AU0A 1GECE 2XU5A 3OISA 4PP2E 4FK5A 1TL9A 2DCAA 4YYQA 1NB3A 1CPJA 1ZIVA 5CVOB 2FQ9A 1MEMA 2FRQA 1PPPA 1KHQA 2G8EA 3HHIA 1MDWA 4I07A 4QRVA 2DJGB 1PPNA 3AI8A 5CVNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KHP A;  3OVX A;  2E00 A;  3LXS A;  3MOR A;  1Q6K A;  3IEJ A;  4WA6 A;  3HD3 A;  5F02 A;  1CQD A;  3N3G A;  4YYV A;  2G8J A;  2YJB A;  3O1G A;  3P5W A;  3I3T A;  1PBH A;  1O0E A;  1STF E;  2F1G A;  3F75 A;  3OF9 A;  4OEL A;  3P5X A;  4XR7 A;  3MHH A;  3PW3 A;  5EF4 A;  4PAD A;  3H7D A;  4N4Z A;  4CZW A;  1U9V A;  1VSN A;  2E03 A;  1ITO A;  2DCD A;  1POP A;  9PAP A;  1DEU A;  1GCB A;  3RVV A;  1TU6 A;  5K16 A;  4CDF B;  1AIM A;  5JA7 A;  3CH3 X;  1CS8 A;  3K8U A;  2P0R A;  3DF0 A;  4HWY A;  3K9M A;  3BOW A;  2HH5 A;  1ME4 A;  2FT2 A;  4QRX A;  3IUT A;  2NQA A;  3CBK A;  2AYO A;  3BCN A;  3BWK A;  3CBJ A;  4P6G A;  4BS6 A;  5A24 A;  1MEG A;  1YAL A;  2XU1 A;  1NB5 A;  2PBH A;  4Q8H A;  4BSQ A;  2G6D A;  7PCK A;  3P5U A;  5FPW A;  2C0Y A;  1U5I A;  2DZZ A;  3PBH A;  1XKG A;  1HUC B;  2FYE A;  2FTD A;  1EWM A;  4PP1 A;  3OVZ A;  4G54 A;  3PDF A;  1GLO A;  2ATO A;  2P86 A;  1VJV A;  1CTE A;  1S4V A;  1QDQ A;  1CB5 A;  2IPP B;  4FIP A;  2DC6 A;  4X6J A;  2AIM A;  2JQG R;  4BPV A;  3IHP A;  1SP4 B;  3S3Q A;  1QMY A;  3BPM A;  2ACT A;  2WBF X;  3KWZ A;  3KSE A;  5PAD A;  2IBI A;  4YYW A;  1PCI A;  2VHS A;  1PPD A;  1ICF A;  1PAD A;  2AYN A;  1KXR A;  2YJC A;  3HHA A;  1F2C A;  1YT7 A;  2FRA A;  4AXM A;  1EF7 A;  1CJL A;  1Y08 A;  2AU1 A;  3CH2 X;  1JQP A;  1DF0 A;  1NPZ A;  5EGW A;  4I04 A;  3P5V A;  3OF8 A;  2PNS A;  2DZY A;  4K7C A;  2YJ8 A;  1U9Q X;  3KX1 A;  3F5V A;  4YYR A;  1AU3 A;  3KKU A;  1SNK A;  2AUX A;  1NL6 A;  1BGO A;  2R9C A;  2XU4 A;  2E01 A;  3QSD A;  4MSX A;  3ZUA A;  3QT4 A;  3E1Z B;  4I05 A;  2Y6E A;  2OUL A;  1MIR A;  3IMA A;  1NLJ A;  2CB5 A;  2OZ2 A;  3MTN A;  3H8B A;  4RY2 A;  1U9W A;  2GFO A;  2H7J A;  1KFX L;  2NQI A;  1IWD A;  3KFQ A;  4DMY A;  1KFU L;  3BC3 A;  3H8C A;  1F2A A;  4CDD B;  4PI3 A;  2Y5B A;  3H89 A;  4AXL A;  3BPF A;  1BQI A;  1EWP A;  2FO5 A;  1EWO A;  3NHE A;  4YV8 A;  1QOL A;  2R9N A;  1ZCM A;  1BY8 A;  4XUI A;  2R6N A;  3D6S A;  3N3K A;  2G7Y A;  4W5B A;  2DC9 A;  1GMY A;  1THE A;  4MZS A;  2AVW A;  1FH0 A;  3M99 A;  4CDC B;  2AS8 A;  3WXE A;  1A6R A;  3PNR A;  2DC7 A;  2HD5 A;  4QH6 A;  2XU3 A;  1MS6 A;  2R9F A;  3GCB A;  3K24 A;  3U8E A;  4YVA A;  3WXF A;  2AUZ A;  1CV8 A;  1K3B B;  1NQC A;  3C9E A;  2B1M A;  2R9M A;  3HWN A;  4W4U A;  2JQF R;  1TLO A;  4YYS A;  4P6E A;  1PXV A;  4Q8G A;  2HXZ A;  4CDE B;  1AU4 A;  1Y4H A;  3V6C A;  4N79 A;  1AYV A;  2ARY A;  1YVB A;  3B79 A;  3I06 A;  3RVW A;  1AEC A;  4KLB A;  1X9Y A;  1U9X A;  3USV A;  1ME3 A;  5JH3 A;  1M6D A;  3O0U A;  2YJ2 A;  2B1N A;  4W5C A;  2HHN A;  1PE6 A;  2DCC A;  2DC8 A;  2FUD A;  2GHU A;  4X6I A;  1AU2 A;  2BDZ A;  4DMX A;  3H6S A;  4X6H A;  1YK7 A;  1F29 A;  2PRE A;  3LFY A;  4FJC A;  2YJ9 A;  5CVM A;  3TNX A;  3IV2 A;  1CVZ A;  1YK8 A;  3WXG A;  3MHS A;  2DJF B;  1AYU A;  2F7D A;  2R9O A;  3S3R A;  1BP4 A;  4OEM A;  3KWB X;  6PAD A;  4ZUX U;  2CIO A;  3KW9 A;  3V6E A;  5J94 A;  1PIP A;  4QBB A;  8PCH A;  2DCB A;  2NQG A;  2E02 A;  3ERV A;  1AYW A;  2VHF A;  2O6X A;  3QJ3 A;  1F2B A;  2PAD A;  4YYU A;  2NQD B;  2BDL A;  4MZO A;  1PPO A;  3IOQ A;  2OP3 A;  5CHV A;  1CSB B;  5CHT A;  1MHW A;  4QRG A;  4BS5 A;  4BQV A;  3N4C A;  1ATK A;  2P7U A;  1EWL A;  3RVX A;  1QXP A;  4N8W A;  1AU0 A;  1GEC E;  2XU5 A;  3OIS A;  4PP2 E;  4FK5 A;  1TL9 A;  2DCA A;  4YYQ A;  1NB3 A;  1CPJ A;  1ZIV A;  5CVO B;  2FQ9 A;  1MEM A;  2FRQ A;  1PPP A;  1KHQ A;  2G8E A;  3HHI A;  1MDW A;  4I07 A;  4QRV A;  2DJG B;  1PPN A;  3AI8 A;  5CVN B; 
#chains in the Genus database with same CATH topology
 1KHP A;  3OVX A;  3TMP A;  2E00 A;  3LXS A;  3MOR A;  5EZS A;  1Q6K A;  2DOS A;  3IEJ A;  4WA6 A;  3HD3 A;  3PHX A;  5F02 A;  1CQD A;  4P16 A;  3N3G A;  1UKF A;  4YYV A;  2G8J A;  2YJB A;  3O1G A;  2BTW A;  3P5W A;  3I3T A;  1PBH A;  1O0E A;  3C0R A;  1STF E;  2F1G A;  3F75 A;  3OF9 A;  4OEL A;  3P5X A;  4XR7 A;  3MHH A;  3PW3 A;  5EF4 A;  4PAD A;  3H7D A;  4N4Z A;  4CZW A;  1U9V A;  5EZQ A;  1VSN A;  3IFU A;  2E03 A;  1ITO A;  2DCD A;  1POP A;  9PAP A;  1DEU A;  1GCB A;  3RVV A;  1TU6 A;  5K16 A;  4CDF B;  1AIM A;  5JA7 A;  3CH3 X;  1CS8 A;  3K8U A;  3PSE A;  2P0R A;  4M0W A;  3DF0 A;  4HWY A;  3K9M A;  4XZX A;  3BOW A;  2HH5 A;  3PHW A;  4RKX A;  1ME4 A;  2FT2 A;  4QRX A;  3IUT A;  2NQA A;  4WUR A;  3CBK A;  2AYO A;  3BCN A;  3BWK A;  3CBJ A;  4P6G A;  4BS6 A;  5A24 A;  1MEG A;  1YAL A;  2XU1 A;  1NB5 A;  2PBH A;  4Q8H A;  4BSQ A;  2G6D A;  7PCK A;  3P5U A;  4OVZ A;  5FPW A;  2C0Y A;  1U5I A;  1PVJ A;  2DZZ A;  3PBH A;  1XKG A;  4GUA A;  1HUC B;  2FYE A;  2FTD A;  1EWM A;  4PP1 A;  4PT5 A;  3OVZ A;  4G54 A;  3PDF A;  1GLO A;  2ATO A;  2P86 A;  1VJV A;  1CTE A;  2AGA A;  1S4V A;  1QDQ A;  1CB5 A;  2IPP B;  4FIP A;  2DC6 A;  4X6J A;  2AIM A;  2JQG R;  4BPV A;  4D8B A;  3IHP A;  1SP4 B;  4IP3 A;  4D8I A;  3S3Q A;  1QMY A;  3BPM A;  2ACT A;  1DKI A;  3TRK A;  2WBF X;  3KWZ A;  3KSE A;  5PAD A;  3OQC A;  2IBI A;  3BY4 A;  4YYW A;  1PCI A;  2VHS A;  1PPD A;  1ICF A;  1PAD A;  2AYN A;  1KXR A;  2YJC A;  3HHA A;  1F2C A;  1YT7 A;  2JTC A;  4BOQ A;  2FRA A;  4AXM A;  4OVZ B;  1EF7 A;  1CJL A;  1Y08 A;  2AU1 A;  3CH2 X;  4BOU A;  1JQP A;  1DF0 A;  1NPZ A;  5EGW A;  4I04 A;  3P5V A;  3OF8 A;  2PNS A;  2DZY A;  4K7C A;  2YJ8 A;  1U9Q X;  3KX1 A;  3F5V A;  5CVN B;  4YYR A;  1AU3 A;  3KKU A;  1SNK A;  2AUX A;  1NL6 A;  1BGO A;  2R9C A;  2XU4 A;  2E01 A;  3QSD A;  4MSX A;  3ZUA A;  3QT4 A;  3E1Z B;  3MTV A;  4I05 A;  2Y6E A;  2OUL A;  1MIR A;  3IMA A;  1NLJ A;  2CB5 A;  2OZ2 A;  3MTN A;  3H8B A;  4RY2 A;  1U9W A;  2GFO A;  2H7J A;  1KFX L;  2HWK A;  2NQI A;  1IWD A;  3KFQ A;  4DMY A;  1KFU L;  3BC3 A;  3H8C A;  1F2A A;  4CDD B;  4PI3 A;  2Y5B A;  3H89 A;  4AXL A;  3BPF A;  1BQI A;  1EWP A;  2FO5 A;  1EWO A;  3NHE A;  4YV8 A;  1QOL A;  2R9N A;  1ZCM A;  1BY8 A;  4OW0 A;  4XUI A;  2R6N A;  3D6S A;  3N3K A;  2G7Y A;  4W5B A;  4A5U A;  2DC9 A;  1GMY A;  1THE A;  4MZS A;  2AVW A;  1FH0 A;  3M99 A;  4CDC B;  2AS8 A;  3WXE A;  1A6R A;  3PNR A;  2DC7 A;  3PT2 A;  2HD5 A;  5JZE A;  4BOS A;  3BB7 A;  3B21 A;  4QH6 A;  2XU3 A;  3W31 A;  1MS6 A;  2J7Q C;  2R9F A;  3GCB A;  3K24 A;  3U8E A;  4YVA A;  4MM3 B;  3WXF A;  2AUZ A;  1CV8 A;  1K3B B;  1NQC A;  3C9E A;  2B1M A;  2R9M A;  3HWN A;  4W4U A;  2JQF R;  1TLO A;  4YYS A;  4P6E A;  1PXV A;  4Q8G A;  2HXZ A;  4CDE B;  1AU4 A;  1YZB A;  3PRM A;  1Y4H A;  3RNV A;  3V6C A;  4N79 A;  1AYV A;  2ARY A;  1YVB A;  3B79 A;  3I06 A;  3RVW A;  1AEC A;  4KLB A;  1X9Y A;  1U9X A;  2JRI A;  3USV A;  1ME3 A;  5JH3 A;  1M6D A;  3O0U A;  2YJ2 A;  4IUM A;  3PRP A;  2B1N A;  4R3D A;  4W5C A;  2HHN A;  1PE6 A;  2DCC A;  2DC8 A;  4MI7 A;  2FUD A;  2GHU A;  4BOZ A;  4X6I A;  1AU2 A;  3MJ5 A;  2BDZ A;  4DMX A;  3H6S A;  4X6H A;  1YK7 A;  1F29 A;  5E6J A;  2PRE A;  3LFY A;  4FJC A;  2J7Q A;  2YJ9 A;  5CVM A;  5KO3 A;  3TNX A;  3IV2 A;  1CVZ A;  4RF1 A;  1YK8 A;  3WXG A;  3MHS A;  2DJF B;  1AYU A;  2F7D A;  2R9O A;  3S3R A;  1BP4 A;  4OEM A;  3KWB X;  4RNA A;  3BBA A;  6PAD A;  4ZUX U;  2CIO A;  3KW9 A;  3V6E A;  5J94 A;  1PIP A;  4QBB A;  4BOP A;  8PCH A;  2DCB A;  2NQG A;  2E02 A;  3ERV A;  1AYW A;  4D8E A;  2UZJ A;  2VHF A;  2O6X A;  3QJ3 A;  1F2B A;  2BTW B;  2PAD A;  4YYU A;  2NQD B;  4RF0 A;  2BDL A;  4MZO A;  1PPO A;  3IOQ A;  2OP3 A;  4REZ A;  5CHV A;  3MP2 A;  1CSB B;  5CHT A;  1MHW A;  4QRG A;  3E9S A;  3PHU A;  4BS5 A;  4BQV A;  3N4C A;  1ATK A;  2P7U A;  1EWL A;  3RVX A;  1QXP A;  4ZTB A;  3ZNH A;  4N8W A;  1AU0 A;  1GEC E;  2XU5 A;  3OIS A;  4PP2 E;  4FK5 A;  1TL9 A;  2DCA A;  4YYQ A;  1NB3 A;  1CPJ A;  1ZIV A;  2FE8 A;  3O65 A;  5CVO B;  2FQ9 A;  1MEM A;  2FRQ A;  1PPP A;  1KHQ A;  2G8E A;  3HHI A;  3W30 A;  1MDW A;  4I07 A;  4QRV A;  2DJG B;  1PPN A;  2Z84 A;  3AI8 A;  2BU3 A;  4HXD B; 
#chains in the Genus database with same CATH homology
 1KHP A;  3OVX A;  2E00 A;  3LXS A;  3MOR A;  1Q6K A;  3IEJ A;  4WA6 A;  3HD3 A;  5F02 A;  1CQD A;  3N3G A;  4BGF A;  4YYV A;  2G8J A;  2YJB A;  3O1G A;  3P5W A;  3I3T A;  1PBH A;  1O0E A;  1STF E;  2F1G A;  3F75 A;  3OF9 A;  4OEL A;  3P5X A;  4XR7 A;  3MHH A;  3PW3 A;  5EF4 A;  4PAD A;  3H7D A;  4N4Z A;  4CZW A;  1U9V A;  1VSN A;  2E03 A;  1ITO A;  2DCD A;  1POP A;  9PAP A;  1DEU A;  1GCB A;  3RVV A;  1TU6 A;  5K16 A;  4CDF B;  1AIM A;  5JA7 A;  3CH3 X;  1CS8 A;  3K8U A;  2P0R A;  3DF0 A;  4HWY A;  3K9M A;  3BOW A;  2HH5 A;  1ME4 A;  2FT2 A;  4QRX A;  3IUT A;  2NQA A;  3CBK A;  2AYO A;  3BCN A;  3BWK A;  3CBJ A;  4P6G A;  4BS6 A;  5A24 A;  1MEG A;  1YAL A;  2XU1 A;  1GX3 A;  1NB5 A;  2PBH A;  4Q8H A;  4BSQ A;  2G6D A;  7PCK A;  3P5U A;  5FPW A;  2C0Y A;  1U5I A;  2DZZ A;  3PBH A;  1XKG A;  1HUC B;  2FYE A;  2FTD A;  1EWM A;  4PP1 A;  3OVZ A;  4G54 A;  3PDF A;  1GLO A;  2ATO A;  2P86 A;  1VJV A;  1CTE A;  1S4V A;  1QDQ A;  1CB5 A;  2IPP B;  4FIP A;  2DC6 A;  4X6J A;  2AIM A;  2JQG R;  4BPV A;  3IHP A;  1SP4 B;  3S3Q A;  1QMY A;  3BPM A;  2ACT A;  2WBF X;  3KWZ A;  3KSE A;  5PAD A;  2IBI A;  4YYW A;  1PCI A;  2VHS A;  1PPD A;  1ICF A;  1PAD A;  2AYN A;  1KXR A;  2YJC A;  3HHA A;  1F2C A;  1YT7 A;  4NV7 A;  2FRA A;  4AXM A;  3LTW A;  1EF7 A;  1CJL A;  1Y08 A;  2AU1 A;  3CH2 X;  1JQP A;  1DF0 A;  1NPZ A;  5EGW A;  4I04 A;  3P5V A;  3OF8 A;  2PNS A;  2DZY A;  4K7C A;  2YJ8 A;  4C5P A;  1U9Q X;  3KX1 A;  3F5V A;  4YYR A;  1AU3 A;  3KKU A;  1SNK A;  2AUX A;  1NL6 A;  1BGO A;  2R9C A;  2XU4 A;  2E01 A;  3QSD A;  4MSX A;  3ZUA A;  3QT4 A;  3E1Z B;  4I05 A;  2Y6E A;  2OUL A;  1MIR A;  3IMA A;  1NLJ A;  2CB5 A;  2OZ2 A;  3MTN A;  3H8B A;  4RY2 A;  1U9W A;  2GFO A;  2H7J A;  1KFX L;  2NQI A;  1IWD A;  3KFQ A;  4DMY A;  1E2T A;  1KFU L;  3BC3 A;  3H8C A;  2VFC A;  1F2A A;  4CDD B;  4PI3 A;  2Y5B A;  3H89 A;  4AXL A;  3BPF A;  1BQI A;  1EWP A;  1W4T A;  2FO5 A;  1EWO A;  3NHE A;  2BSZ A;  4YV8 A;  1QOL A;  2R9N A;  1ZCM A;  1BY8 A;  4XUI A;  2R6N A;  3D6S A;  3N3K A;  2G7Y A;  1W6F A;  4W5B A;  2DC9 A;  1GMY A;  1THE A;  4MZS A;  2AVW A;  1FH0 A;  3M99 A;  2VFB A;  4CDC B;  2AS8 A;  3WXE A;  1A6R A;  3PNR A;  2DC7 A;  2HD5 A;  4QH6 A;  2XU3 A;  1MS6 A;  2R9F A;  3GCB A;  3K24 A;  3U8E A;  4YVA A;  3WXF A;  2AUZ A;  1CV8 A;  1K3B B;  1NQC A;  3C9E A;  2B1M A;  2R9M A;  3HWN A;  4W4U A;  2JQF R;  1TLO A;  4YYS A;  4P6E A;  1PXV A;  4Q8G A;  2HXZ A;  4CDE B;  1AU4 A;  1Y4H A;  3V6C A;  4N79 A;  1AYV A;  2ARY A;  1YVB A;  3B79 A;  3I06 A;  3RVW A;  1AEC A;  4KLB A;  1X9Y A;  1U9X A;  3USV A;  1ME3 A;  5JH3 A;  1M6D A;  3O0U A;  2YJ2 A;  2B1N A;  3D9W A;  4W5C A;  2HHN A;  1PE6 A;  4NV8 A;  2DCC A;  2DC8 A;  2FUD A;  2GHU A;  4X6I A;  1AU2 A;  2BDZ A;  4DMX A;  3H6S A;  4X6H A;  1YK7 A;  1F29 A;  2PRE A;  3LFY A;  4FJC A;  2YJ9 A;  5CVM A;  3TNX A;  3IV2 A;  1CVZ A;  1YK8 A;  3WXG A;  3MHS A;  2DJF B;  1AYU A;  2F7D A;  2R9O A;  3S3R A;  1BP4 A;  4OEM A;  3KWB X;  6PAD A;  4ZUX U;  2CIO A;  3KW9 A;  3V6E A;  5J94 A;  1PIP A;  4QBB A;  4B55 A;  8PCH A;  2DCB A;  2NQG A;  2E02 A;  3ERV A;  1AYW A;  2VHF A;  2O6X A;  3QJ3 A;  1F2B A;  2PAD A;  4YYU A;  1W5R A;  2NQD B;  2BDL A;  4MZO A;  1PPO A;  3IOQ A;  2OP3 A;  5CHV A;  1CSB B;  5CHT A;  1MHW A;  4QRG A;  4BS5 A;  4BQV A;  3N4C A;  4GUZ A;  1ATK A;  2P7U A;  1EWL A;  3RVX A;  1QXP A;  4N8W A;  1AU0 A;  1GEC E;  2XU5 A;  3OIS A;  4PP2 E;  4FK5 A;  1TL9 A;  2DCA A;  4YYQ A;  1NB3 A;  1CPJ A;  1ZIV A;  5CVO B;  2FQ9 A;  1MEM A;  2FRQ A;  1PPP A;  1KHQ A;  2G8E A;  3HHI A;  1MDW A;  4I07 A;  4QRV A;  2DJG B;  1PPN A;  3AI8 A;  5CVN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...