3H6SA

Structure of clitocypin - cathepsin v complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
221
structure length
220
Chain Sequence
LPKSVDWRKKGYVTPVKNQKQCGSWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICKYRPENSVAQDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSDNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin L2
publication title Versatile loops in mycocypins inhibit three protease families.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 70
structure length 220
sequence length 221
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.43: Cathepsin V.
pdb deposition date 2009-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3h6sA00
3I06A 3NHEA 3P5XA 1STFE 2ATOA 2HXZA 1ZIVA 4YYRA 3CH3X 5JA7A 1VJVA 1XKGA 1AYUA 4FIPA 1NB3A 1PE6A 2DZZA 4Q8GA 1AECA 1TL9A 5K16A 1MEMA 3OVZA 3HHIA 3IOQA 4X6IA 1ICFA 6PADA 3V6CA 1O0EA 3KX1A 2JQGR 2O6XA 2P7UA 2FRQA 4Q8HA 3HWNA 1CB5A 4XUIA 1QXPA 4MSXA 4K7CA 3RVVA 2BDLA 1BP4A 1CTEA 2R9NA 3BPFA 2FT2A 3LXSA 3HD3A 2IPPB 3H8CA 3OVXA 3OISA 4QRVA 2DJGB 2OULA 4CDCB 1EWLA 2R6NA 1KFUL 2FRAA 2PADA 1ZCMA 2H7JA 4KLBA 2DCDA 3RVXA 2E03A 1F2BA 4YV8A 2DC7A 1AU0A 4N4ZA 2YJ8A 2G7YA 1YK7A 1YT7A 2HH5A 1CSBB 3PDFA 2Y5BA 1HUCB 1ME4A 1Q6KA 1MDWA 3I3TA 2R9CA 1PBHA 3IV2A 3LFYA 1SP4B 3V6EA 1A6RA 2DC8A 1GLOA 2F1GA 2HD5A 1PPDA 3MTNA 1JQPA 3B79A 2AS8A 3GCBA 1S4VA 2FO5A 5A24A 3E1ZB 3K8UA 1PPOA 4FJCA 3KKUA 3CBJA 1KXRA 1EWMA 1U9VA 4N79A 4PP2E 4YVAA 5CVNB 4I05A 4BS5A 2B1NA 4AXMA 3K24A 1Y4HA 3BOWA 1CS8A 3OF8A 1KFXL 3BWKA 4XR7A 2AU1A 2AUZA 3N3KA 4QRGA 4YYWA 5F02A 4I07A 4X6HA 4BPVA 3H6SA 2DC9A 2XU5A 1SNKA 2PNSA 4OELA 3IEJA 1U9WA 1Y08A 4P6GA 2YJ9A 4PADA 2FQ9A 3BCNA 1DEUA 1QDQA 3H89A 1X9YA 2AUXA 2AYOA 3O0UA 3K9MA 2AYNA 1IWDA 3KSEA 1EWPA 3S3QA 3QJ3A 2OZ2A 3N4CA 1QOLA 1CQDA 4FK5A 1VSNA 2R9FA 1PADA 2DCBA 2P86A 3KW9A 5CHTA 3KFQA 4N8WA 5CHVA 4W5CA 3N3GA 4CDFB 4YYVA 2AVWA 3P5UA 4W4UA 3QT4A 4RY2A 1KHPA 2YJBA 1EF7A 2B1MA 1MHWA 1QMYA 1CVZA 1TLOA 4P6EA 1NB5A 1FH0A 3IHPA 3WXEA 2NQDB 5JH3A 3RVWA 4ZUXU 4YYQA 1MS6A 3BC3A 3H7DA 1AU4A 1M6DA 1U5IA 1CJLA 1NPZA 2ARYA 3WXGA 3KWBX 2Y6EA 5EGWA 1U9XA 2G6DA 1PXVA 3BPMA 3MHHA 2VHFA 3H8BA 4QH6A 1PIPA 1ME3A 3ERVA 2CB5A 2NQIA 2YJ2A 1ATKA 2DZYA 1PPNA 4BS6A 2AIMA 1F29A 2IBIA 4HWYA 1U9QX 5J94A 2PBHA 3M99A 2OP3A 3CBKA 3O1GA 3PBHA 1AYVA 3P5VA 5EF4A 3AI8A 4AXLA 4WA6A 4BSQA 4DMXA 2GFOA 2FUDA 5PADA 3PW3A 4MZOA 5CVMA 2BDZA 3ZUAA 2HHNA 3MHSA 4YYSA 3WXFA 2P0RA 1ITOA 4OEMA 3QSDA 3F5VA 4BQVA 2E01A 3TNXA 1AU2A 1PPPA 2XU1A 4PP1A 1CV8A 2NQGA 1BQIA 2DCCA 4G54A 1YVBA 2C0YA 2G8JA 4CDEB 1MEGA 2YJCA 2PREA 3IMAA 2ACTA 3U8EA 1THEA 1DF0A 4QBBA 4MZSA 5CVOB 3P5WA 2FYEA 1F2AA 2VHSA 2DCAA 1CPJA 1GECE 1YK8A 1KHQA 4I04A 4QRXA 1AYWA 2E00A 2JQFR 3D6SA 2WBFX 3S3RA 2DC6A 3USVA 4CDDB 2FTDA 1BY8A 3F75A 4PI3A 3PNRA 3OF9A 5FPWA 4W5BA 1F2CA 2DJFB 1TU6A 1GMYA 1GCBA 7PCKA 1K3BB 4YYUA 2XU3A 1POPA 3HHAA 2NQAA 9PAPA 2G8EA 3DF0A 3C9EA 1MIRA 1YALA 2GHUA 1NLJA 4CZWA 1EWOA 2CIOA 2R9MA 4X6JA 2F7DA 3IUTA 3MORA 2XU4A 1NQCA 1AU3A 3KWZA 8PCHA 2R9OA 2E02A 1NL6A 1PCIA 4DMYA 3CH2X 1BGOA 1AIMA
chains in the Genus database with same CATH superfamily
3I06A 3NHEA 3P5XA 1STFE 2ATOA 2HXZA 4GUAA 3BB7A 1ZIVA 4YYRA 3CH3X 5JA7A 1VJVA 1XKGA 1AYUA 4FIPA 1NB3A 1PE6A 2DZZA 2J7QC 4Q8GA 1AECA 1TL9A 5K16A 1MEMA 3OVZA 3HHIA 3IOQA 4X6IA 1ICFA 6PADA 3V6CA 1O0EA 3KX1A 2JQGR 2O6XA 2P7UA 2FRQA 5JZEA 4Q8HA 5EZSA 3HWNA 1CB5A 4XUIA 1QXPA 4MSXA 4K7CA 3RVVA 2BTWB 2BDLA 4IP3A 1BP4A 1CTEA 2R9NA 3E9SA 3BPFA 2FT2A 3LXSA 3HD3A 2IPPB 3H8CA 3OVXA 3OISA 4QRVA 2DJGB 2OULA 4CDCB 1EWLA 2R6NA 1KFUL 2FRAA 2J7QA 2PADA 1ZCMA 2H7JA 4KLBA 2DCDA 3RVXA 2E03A 1F2BA 4YV8A 2DC7A 1AU0A 4N4ZA 2YJ8A 2G7YA 1YK7A 1YT7A 2HH5A 1CSBB 4P16A 3PDFA 2Y5BA 1HUCB 1ME4A 1Q6KA 1MDWA 3I3TA 2R9CA 1PBHA 3IV2A 3LFYA 1SP4B 3V6EA 1A6RA 2DC8A 4M0WA 1GLOA 2F1GA 2HD5A 1PPDA 3MTNA 1JQPA 3B79A 2AS8A 3GCBA 1S4VA 2FO5A 5A24A 3E1ZB 3K8UA 1PPOA 4FJCA 3KKUA 3CBJA 1KXRA 1EWMA 1U9VA 4N79A 4PP2E 4YVAA 5CVNB 4I05A 3PSEA 4BS5A 2B1NA 4BOZA 4AXMA 3K24A 1Y4HA 3BOWA 1CS8A 3OF8A 1KFXL 3BWKA 4XR7A 2AU1A 4OVZB 2HWKA 2AUZA 3N3KA 4QRGA 4YYWA 5F02A 4I07A 4X6HA 4D8BA 4BPVA 3H6SA 2DC9A 2XU5A 1SNKA 2PNSA 4OELA 3IEJA 1U9WA 1Y08A 4P6GA 4BOQA 2YJ9A 4PADA 2FQ9A 3BCNA 1DEUA 1QDQA 3H89A 1X9YA 2AUXA 2AYOA 3O0UA 3K9MA 2AYNA 1IWDA 2UZJA 3KSEA 1EWPA 3OQCA 3S3QA 3QJ3A 2OZ2A 3N4CA 1QOLA 1CQDA 4FK5A 3B21A 1VSNA 2R9FA 1PADA 2DCBA 2P86A 3KW9A 5CHTA 3KFQA 4N8WA 3TMPA 5CHVA 2JRIA 1UKFA 4W5CA 3N3GA 4CDFB 4YYVA 2AVWA 3BY4A 3P5UA 4W4UA 3QT4A 4RY2A 1KHPA 2YJBA 1EF7A 2B1MA 2FE8A 3ZNHA 1MHWA 1QMYA 1CVZA 1TLOA 4BOSA 4P6EA 1NB5A 1FH0A 3IHPA 3WXEA 2NQDB 4D8EA 5JH3A 2AGAA 3RVWA 4ZUXU 4YYQA 1MS6A 3BC3A 3H7DA 1AU4A 3W31A 1M6DA 1U5IA 1CJLA 1NPZA 2ARYA 3PHWA 3WXGA 3KWBX 1DKIA 3W30A 2Y6EA 5EGWA 1U9XA 2G6DA 5KO3A 4ZTBA 1PXVA 3BPMA 4HXDB 3MHHA 4R3DA 2VHFA 5EZQA 3H8BA 4QH6A 1PIPA 4MI7A 3PRMA 1ME3A 3ERVA 2CB5A 2NQIA 2Z84A 2YJ2A 1ATKA 2DZYA 3TRKA 1PPNA 5E6JA 4BS6A 2AIMA 1F29A 3PT2A 2IBIA 4HWYA 1U9QX 4XZXA 5J94A 2PBHA 3M99A 2OP3A 4REZA 4OVZA 3RNVA 3CBKA 3O1GA 3PBHA 1AYVA 3P5VA 5EF4A 3AI8A 4AXLA 4WA6A 4BOPA 4BSQA 4DMXA 2GFOA 2FUDA 5PADA 3PW3A 4MZOA 4RKXA 5CVMA 2BDZA 3ZUAA 2HHNA 3MHSA 4YYSA 4RF0A 3WXFA 2P0RA 1ITOA 4OEMA 3QSDA 3F5VA 4BQVA 2E01A 3PRPA 3TNXA 1AU2A 1PPPA 2BTWA 3MTVA 4PT5A 2XU1A 4PP1A 1CV8A 2NQGA 1BQIA 2DCCA 4G54A 1YVBA 2C0YA 2G8JA 4CDEB 1MEGA 4RNAA 2YJCA 2PREA 3IMAA 4MM3B 2ACTA 3U8EA 1THEA 1DF0A 4QBBA 4MZSA 5CVOB 4RF1A 3P5WA 2FYEA 1F2AA 2BU3A 3O65A 4WURA 2VHSA 2DCAA 1CPJA 1GECE 1YK8A 1KHQA 4I04A 4QRXA 1AYWA 2E00A 2JQFR 3D6SA 2WBFX 1PVJA 2DC6A 3S3RA 3USVA 4CDDB 2FTDA 2DOSA 1BY8A 3MJ5A 2JTCA 3F75A 3MP2A 4PI3A 3PNRA 3OF9A 1YZBA 5FPWA 4W5BA 1F2CA 2DJFB 4D8IA 1TU6A 1GMYA 1GCBA 4BOUA 7PCKA 4OW0A 1K3BB 3BBAA 4YYUA 2XU3A 1POPA 3HHAA 2NQAA 3C0RA 3PHXA 9PAPA 2G8EA 3IFUA 3DF0A 3C9EA 4IUMA 1MIRA 1YALA 2GHUA 1NLJA 4CZWA 1EWOA 3PHUA 2CIOA 2R9MA 4X6JA 2F7DA 3IUTA 3MORA 2XU4A 1NQCA 1AU3A 3KWZA 8PCHA 2R9OA 2E02A 1NL6A 1PCIA 4DMYA 3CH2X 1BGOA 1AIMA 4A5UA
chains in the Genus database with same CATH topology
3I06A 3NHEA 3P5XA 1STFE 4NV8A 2ATOA 2HXZA 1ZIVA 4YYRA 3CH3X 5JA7A 1VJVA 1XKGA 1AYUA 4FIPA 1NB3A 1PE6A 2DZZA 4Q8GA 1AECA 1TL9A 5K16A 1MEMA 3OVZA 3HHIA 3IOQA 4X6IA 4BGFA 1ICFA 6PADA 3V6CA 1O0EA 3LTWA 3KX1A 2JQGR 2O6XA 2P7UA 2FRQA 4Q8HA 3HWNA 1CB5A 4XUIA 1QXPA 4NV7A 4MSXA 4K7CA 3RVVA 2BDLA 1BP4A 1CTEA 2R9NA 3BPFA 2FT2A 3D9WA 3LXSA 3HD3A 2IPPB 3H8CA 3OVXA 3OISA 4QRVA 2DJGB 2OULA 4CDCB 1EWLA 2R6NA 1KFUL 2FRAA 2PADA 1ZCMA 2H7JA 4KLBA 2DCDA 3RVXA 2E03A 1F2BA 4YV8A 2DC7A 1AU0A 4N4ZA 2YJ8A 2G7YA 1YK7A 1YT7A 2HH5A 1CSBB 3PDFA 2Y5BA 1HUCB 1ME4A 1Q6KA 1MDWA 3I3TA 2R9CA 1PBHA 3IV2A 3LFYA 1SP4B 3V6EA 1A6RA 2DC8A 1GLOA 2F1GA 2HD5A 1PPDA 2VFCA 3MTNA 1JQPA 3B79A 2AS8A 1W4TA 3GCBA 1S4VA 2FO5A 5A24A 3E1ZB 3K8UA 1PPOA 4FJCA 3KKUA 3CBJA 1KXRA 1EWMA 1U9VA 4N79A 4PP2E 4YVAA 5CVNB 4I05A 4BS5A 2B1NA 4AXMA 3K24A 1Y4HA 3BOWA 1CS8A 3OF8A 1KFXL 3BWKA 4XR7A 2AU1A 2AUZA 3N3KA 4QRGA 4YYWA 5F02A 4I07A 4X6HA 4BPVA 3H6SA 2DC9A 2XU5A 1SNKA 2PNSA 4OELA 3IEJA 1U9WA 1Y08A 4P6GA 2YJ9A 4PADA 2FQ9A 3BCNA 1DEUA 1QDQA 3H89A 1X9YA 2AUXA 2AYOA 3O0UA 3K9MA 2AYNA 1IWDA 3KSEA 1EWPA 3S3QA 3QJ3A 2OZ2A 3N4CA 1QOLA 1CQDA 4FK5A 1VSNA 2R9FA 1PADA 2DCBA 2P86A 3KW9A 5CHTA 3KFQA 4N8WA 5CHVA 4W5CA 3N3GA 4CDFB 4YYVA 2AVWA 3P5UA 4W4UA 1W6FA 3QT4A 4RY2A 1KHPA 2YJBA 1EF7A 2B1MA 1GX3A 1MHWA 1QMYA 1CVZA 1TLOA 4P6EA 1NB5A 1FH0A 3IHPA 3WXEA 2NQDB 5JH3A 3RVWA 4ZUXU 4YYQA 1MS6A 4GUZA 3BC3A 3H7DA 1AU4A 1M6DA 1U5IA 1CJLA 1NPZA 2ARYA 3WXGA 3KWBX 2Y6EA 5EGWA 1U9XA 2G6DA 2BSZA 1PXVA 3BPMA 3MHHA 2VHFA 3H8BA 4QH6A 1PIPA 1ME3A 3ERVA 2CB5A 2NQIA 2YJ2A 1ATKA 2DZYA 1PPNA 4BS6A 2AIMA 1F29A 1E2TA 2IBIA 4HWYA 1U9QX 5J94A 2PBHA 3M99A 2OP3A 3CBKA 3O1GA 3PBHA 1AYVA 3P5VA 5EF4A 3AI8A 4AXLA 4WA6A 4BSQA 4DMXA 2GFOA 2FUDA 5PADA 3PW3A 4MZOA 5CVMA 2BDZA 3ZUAA 2HHNA 3MHSA 2VFBA 4YYSA 3WXFA 2P0RA 1ITOA 1W5RA 4OEMA 3QSDA 3F5VA 4BQVA 2E01A 3TNXA 1AU2A 1PPPA 2XU1A 4PP1A 1CV8A 2NQGA 1BQIA 2DCCA 4G54A 1YVBA 2C0YA 2G8JA 4CDEB 1MEGA 2YJCA 2PREA 3IMAA 2ACTA 3U8EA 1THEA 1DF0A 4QBBA 4MZSA 5CVOB 3P5WA 2FYEA 1F2AA 2VHSA 2DCAA 1CPJA 1GECE 1YK8A 1KHQA 4I04A 4QRXA 1AYWA 2E00A 2JQFR 3D6SA 2WBFX 4C5PA 3S3RA 2DC6A 3USVA 4CDDB 2FTDA 1BY8A 3F75A 4PI3A 3PNRA 3OF9A 5FPWA 4W5BA 1F2CA 2DJFB 1TU6A 1GMYA 1GCBA 7PCKA 1K3BB 4YYUA 2XU3A 1POPA 3HHAA 2NQAA 9PAPA 4B55A 2G8EA 3DF0A 3C9EA 1MIRA 1YALA 2GHUA 1NLJA 4CZWA 1EWOA 2CIOA 2R9MA 4X6JA 3MORA 2F7DA 3IUTA 2XU4A 1NQCA 1AU3A 3KWZA 8PCHA 2R9OA 2E02A 1NL6A 1PCIA 4DMYA 3CH2X 1BGOA 1AIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I06 A;  3NHE A;  3P5X A;  1STF E;  2ATO A;  2HXZ A;  1ZIV A;  4YYR A;  3CH3 X;  5JA7 A;  1VJV A;  1XKG A;  1AYU A;  4FIP A;  1NB3 A;  1PE6 A;  2DZZ A;  4Q8G A;  1AEC A;  1TL9 A;  5K16 A;  1MEM A;  3OVZ A;  3HHI A;  3IOQ A;  4X6I A;  1ICF A;  6PAD A;  3V6C A;  1O0E A;  3KX1 A;  2JQG R;  2O6X A;  2P7U A;  2FRQ A;  4Q8H A;  3HWN A;  1CB5 A;  4XUI A;  1QXP A;  4MSX A;  4K7C A;  3RVV A;  2BDL A;  1BP4 A;  1CTE A;  2R9N A;  3BPF A;  2FT2 A;  3LXS A;  3HD3 A;  2IPP B;  3H8C A;  3OVX A;  3OIS A;  4QRV A;  2DJG B;  2OUL A;  4CDC B;  1EWL A;  2R6N A;  1KFU L;  2FRA A;  2PAD A;  1ZCM A;  2H7J A;  4KLB A;  2DCD A;  3RVX A;  2E03 A;  1F2B A;  4YV8 A;  2DC7 A;  1AU0 A;  4N4Z A;  2YJ8 A;  2G7Y A;  1YK7 A;  1YT7 A;  2HH5 A;  1CSB B;  3PDF A;  2Y5B A;  1HUC B;  1ME4 A;  1Q6K A;  1MDW A;  3I3T A;  2R9C A;  1PBH A;  3IV2 A;  3LFY A;  1SP4 B;  3V6E A;  1A6R A;  2DC8 A;  1GLO A;  2F1G A;  2HD5 A;  1PPD A;  3MTN A;  1JQP A;  3B79 A;  2AS8 A;  3GCB A;  1S4V A;  2FO5 A;  5A24 A;  3E1Z B;  3K8U A;  1PPO A;  4FJC A;  3KKU A;  3CBJ A;  1KXR A;  1EWM A;  1U9V A;  4N79 A;  4PP2 E;  4YVA A;  5CVN B;  4I05 A;  4BS5 A;  2B1N A;  4AXM A;  3K24 A;  1Y4H A;  3BOW A;  1CS8 A;  3OF8 A;  1KFX L;  3BWK A;  4XR7 A;  2AU1 A;  2AUZ A;  3N3K A;  4QRG A;  4YYW A;  5F02 A;  4I07 A;  4X6H A;  4BPV A;  3H6S A;  2DC9 A;  2XU5 A;  1SNK A;  2PNS A;  4OEL A;  3IEJ A;  1U9W A;  1Y08 A;  4P6G A;  2YJ9 A;  4PAD A;  2FQ9 A;  3BCN A;  1DEU A;  1QDQ A;  3H89 A;  1X9Y A;  2AUX A;  2AYO A;  3O0U A;  3K9M A;  2AYN A;  1IWD A;  3KSE A;  1EWP A;  3S3Q A;  3QJ3 A;  2OZ2 A;  3N4C A;  1QOL A;  1CQD A;  4FK5 A;  1VSN A;  2R9F A;  1PAD A;  2DCB A;  2P86 A;  3KW9 A;  5CHT A;  3KFQ A;  4N8W A;  5CHV A;  4W5C A;  3N3G A;  4CDF B;  4YYV A;  2AVW A;  3P5U A;  4W4U A;  3QT4 A;  4RY2 A;  1KHP A;  2YJB A;  1EF7 A;  2B1M A;  1MHW A;  1QMY A;  1CVZ A;  1TLO A;  4P6E A;  1NB5 A;  1FH0 A;  3IHP A;  3WXE A;  2NQD B;  5JH3 A;  3RVW A;  4ZUX U;  4YYQ A;  1MS6 A;  3BC3 A;  3H7D A;  1AU4 A;  1M6D A;  1U5I A;  1CJL A;  1NPZ A;  2ARY A;  3WXG A;  3KWB X;  2Y6E A;  5EGW A;  1U9X A;  2G6D A;  1PXV A;  3BPM A;  3MHH A;  2VHF A;  3H8B A;  4QH6 A;  1PIP A;  1ME3 A;  3ERV A;  2CB5 A;  2NQI A;  2YJ2 A;  1ATK A;  2DZY A;  1PPN A;  4BS6 A;  2AIM A;  1F29 A;  2IBI A;  4HWY A;  1U9Q X;  5J94 A;  2PBH A;  3M99 A;  2OP3 A;  3CBK A;  3O1G A;  3PBH A;  1AYV A;  3P5V A;  5EF4 A;  3AI8 A;  4AXL A;  4WA6 A;  4BSQ A;  4DMX A;  2GFO A;  2FUD A;  5PAD A;  3PW3 A;  4MZO A;  5CVM A;  2BDZ A;  3ZUA A;  2HHN A;  3MHS A;  4YYS A;  3WXF A;  2P0R A;  1ITO A;  4OEM A;  3QSD A;  3F5V A;  4BQV A;  2E01 A;  3TNX A;  1AU2 A;  1PPP A;  2XU1 A;  4PP1 A;  1CV8 A;  2NQG A;  1BQI A;  2DCC A;  4G54 A;  1YVB A;  2C0Y A;  2G8J A;  4CDE B;  1MEG A;  2YJC A;  2PRE A;  3IMA A;  2ACT A;  3U8E A;  1THE A;  1DF0 A;  4QBB A;  4MZS A;  5CVO B;  3P5W A;  2FYE A;  1F2A A;  2VHS A;  2DCA A;  1CPJ A;  1GEC E;  1YK8 A;  1KHQ A;  4I04 A;  4QRX A;  1AYW A;  2E00 A;  2JQF R;  3D6S A;  2WBF X;  3S3R A;  2DC6 A;  3USV A;  4CDD B;  2FTD A;  1BY8 A;  3F75 A;  4PI3 A;  3PNR A;  3OF9 A;  5FPW A;  4W5B A;  1F2C A;  2DJF B;  1TU6 A;  1GMY A;  1GCB A;  7PCK A;  1K3B B;  4YYU A;  2XU3 A;  1POP A;  3HHA A;  2NQA A;  9PAP A;  2G8E A;  3DF0 A;  3C9E A;  1MIR A;  1YAL A;  2GHU A;  1NLJ A;  4CZW A;  1EWO A;  2CIO A;  2R9M A;  4X6J A;  2F7D A;  3IUT A;  3MOR A;  2XU4 A;  1NQC A;  1AU3 A;  3KWZ A;  8PCH A;  2R9O A;  2E02 A;  1NL6 A;  1PCI A;  4DMY A;  3CH2 X;  1BGO A;  1AIM A; 
#chains in the Genus database with same CATH topology
 3I06 A;  3NHE A;  3P5X A;  1STF E;  2ATO A;  2HXZ A;  4GUA A;  3BB7 A;  1ZIV A;  4YYR A;  3CH3 X;  5JA7 A;  1VJV A;  1XKG A;  1AYU A;  4FIP A;  1NB3 A;  1PE6 A;  2DZZ A;  2J7Q C;  4Q8G A;  1AEC A;  1TL9 A;  5K16 A;  1MEM A;  3OVZ A;  3HHI A;  3IOQ A;  4X6I A;  1ICF A;  6PAD A;  3V6C A;  1O0E A;  3KX1 A;  2JQG R;  2O6X A;  2P7U A;  2FRQ A;  5JZE A;  4Q8H A;  5EZS A;  3HWN A;  1CB5 A;  4XUI A;  1QXP A;  4MSX A;  4K7C A;  3RVV A;  2BTW B;  2BDL A;  4IP3 A;  1BP4 A;  1CTE A;  2R9N A;  3E9S A;  3BPF A;  2FT2 A;  3LXS A;  3HD3 A;  2IPP B;  3H8C A;  3OVX A;  3OIS A;  4QRV A;  2DJG B;  2OUL A;  4CDC B;  1EWL A;  2R6N A;  1KFU L;  2FRA A;  2J7Q A;  2PAD A;  1ZCM A;  2H7J A;  4KLB A;  2DCD A;  3RVX A;  2E03 A;  1F2B A;  4YV8 A;  2DC7 A;  1AU0 A;  4N4Z A;  2YJ8 A;  2G7Y A;  1YK7 A;  1YT7 A;  2HH5 A;  1CSB B;  4P16 A;  3PDF A;  2Y5B A;  1HUC B;  1ME4 A;  1Q6K A;  1MDW A;  3I3T A;  2R9C A;  1PBH A;  3IV2 A;  3LFY A;  1SP4 B;  3V6E A;  1A6R A;  2DC8 A;  4M0W A;  1GLO A;  2F1G A;  2HD5 A;  1PPD A;  3MTN A;  1JQP A;  3B79 A;  2AS8 A;  3GCB A;  1S4V A;  2FO5 A;  5A24 A;  3E1Z B;  3K8U A;  1PPO A;  4FJC A;  3KKU A;  3CBJ A;  1KXR A;  1EWM A;  1U9V A;  4N79 A;  4PP2 E;  4YVA A;  5CVN B;  4I05 A;  3PSE A;  4BS5 A;  2B1N A;  4BOZ A;  4AXM A;  3K24 A;  1Y4H A;  3BOW A;  1CS8 A;  3OF8 A;  1KFX L;  3BWK A;  4XR7 A;  2AU1 A;  4OVZ B;  2HWK A;  2AUZ A;  3N3K A;  4QRG A;  4YYW A;  5F02 A;  4I07 A;  4X6H A;  4D8B A;  4BPV A;  3H6S A;  2DC9 A;  2XU5 A;  1SNK A;  2PNS A;  4OEL A;  3IEJ A;  1U9W A;  1Y08 A;  4P6G A;  4BOQ A;  2YJ9 A;  4PAD A;  2FQ9 A;  3BCN A;  1DEU A;  1QDQ A;  3H89 A;  1X9Y A;  2AUX A;  2AYO A;  3O0U A;  3K9M A;  2AYN A;  1IWD A;  2UZJ A;  3KSE A;  1EWP A;  3OQC A;  3S3Q A;  3QJ3 A;  2OZ2 A;  3N4C A;  1QOL A;  1CQD A;  4FK5 A;  3B21 A;  1VSN A;  2R9F A;  1PAD A;  2DCB A;  2P86 A;  3KW9 A;  5CHT A;  3KFQ A;  4N8W A;  3TMP A;  5CHV A;  2JRI A;  1UKF A;  4W5C A;  3N3G A;  4CDF B;  4YYV A;  2AVW A;  3BY4 A;  3P5U A;  4W4U A;  3QT4 A;  4RY2 A;  1KHP A;  2YJB A;  1EF7 A;  2B1M A;  2FE8 A;  3ZNH A;  1MHW A;  1QMY A;  1CVZ A;  1TLO A;  4BOS A;  4P6E A;  1NB5 A;  1FH0 A;  3IHP A;  3WXE A;  2NQD B;  4D8E A;  5JH3 A;  2AGA A;  3RVW A;  4ZUX U;  4YYQ A;  1MS6 A;  3BC3 A;  3H7D A;  1AU4 A;  3W31 A;  1M6D A;  1U5I A;  1CJL A;  1NPZ A;  2ARY A;  3PHW A;  3WXG A;  3KWB X;  1DKI A;  3W30 A;  2Y6E A;  5EGW A;  1U9X A;  2G6D A;  5KO3 A;  4ZTB A;  1PXV A;  3BPM A;  4HXD B;  3MHH A;  4R3D A;  2VHF A;  5EZQ A;  3H8B A;  4QH6 A;  1PIP A;  4MI7 A;  3PRM A;  1ME3 A;  3ERV A;  2CB5 A;  2NQI A;  2Z84 A;  2YJ2 A;  1ATK A;  2DZY A;  3TRK A;  1PPN A;  5E6J A;  4BS6 A;  2AIM A;  1F29 A;  3PT2 A;  2IBI A;  4HWY A;  1U9Q X;  4XZX A;  5J94 A;  2PBH A;  3M99 A;  2OP3 A;  4REZ A;  4OVZ A;  3RNV A;  3CBK A;  3O1G A;  3PBH A;  1AYV A;  3P5V A;  5EF4 A;  3AI8 A;  4AXL A;  4WA6 A;  4BOP A;  4BSQ A;  4DMX A;  2GFO A;  2FUD A;  5PAD A;  3PW3 A;  4MZO A;  4RKX A;  5CVM A;  2BDZ A;  3ZUA A;  2HHN A;  3MHS A;  4YYS A;  4RF0 A;  3WXF A;  2P0R A;  1ITO A;  4OEM A;  3QSD A;  3F5V A;  4BQV A;  2E01 A;  3PRP A;  3TNX A;  1AU2 A;  1PPP A;  2BTW A;  3MTV A;  4PT5 A;  2XU1 A;  4PP1 A;  1CV8 A;  2NQG A;  1BQI A;  2DCC A;  4G54 A;  1YVB A;  2C0Y A;  2G8J A;  4CDE B;  1MEG A;  4RNA A;  2YJC A;  2PRE A;  3IMA A;  4MM3 B;  2ACT A;  3U8E A;  1THE A;  1DF0 A;  4QBB A;  4MZS A;  5CVO B;  4RF1 A;  3P5W A;  2FYE A;  1F2A A;  2BU3 A;  3O65 A;  4WUR A;  2VHS A;  2DCA A;  1CPJ A;  1GEC E;  1YK8 A;  1KHQ A;  4I04 A;  4QRX A;  1AYW A;  2E00 A;  2JQF R;  3D6S A;  2WBF X;  1PVJ A;  2DC6 A;  3S3R A;  3USV A;  4CDD B;  2FTD A;  2DOS A;  1BY8 A;  3MJ5 A;  2JTC A;  3F75 A;  3MP2 A;  4PI3 A;  3PNR A;  3OF9 A;  1YZB A;  5FPW A;  4W5B A;  1F2C A;  2DJF B;  4D8I A;  1TU6 A;  1GMY A;  1GCB A;  4BOU A;  7PCK A;  4OW0 A;  1K3B B;  3BBA A;  4YYU A;  2XU3 A;  1POP A;  3HHA A;  2NQA A;  3C0R A;  3PHX A;  9PAP A;  2G8E A;  3IFU A;  3DF0 A;  3C9E A;  4IUM A;  1MIR A;  1YAL A;  2GHU A;  1NLJ A;  4CZW A;  1EWO A;  3PHU A;  2CIO A;  2R9M A;  4X6J A;  2F7D A;  3IUT A;  3MOR A;  2XU4 A;  1NQC A;  1AU3 A;  3KWZ A;  8PCH A;  2R9O A;  2E02 A;  1NL6 A;  1PCI A;  4DMY A;  3CH2 X;  1BGO A;  1AIM A;  4A5U A; 
#chains in the Genus database with same CATH homology
 3I06 A;  3NHE A;  3P5X A;  1STF E;  4NV8 A;  2ATO A;  2HXZ A;  1ZIV A;  4YYR A;  3CH3 X;  5JA7 A;  1VJV A;  1XKG A;  1AYU A;  4FIP A;  1NB3 A;  1PE6 A;  2DZZ A;  4Q8G A;  1AEC A;  1TL9 A;  5K16 A;  1MEM A;  3OVZ A;  3HHI A;  3IOQ A;  4X6I A;  4BGF A;  1ICF A;  6PAD A;  3V6C A;  1O0E A;  3LTW A;  3KX1 A;  2JQG R;  2O6X A;  2P7U A;  2FRQ A;  4Q8H A;  3HWN A;  1CB5 A;  4XUI A;  1QXP A;  4NV7 A;  4MSX A;  4K7C A;  3RVV A;  2BDL A;  1BP4 A;  1CTE A;  2R9N A;  3BPF A;  2FT2 A;  3D9W A;  3LXS A;  3HD3 A;  2IPP B;  3H8C A;  3OVX A;  3OIS A;  4QRV A;  2DJG B;  2OUL A;  4CDC B;  1EWL A;  2R6N A;  1KFU L;  2FRA A;  2PAD A;  1ZCM A;  2H7J A;  4KLB A;  2DCD A;  3RVX A;  2E03 A;  1F2B A;  4YV8 A;  2DC7 A;  1AU0 A;  4N4Z A;  2YJ8 A;  2G7Y A;  1YK7 A;  1YT7 A;  2HH5 A;  1CSB B;  3PDF A;  2Y5B A;  1HUC B;  1ME4 A;  1Q6K A;  1MDW A;  3I3T A;  2R9C A;  1PBH A;  3IV2 A;  3LFY A;  1SP4 B;  3V6E A;  1A6R A;  2DC8 A;  1GLO A;  2F1G A;  2HD5 A;  1PPD A;  2VFC A;  3MTN A;  1JQP A;  3B79 A;  2AS8 A;  1W4T A;  3GCB A;  1S4V A;  2FO5 A;  5A24 A;  3E1Z B;  3K8U A;  1PPO A;  4FJC A;  3KKU A;  3CBJ A;  1KXR A;  1EWM A;  1U9V A;  4N79 A;  4PP2 E;  4YVA A;  5CVN B;  4I05 A;  4BS5 A;  2B1N A;  4AXM A;  3K24 A;  1Y4H A;  3BOW A;  1CS8 A;  3OF8 A;  1KFX L;  3BWK A;  4XR7 A;  2AU1 A;  2AUZ A;  3N3K A;  4QRG A;  4YYW A;  5F02 A;  4I07 A;  4X6H A;  4BPV A;  3H6S A;  2DC9 A;  2XU5 A;  1SNK A;  2PNS A;  4OEL A;  3IEJ A;  1U9W A;  1Y08 A;  4P6G A;  2YJ9 A;  4PAD A;  2FQ9 A;  3BCN A;  1DEU A;  1QDQ A;  3H89 A;  1X9Y A;  2AUX A;  2AYO A;  3O0U A;  3K9M A;  2AYN A;  1IWD A;  3KSE A;  1EWP A;  3S3Q A;  3QJ3 A;  2OZ2 A;  3N4C A;  1QOL A;  1CQD A;  4FK5 A;  1VSN A;  2R9F A;  1PAD A;  2DCB A;  2P86 A;  3KW9 A;  5CHT A;  3KFQ A;  4N8W A;  5CHV A;  4W5C A;  3N3G A;  4CDF B;  4YYV A;  2AVW A;  3P5U A;  4W4U A;  1W6F A;  3QT4 A;  4RY2 A;  1KHP A;  2YJB A;  1EF7 A;  2B1M A;  1GX3 A;  1MHW A;  1QMY A;  1CVZ A;  1TLO A;  4P6E A;  1NB5 A;  1FH0 A;  3IHP A;  3WXE A;  2NQD B;  5JH3 A;  3RVW A;  4ZUX U;  4YYQ A;  1MS6 A;  4GUZ A;  3BC3 A;  3H7D A;  1AU4 A;  1M6D A;  1U5I A;  1CJL A;  1NPZ A;  2ARY A;  3WXG A;  3KWB X;  2Y6E A;  5EGW A;  1U9X A;  2G6D A;  2BSZ A;  1PXV A;  3BPM A;  3MHH A;  2VHF A;  3H8B A;  4QH6 A;  1PIP A;  1ME3 A;  3ERV A;  2CB5 A;  2NQI A;  2YJ2 A;  1ATK A;  2DZY A;  1PPN A;  4BS6 A;  2AIM A;  1F29 A;  1E2T A;  2IBI A;  4HWY A;  1U9Q X;  5J94 A;  2PBH A;  3M99 A;  2OP3 A;  3CBK A;  3O1G A;  3PBH A;  1AYV A;  3P5V A;  5EF4 A;  3AI8 A;  4AXL A;  4WA6 A;  4BSQ A;  4DMX A;  2GFO A;  2FUD A;  5PAD A;  3PW3 A;  4MZO A;  5CVM A;  2BDZ A;  3ZUA A;  2HHN A;  3MHS A;  2VFB A;  4YYS A;  3WXF A;  2P0R A;  1ITO A;  1W5R A;  4OEM A;  3QSD A;  3F5V A;  4BQV A;  2E01 A;  3TNX A;  1AU2 A;  1PPP A;  2XU1 A;  4PP1 A;  1CV8 A;  2NQG A;  1BQI A;  2DCC A;  4G54 A;  1YVB A;  2C0Y A;  2G8J A;  4CDE B;  1MEG A;  2YJC A;  2PRE A;  3IMA A;  2ACT A;  3U8E A;  1THE A;  1DF0 A;  4QBB A;  4MZS A;  5CVO B;  3P5W A;  2FYE A;  1F2A A;  2VHS A;  2DCA A;  1CPJ A;  1GEC E;  1YK8 A;  1KHQ A;  4I04 A;  4QRX A;  1AYW A;  2E00 A;  2JQF R;  3D6S A;  2WBF X;  4C5P A;  3S3R A;  2DC6 A;  3USV A;  4CDD B;  2FTD A;  1BY8 A;  3F75 A;  4PI3 A;  3PNR A;  3OF9 A;  5FPW A;  4W5B A;  1F2C A;  2DJF B;  1TU6 A;  1GMY A;  1GCB A;  7PCK A;  1K3B B;  4YYU A;  2XU3 A;  1POP A;  3HHA A;  2NQA A;  9PAP A;  4B55 A;  2G8E A;  3DF0 A;  3C9E A;  1MIR A;  1YAL A;  2GHU A;  1NLJ A;  4CZW A;  1EWO A;  2CIO A;  2R9M A;  4X6J A;  3MOR A;  2F7D A;  3IUT A;  2XU4 A;  1NQC A;  1AU3 A;  3KWZ A;  8PCH A;  2R9O A;  2E02 A;  1NL6 A;  1PCI A;  4DMY A;  3CH2 X;  1BGO A;  1AIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...