2P7UA

The crystal structure of rhodesain, the major cysteine protease of t. brucei rhodesiense, bound to inhibitor k777
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
215
structure length
215
Chain Sequence
APAAVDWREKGAVTPVKDQGQCGSCWAFSTIGNIEGQWQVAGNPLVSLSEQMLVSCDTIDFGCGGGLMDNAFNWIVNSNGGNVFTEASYPYVSGNGEQPQCQMNGHEIGAAITDHVDLPQDEDAIAAYLAENGPLAIAVDATSFMDYNGGILTSCTSEQLDHGVLLVGYNDASNPPYWIIKNSWSNMWGEDGYIRIEKGTNQCLMNQAVSSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cysteine protease
publication title Vinyl sulfones as antiparasitic agents and a structural basis for drug design.
pubmed doi rcsb
source organism Trypanosoma brucei rhodesiense
total genus 69
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2007-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2p7uA00
1AYUA 3BWKA 9PAPA 4YYVA 2O6XA 2DZZA 2Y5BA 1PPDA 1QXPA 3F5VA 4CDCB 2DC6A 3LFYA 2AUXA 2AS8A 3F75A 1PADA 1PXVA 3V6EA 1AYVA 2BDZA 4QRVA 3RVWA 4XR7A 3M99A 3N4CA 1PPNA 1KFXL 3IUTA 3LXSA 4N79A 4X6IA 1A6RA 2VHSA 3O1GA 3D6SA 1CQDA 3HWNA 4X6HA 4AXLA 2XU4A 2JQFR 2HHNA 1IWDA 1AYWA 2C0YA 4DMYA 3CBKA 1FH0A 3I3TA 3KWZA 5PADA 1GCBA 1MHWA 5CVOB 3NHEA 2E00A 1CB5A 3PNRA 2G7YA 2YJBA 2HH5A 1XKGA 4P6GA 2FO5A 4P6EA 1U9WA 4Q8HA 3P5XA 3OF9A 4YYWA 3KX1A 4FJCA 3AI8A 4AXMA 1MEMA 3IV2A 2DJFB 3CH3X 1ITOA 2IPPB 1CTEA 4X6JA 2R9CA 3GCBA 2E03A 3H8CA 2YJCA 4W4UA 1MEGA 2FTDA 3KKUA 3IMAA 2G8EA 2DC7A 4PP2E 5F02A 3K24A 5J94A 1CJLA 1M6DA 1HUCB 3QJ3A 1S4VA 1AU2A 1JQPA 1THEA 2XU5A 5EF4A 2Y6EA 2DC9A 3KW9A 1YALA 1EWLA 2R9NA 3K8UA 4OEMA 4FIPA 4DMXA 4PI3A 1X9YA 2OP3A 1YT7A 1MS6A 1CS8A 1CSBB 1U9QX 4QH6A 2NQAA 2R9MA 2FRAA 2FYEA 3TNXA 1BP4A 2P7UA 3IHPA 4N8WA 2PREA 4MZSA 2R6NA 2G8JA 4FK5A 5JA7A 5CHTA 1STFE 1MIRA 3CH2X 1DF0A 2F7DA 3WXFA 2BDLA 4K7CA 2ACTA 2FQ9A 1QMYA 2PADA 4KLBA 3S3RA 2DCAA 4W5CA 2WBFX 2GFOA 3OF8A 3HHAA 4PP1A 2DJGB 3O0UA 3P5WA 2NQDB 2AIMA 2YJ9A 1KHPA 1F2CA 1PBHA 4CDDB 2AUZA 1PPOA 4YYRA 4BPVA 1CV8A 3USVA 4MSXA 4CDEB 4MZOA 1NPZA 4OELA 2AYOA 2NQGA 4CZWA 2AU1A 5CHVA 2AYNA 5A24A 1BY8A 3MTNA 1POPA 5CVMA 2PNSA 3ERVA 3H8BA 3QT4A 1TU6A 1DEUA 4QRGA 5JH3A 1MDWA 3KWBX 4BQVA 2ATOA 1EWOA 1ZCMA 3IOQA 1TL9A 6PADA 1NB3A 3B79A 1KXRA 2YJ2A 2H7JA 4PADA 1ATKA 3ZUAA 3OVXA 2JQGR 1Q6KA 2FT2A 4N4ZA 3H89A 1NL6A 1PPPA 2E02A 1BGOA 2DCCA 4Q8GA 1PIPA 3BOWA 8PCHA 1AECA 2CB5A 3C9EA 5EGWA 1CPJA 1F29A 2FRQA 2AVWA 4I04A 3BPMA 2P0RA 1NQCA 2VHFA 3BPFA 2E01A 3OISA 3U8EA 1ME3A 1GLOA 1YK8A 1BQIA 4BSQA 1KHQA 4QBBA 1U9XA 4ZUXU 2OULA 1SNKA 1QDQA 3CBJA 1AU3A 1VJVA 1AU0A 1U9VA 2HD5A 1K3BB 3P5UA 4I05A 1CVZA 3H7DA 3MHHA 1F2BA 3H6SA 2DZYA 3DF0A 4BS5A 3KFQA 1O0EA 2NQIA 4YYSA 3KSEA 1AIMA 3WXGA 1SP4B 1NB5A 2XU1A 1Y4HA 3OVZA 4HWYA 4WA6A 1ZIVA 1KFUL 2P86A 2FUDA 1GECE 4BS6A 4G54A 2YJ8A 2HXZA 3MHSA 2R9FA 4W5BA 1YVBA 3HHIA 4YVAA 4XUIA 2ARYA 1QOLA 2G6DA 3RVXA 3PW3A 2OZ2A 5FPWA 1NLJA 3IEJA 1AU4A 5CVNB 1ICFA 2B1NA 3QSDA 2DCBA 1EF7A 1GMYA 3N3KA 7PCKA 4RY2A 4QRXA 1Y08A 4CDFB 3E1ZB 2B1MA 4YYQA 3P5VA 2F1GA 1EWPA 3BCNA 3I06A 1PE6A 2DC8A 1TLOA 3PDFA 3RVVA 2R9OA 3N3GA 4I07A 2IBIA 2DCDA 2XU3A 3V6CA 1PCIA 3BC3A 3K9MA 1ME4A 3HD3A 3MORA 3WXEA 2PBHA 1U5IA 3PBHA 1YK7A 1EWMA 5K16A 2GHUA 1VSNA 2CIOA 4YYUA 4YV8A 1F2AA 3S3QA
chains in the Genus database with same CATH superfamily
1AYUA 3BWKA 3MP2A 9PAPA 4YYVA 2O6XA 2DZZA 2Y5BA 1PPDA 1QXPA 3F5VA 3PRMA 4CDCB 2DC6A 3LFYA 2AUXA 3MTVA 3PRPA 2AS8A 3F75A 1PADA 1PXVA 4XZXA 3V6EA 1AYVA 2BDZA 5KO3A 4QRVA 3RVWA 4XR7A 3M99A 3N4CA 1PPNA 1KFXL 3IUTA 3LXSA 4N79A 4X6IA 1A6RA 2VHSA 3PHXA 3O1GA 3TMPA 3D6SA 1CQDA 3HWNA 4X6HA 2HWKA 4AXLA 2XU4A 2JQFR 2HHNA 1IWDA 1AYWA 2C0YA 4DMYA 3CBKA 1FH0A 3I3TA 3KWZA 5PADA 4BOPA 1GCBA 1MHWA 5CVOB 3NHEA 2E00A 1CB5A 3PNRA 2G7YA 2YJBA 2HH5A 1XKGA 4P6GA 2FO5A 4P6EA 1U9WA 4Q8HA 3P5XA 3OF9A 4YYWA 3KX1A 4FJCA 3AI8A 4AXMA 1MEMA 3IV2A 4IUMA 2DJFB 4BOQA 3CH3X 1ITOA 2IPPB 4MM3B 1CTEA 4X6JA 4BOZA 2R9CA 3GCBA 3RNVA 2E03A 4OW0A 3H8CA 2YJCA 4W4UA 1MEGA 2FTDA 3KKUA 3IMAA 2G8EA 3E9SA 2DC7A 4PP2E 5F02A 3K24A 5J94A 1CJLA 1M6DA 1HUCB 3QJ3A 1S4VA 1AU2A 1JQPA 1THEA 3PHWA 2XU5A 5JZEA 5EF4A 2Y6EA 2DC9A 3KW9A 1YALA 1EWLA 2R9NA 4OVZB 4OVZA 3K8UA 4D8BA 4OEMA 3BY4A 3IFUA 4FIPA 4DMXA 4PI3A 1X9YA 2OP3A 1YT7A 1MS6A 1CS8A 1CSBB 1U9QX 4QH6A 2NQAA 2R9MA 2FRAA 2FYEA 3TNXA 1BP4A 2P7UA 3IHPA 4N8WA 2PREA 4MZSA 2R6NA 2G8JA 4FK5A 5JA7A 5CHTA 1STFE 1MIRA 3CH2X 1DF0A 2F7DA 3WXFA 2BDLA 2FQ9A 2ACTA 2PADA 1QMYA 4K7CA 4KLBA 3S3RA 2J7QC 2DCAA 4W5CA 2WBFX 2GFOA 3OF8A 3HHAA 2FE8A 4PP1A 2DJGB 3O0UA 3P5WA 2NQDB 2AIMA 3C0RA 2YJ9A 1DKIA 1KHPA 1F2CA 3ZNHA 1PBHA 4CDDB 2AUZA 1PPOA 4YYRA 2JTCA 3W30A 4BPVA 1CV8A 3USVA 4MSXA 1PVJA 4CDEB 4MZOA 1NPZA 4OELA 3BB7A 2AYOA 2NQGA 4BOUA 4CZWA 2AU1A 5CHVA 2AYNA 5A24A 1BY8A 3MTNA 1POPA 4MI7A 4GUAA 5CVMA 2PNSA 3ERVA 3H8BA 3QT4A 1TU6A 1DEUA 4QRGA 5JH3A 1MDWA 3KWBX 4BQVA 2ATOA 1EWOA 1ZCMA 3IOQA 1TL9A 6PADA 1NB3A 3B79A 1KXRA 2YJ2A 2H7JA 4PADA 1ATKA 3ZUAA 3OVXA 3B21A 1YZBA 2JQGR 1Q6KA 2FT2A 4N4ZA 3H89A 1NL6A 1PPPA 2E02A 1BGOA 3PT2A 2DOSA 2DCCA 4R3DA 4Q8GA 4RF1A 1PIPA 4RF0A 3BOWA 8PCHA 2BTWB 2BTWA 3O65A 1AECA 2BU3A 2CB5A 3C9EA 5EGWA 1CPJA 1F29A 2FRQA 2AVWA 3OQCA 4HXDB 4I04A 3BPMA 2P0RA 1NQCA 2VHFA 4RKXA 3BPFA 2E01A 3OISA 3U8EA 1ME3A 3PSEA 1GLOA 1YK8A 1BQIA 4BSQA 1KHQA 1UKFA 4QBBA 3TRKA 1U9XA 4ZUXU 2OULA 5E6JA 1SNKA 1QDQA 3CBJA 1AU3A 1VJVA 1AU0A 1U9VA 2HD5A 1K3BB 3P5UA 4I05A 1CVZA 3H7DA 3MHHA 1F2BA 3H6SA 2DZYA 3DF0A 4BOSA 4BS5A 3KFQA 1O0EA 2NQIA 4YYSA 3KSEA 1AIMA 4PT5A 3WXGA 1SP4B 1NB5A 2XU1A 1Y4HA 3OVZA 2UZJA 4HWYA 4D8EA 5EZSA 4WA6A 4IP3A 1ZIVA 3PHUA 1KFUL 2P86A 2FUDA 1GECE 4BS6A 4G54A 2YJ8A 2HXZA 3MHSA 2R9FA 2Z84A 1YVBA 3HHIA 4W5BA 4YVAA 4ZTBA 4XUIA 2ARYA 3W31A 1QOLA 2G6DA 3RVXA 3PW3A 4REZA 2OZ2A 5FPWA 1NLJA 3IEJA 1AU4A 5CVNB 1ICFA 2B1NA 3QSDA 2DCBA 1EF7A 1GMYA 3N3KA 7PCKA 4RY2A 1Y08A 4QRXA 4CDFB 4M0WA 3E1ZB 2B1MA 4YYQA 3P5VA 2F1GA 1EWPA 3BCNA 3I06A 4D8IA 1PE6A 2DC8A 5EZQA 2JRIA 1TLOA 4P16A 3PDFA 2AGAA 3RVVA 2R9OA 3N3GA 4I07A 2IBIA 2DCDA 2XU3A 4WURA 4RNAA 3V6CA 1PCIA 3BC3A 2J7QA 3K9MA 1ME4A 3BBAA 4A5UA 3HD3A 3MORA 3WXEA 2PBHA 1U5IA 3PBHA 3MJ5A 1YK7A 1EWMA 5K16A 2GHUA 1VSNA 2CIOA 4YYUA 4YV8A 1F2AA 3S3QA
chains in the Genus database with same CATH topology
1AYUA 3BWKA 9PAPA 4YYVA 2O6XA 2DZZA 2Y5BA 1PPDA 1QXPA 3F5VA 4CDCB 2DC6A 3LFYA 2AUXA 2AS8A 3F75A 1PADA 1PXVA 3V6EA 1AYVA 2BDZA 4QRVA 3RVWA 4XR7A 3M99A 3N4CA 1PPNA 1KFXL 3IUTA 3LXSA 4N79A 4X6IA 1A6RA 2VHSA 3O1GA 3D6SA 1CQDA 3HWNA 4X6HA 4AXLA 2XU4A 2JQFR 2HHNA 1IWDA 1AYWA 2C0YA 4DMYA 3CBKA 1FH0A 3I3TA 3KWZA 5PADA 1GCBA 1MHWA 5CVOB 3NHEA 2E00A 1CB5A 3PNRA 2G7YA 2YJBA 2HH5A 1XKGA 4P6GA 2FO5A 4P6EA 1U9WA 4Q8HA 3P5XA 3OF9A 4YYWA 3KX1A 4FJCA 3AI8A 4NV7A 4AXMA 1MEMA 3IV2A 2DJFB 3CH3X 1ITOA 2IPPB 1CTEA 4X6JA 2R9CA 3GCBA 2E03A 3H8CA 2YJCA 1W5RA 4W4UA 1MEGA 2FTDA 3KKUA 3IMAA 2G8EA 2DC7A 4PP2E 5F02A 3K24A 5J94A 1CJLA 1M6DA 4GUZA 1HUCB 3QJ3A 1S4VA 1AU2A 1JQPA 1THEA 2XU5A 3LTWA 5EF4A 2Y6EA 2DC9A 3KW9A 1YALA 1EWLA 2R9NA 3K8UA 4OEMA 4FIPA 4DMXA 4PI3A 1X9YA 2OP3A 2VFCA 1YT7A 1MS6A 1CS8A 1CSBB 1U9QX 4QH6A 2NQAA 2R9MA 2FRAA 2FYEA 1E2TA 3TNXA 1BP4A 2P7UA 3IHPA 4N8WA 2PREA 4MZSA 2R6NA 2G8JA 4FK5A 5JA7A 5CHTA 1STFE 1MIRA 3CH2X 1DF0A 2F7DA 3WXFA 2BDLA 4K7CA 2ACTA 2FQ9A 1QMYA 2PADA 4KLBA 3S3RA 2DCAA 4W5CA 2WBFX 2GFOA 3OF8A 1GX3A 3HHAA 4PP1A 2DJGB 3O0UA 3P5WA 2NQDB 2AIMA 2YJ9A 1KHPA 1W4TA 1F2CA 1PBHA 4CDDB 2AUZA 1PPOA 4YYRA 4BPVA 1CV8A 3USVA 4MSXA 1W6FA 4CDEB 4MZOA 1NPZA 4OELA 2AYOA 2NQGA 4CZWA 2AU1A 5CHVA 2AYNA 5A24A 1BY8A 3MTNA 1POPA 5CVMA 2PNSA 3ERVA 3H8BA 3QT4A 1TU6A 1DEUA 4QRGA 5JH3A 1MDWA 3KWBX 4BQVA 2ATOA 1EWOA 1ZCMA 3IOQA 1TL9A 6PADA 1NB3A 3B79A 1KXRA 2YJ2A 2H7JA 4PADA 1ATKA 3ZUAA 3OVXA 2JQGR 1Q6KA 2FT2A 4N4ZA 3H89A 4NV8A 1NL6A 1PPPA 2E02A 1BGOA 2DCCA 4Q8GA 1PIPA 3BOWA 8PCHA 1AECA 2CB5A 3C9EA 5EGWA 1CPJA 1F29A 2FRQA 2AVWA 2VFBA 4I04A 3BPMA 2P0RA 3D9WA 1NQCA 2VHFA 3BPFA 2E01A 3OISA 3U8EA 1ME3A 1GLOA 1YK8A 1BQIA 4BSQA 1KHQA 4QBBA 1U9XA 4ZUXU 2OULA 1SNKA 1QDQA 3CBJA 1AU3A 1VJVA 1AU0A 1U9VA 2HD5A 1K3BB 3P5UA 4I05A 1CVZA 3H7DA 3MHHA 1F2BA 3H6SA 2DZYA 3DF0A 4BS5A 3KFQA 1O0EA 2NQIA 4YYSA 2BSZA 3KSEA 1AIMA 3WXGA 1SP4B 1NB5A 2XU1A 1Y4HA 3OVZA 4HWYA 4WA6A 1ZIVA 1KFUL 2P86A 2FUDA 1GECE 4BS6A 4G54A 2YJ8A 2HXZA 3MHSA 2R9FA 4W5BA 1YVBA 3HHIA 4YVAA 4XUIA 2ARYA 1QOLA 2G6DA 3RVXA 3PW3A 2OZ2A 5FPWA 1NLJA 3IEJA 1AU4A 5CVNB 1ICFA 2B1NA 3QSDA 2DCBA 1EF7A 1GMYA 3N3KA 7PCKA 4RY2A 1Y08A 4QRXA 4CDFB 3E1ZB 2B1MA 4YYQA 3P5VA 2F1GA 1EWPA 3BCNA 3I06A 1PE6A 2DC8A 1TLOA 4C5PA 3PDFA 3RVVA 2R9OA 3N3GA 4I07A 2IBIA 2DCDA 2XU3A 3V6CA 1PCIA 3BC3A 3K9MA 1ME4A 3HD3A 3MORA 3WXEA 2PBHA 1U5IA 3PBHA 4B55A 1YK7A 1EWMA 5K16A 2GHUA 1VSNA 2CIOA 4YYUA 4YV8A 4BGFA 1F2AA 3S3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AYU A;  3BWK A;  9PAP A;  4YYV A;  2O6X A;  2DZZ A;  2Y5B A;  1PPD A;  1QXP A;  3F5V A;  4CDC B;  2DC6 A;  3LFY A;  2AUX A;  2AS8 A;  3F75 A;  1PAD A;  1PXV A;  3V6E A;  1AYV A;  2BDZ A;  4QRV A;  3RVW A;  4XR7 A;  3M99 A;  3N4C A;  1PPN A;  1KFX L;  3IUT A;  3LXS A;  4N79 A;  4X6I A;  1A6R A;  2VHS A;  3O1G A;  3D6S A;  1CQD A;  3HWN A;  4X6H A;  4AXL A;  2XU4 A;  2JQF R;  2HHN A;  1IWD A;  1AYW A;  2C0Y A;  4DMY A;  3CBK A;  1FH0 A;  3I3T A;  3KWZ A;  5PAD A;  1GCB A;  1MHW A;  5CVO B;  3NHE A;  2E00 A;  1CB5 A;  3PNR A;  2G7Y A;  2YJB A;  2HH5 A;  1XKG A;  4P6G A;  2FO5 A;  4P6E A;  1U9W A;  4Q8H A;  3P5X A;  3OF9 A;  4YYW A;  3KX1 A;  4FJC A;  3AI8 A;  4AXM A;  1MEM A;  3IV2 A;  2DJF B;  3CH3 X;  1ITO A;  2IPP B;  1CTE A;  4X6J A;  2R9C A;  3GCB A;  2E03 A;  3H8C A;  2YJC A;  4W4U A;  1MEG A;  2FTD A;  3KKU A;  3IMA A;  2G8E A;  2DC7 A;  4PP2 E;  5F02 A;  3K24 A;  5J94 A;  1CJL A;  1M6D A;  1HUC B;  3QJ3 A;  1S4V A;  1AU2 A;  1JQP A;  1THE A;  2XU5 A;  5EF4 A;  2Y6E A;  2DC9 A;  3KW9 A;  1YAL A;  1EWL A;  2R9N A;  3K8U A;  4OEM A;  4FIP A;  4DMX A;  4PI3 A;  1X9Y A;  2OP3 A;  1YT7 A;  1MS6 A;  1CS8 A;  1CSB B;  1U9Q X;  4QH6 A;  2NQA A;  2R9M A;  2FRA A;  2FYE A;  3TNX A;  1BP4 A;  2P7U A;  3IHP A;  4N8W A;  2PRE A;  4MZS A;  2R6N A;  2G8J A;  4FK5 A;  5JA7 A;  5CHT A;  1STF E;  1MIR A;  3CH2 X;  1DF0 A;  2F7D A;  3WXF A;  2BDL A;  4K7C A;  2ACT A;  2FQ9 A;  1QMY A;  2PAD A;  4KLB A;  3S3R A;  2DCA A;  4W5C A;  2WBF X;  2GFO A;  3OF8 A;  3HHA A;  4PP1 A;  2DJG B;  3O0U A;  3P5W A;  2NQD B;  2AIM A;  2YJ9 A;  1KHP A;  1F2C A;  1PBH A;  4CDD B;  2AUZ A;  1PPO A;  4YYR A;  4BPV A;  1CV8 A;  3USV A;  4MSX A;  4CDE B;  4MZO A;  1NPZ A;  4OEL A;  2AYO A;  2NQG A;  4CZW A;  2AU1 A;  5CHV A;  2AYN A;  5A24 A;  1BY8 A;  3MTN A;  1POP A;  5CVM A;  2PNS A;  3ERV A;  3H8B A;  3QT4 A;  1TU6 A;  1DEU A;  4QRG A;  5JH3 A;  1MDW A;  3KWB X;  4BQV A;  2ATO A;  1EWO A;  1ZCM A;  3IOQ A;  1TL9 A;  6PAD A;  1NB3 A;  3B79 A;  1KXR A;  2YJ2 A;  2H7J A;  4PAD A;  1ATK A;  3ZUA A;  3OVX A;  2JQG R;  1Q6K A;  2FT2 A;  4N4Z A;  3H89 A;  1NL6 A;  1PPP A;  2E02 A;  1BGO A;  2DCC A;  4Q8G A;  1PIP A;  3BOW A;  8PCH A;  1AEC A;  2CB5 A;  3C9E A;  5EGW A;  1CPJ A;  1F29 A;  2FRQ A;  2AVW A;  4I04 A;  3BPM A;  2P0R A;  1NQC A;  2VHF A;  3BPF A;  2E01 A;  3OIS A;  3U8E A;  1ME3 A;  1GLO A;  1YK8 A;  1BQI A;  4BSQ A;  1KHQ A;  4QBB A;  1U9X A;  4ZUX U;  2OUL A;  1SNK A;  1QDQ A;  3CBJ A;  1AU3 A;  1VJV A;  1AU0 A;  1U9V A;  2HD5 A;  1K3B B;  3P5U A;  4I05 A;  1CVZ A;  3H7D A;  3MHH A;  1F2B A;  3H6S A;  2DZY A;  3DF0 A;  4BS5 A;  3KFQ A;  1O0E A;  2NQI A;  4YYS A;  3KSE A;  1AIM A;  3WXG A;  1SP4 B;  1NB5 A;  2XU1 A;  1Y4H A;  3OVZ A;  4HWY A;  4WA6 A;  1ZIV A;  1KFU L;  2P86 A;  2FUD A;  1GEC E;  4BS6 A;  4G54 A;  2YJ8 A;  2HXZ A;  3MHS A;  2R9F A;  4W5B A;  1YVB A;  3HHI A;  4YVA A;  4XUI A;  2ARY A;  1QOL A;  2G6D A;  3RVX A;  3PW3 A;  2OZ2 A;  5FPW A;  1NLJ A;  3IEJ A;  1AU4 A;  5CVN B;  1ICF A;  2B1N A;  3QSD A;  2DCB A;  1EF7 A;  1GMY A;  3N3K A;  7PCK A;  4RY2 A;  4QRX A;  1Y08 A;  4CDF B;  3E1Z B;  2B1M A;  4YYQ A;  3P5V A;  2F1G A;  1EWP A;  3BCN A;  3I06 A;  1PE6 A;  2DC8 A;  1TLO A;  3PDF A;  3RVV A;  2R9O A;  3N3G A;  4I07 A;  2IBI A;  2DCD A;  2XU3 A;  3V6C A;  1PCI A;  3BC3 A;  3K9M A;  1ME4 A;  3HD3 A;  3MOR A;  3WXE A;  2PBH A;  1U5I A;  3PBH A;  1YK7 A;  1EWM A;  5K16 A;  2GHU A;  1VSN A;  2CIO A;  4YYU A;  4YV8 A;  1F2A A;  3S3Q A; 
#chains in the Genus database with same CATH topology
 1AYU A;  3BWK A;  3MP2 A;  9PAP A;  4YYV A;  2O6X A;  2DZZ A;  2Y5B A;  1PPD A;  1QXP A;  3F5V A;  3PRM A;  4CDC B;  2DC6 A;  3LFY A;  2AUX A;  3MTV A;  3PRP A;  2AS8 A;  3F75 A;  1PAD A;  1PXV A;  4XZX A;  3V6E A;  1AYV A;  2BDZ A;  5KO3 A;  4QRV A;  3RVW A;  4XR7 A;  3M99 A;  3N4C A;  1PPN A;  1KFX L;  3IUT A;  3LXS A;  4N79 A;  4X6I A;  1A6R A;  2VHS A;  3PHX A;  3O1G A;  3TMP A;  3D6S A;  1CQD A;  3HWN A;  4X6H A;  2HWK A;  4AXL A;  2XU4 A;  2JQF R;  2HHN A;  1IWD A;  1AYW A;  2C0Y A;  4DMY A;  3CBK A;  1FH0 A;  3I3T A;  3KWZ A;  5PAD A;  4BOP A;  1GCB A;  1MHW A;  5CVO B;  3NHE A;  2E00 A;  1CB5 A;  3PNR A;  2G7Y A;  2YJB A;  2HH5 A;  1XKG A;  4P6G A;  2FO5 A;  4P6E A;  1U9W A;  4Q8H A;  3P5X A;  3OF9 A;  4YYW A;  3KX1 A;  4FJC A;  3AI8 A;  4AXM A;  1MEM A;  3IV2 A;  4IUM A;  2DJF B;  4BOQ A;  3CH3 X;  1ITO A;  2IPP B;  4MM3 B;  1CTE A;  4X6J A;  4BOZ A;  2R9C A;  3GCB A;  3RNV A;  2E03 A;  4OW0 A;  3H8C A;  2YJC A;  4W4U A;  1MEG A;  2FTD A;  3KKU A;  3IMA A;  2G8E A;  3E9S A;  2DC7 A;  4PP2 E;  5F02 A;  3K24 A;  5J94 A;  1CJL A;  1M6D A;  1HUC B;  3QJ3 A;  1S4V A;  1AU2 A;  1JQP A;  1THE A;  3PHW A;  2XU5 A;  5JZE A;  5EF4 A;  2Y6E A;  2DC9 A;  3KW9 A;  1YAL A;  1EWL A;  2R9N A;  4OVZ B;  4OVZ A;  3K8U A;  4D8B A;  4OEM A;  3BY4 A;  3IFU A;  4FIP A;  4DMX A;  4PI3 A;  1X9Y A;  2OP3 A;  1YT7 A;  1MS6 A;  1CS8 A;  1CSB B;  1U9Q X;  4QH6 A;  2NQA A;  2R9M A;  2FRA A;  2FYE A;  3TNX A;  1BP4 A;  2P7U A;  3IHP A;  4N8W A;  2PRE A;  4MZS A;  2R6N A;  2G8J A;  4FK5 A;  5JA7 A;  5CHT A;  1STF E;  1MIR A;  3CH2 X;  1DF0 A;  2F7D A;  3WXF A;  2BDL A;  2FQ9 A;  2ACT A;  2PAD A;  1QMY A;  4K7C A;  4KLB A;  3S3R A;  2J7Q C;  2DCA A;  4W5C A;  2WBF X;  2GFO A;  3OF8 A;  3HHA A;  2FE8 A;  4PP1 A;  2DJG B;  3O0U A;  3P5W A;  2NQD B;  2AIM A;  3C0R A;  2YJ9 A;  1DKI A;  1KHP A;  1F2C A;  3ZNH A;  1PBH A;  4CDD B;  2AUZ A;  1PPO A;  4YYR A;  2JTC A;  3W30 A;  4BPV A;  1CV8 A;  3USV A;  4MSX A;  1PVJ A;  4CDE B;  4MZO A;  1NPZ A;  4OEL A;  3BB7 A;  2AYO A;  2NQG A;  4BOU A;  4CZW A;  2AU1 A;  5CHV A;  2AYN A;  5A24 A;  1BY8 A;  3MTN A;  1POP A;  4MI7 A;  4GUA A;  5CVM A;  2PNS A;  3ERV A;  3H8B A;  3QT4 A;  1TU6 A;  1DEU A;  4QRG A;  5JH3 A;  1MDW A;  3KWB X;  4BQV A;  2ATO A;  1EWO A;  1ZCM A;  3IOQ A;  1TL9 A;  6PAD A;  1NB3 A;  3B79 A;  1KXR A;  2YJ2 A;  2H7J A;  4PAD A;  1ATK A;  3ZUA A;  3OVX A;  3B21 A;  1YZB A;  2JQG R;  1Q6K A;  2FT2 A;  4N4Z A;  3H89 A;  1NL6 A;  1PPP A;  2E02 A;  1BGO A;  3PT2 A;  2DOS A;  2DCC A;  4R3D A;  4Q8G A;  4RF1 A;  1PIP A;  4RF0 A;  3BOW A;  8PCH A;  2BTW B;  2BTW A;  3O65 A;  1AEC A;  2BU3 A;  2CB5 A;  3C9E A;  5EGW A;  1CPJ A;  1F29 A;  2FRQ A;  2AVW A;  3OQC A;  4HXD B;  4I04 A;  3BPM A;  2P0R A;  1NQC A;  2VHF A;  4RKX A;  3BPF A;  2E01 A;  3OIS A;  3U8E A;  1ME3 A;  3PSE A;  1GLO A;  1YK8 A;  1BQI A;  4BSQ A;  1KHQ A;  1UKF A;  4QBB A;  3TRK A;  1U9X A;  4ZUX U;  2OUL A;  5E6J A;  1SNK A;  1QDQ A;  3CBJ A;  1AU3 A;  1VJV A;  1AU0 A;  1U9V A;  2HD5 A;  1K3B B;  3P5U A;  4I05 A;  1CVZ A;  3H7D A;  3MHH A;  1F2B A;  3H6S A;  2DZY A;  3DF0 A;  4BOS A;  4BS5 A;  3KFQ A;  1O0E A;  2NQI A;  4YYS A;  3KSE A;  1AIM A;  4PT5 A;  3WXG A;  1SP4 B;  1NB5 A;  2XU1 A;  1Y4H A;  3OVZ A;  2UZJ A;  4HWY A;  4D8E A;  5EZS A;  4WA6 A;  4IP3 A;  1ZIV A;  3PHU A;  1KFU L;  2P86 A;  2FUD A;  1GEC E;  4BS6 A;  4G54 A;  2YJ8 A;  2HXZ A;  3MHS A;  2R9F A;  2Z84 A;  1YVB A;  3HHI A;  4W5B A;  4YVA A;  4ZTB A;  4XUI A;  2ARY A;  3W31 A;  1QOL A;  2G6D A;  3RVX A;  3PW3 A;  4REZ A;  2OZ2 A;  5FPW A;  1NLJ A;  3IEJ A;  1AU4 A;  5CVN B;  1ICF A;  2B1N A;  3QSD A;  2DCB A;  1EF7 A;  1GMY A;  3N3K A;  7PCK A;  4RY2 A;  1Y08 A;  4QRX A;  4CDF B;  4M0W A;  3E1Z B;  2B1M A;  4YYQ A;  3P5V A;  2F1G A;  1EWP A;  3BCN A;  3I06 A;  4D8I A;  1PE6 A;  2DC8 A;  5EZQ A;  2JRI A;  1TLO A;  4P16 A;  3PDF A;  2AGA A;  3RVV A;  2R9O A;  3N3G A;  4I07 A;  2IBI A;  2DCD A;  2XU3 A;  4WUR A;  4RNA A;  3V6C A;  1PCI A;  3BC3 A;  2J7Q A;  3K9M A;  1ME4 A;  3BBA A;  4A5U A;  3HD3 A;  3MOR A;  3WXE A;  2PBH A;  1U5I A;  3PBH A;  3MJ5 A;  1YK7 A;  1EWM A;  5K16 A;  2GHU A;  1VSN A;  2CIO A;  4YYU A;  4YV8 A;  1F2A A;  3S3Q A; 
#chains in the Genus database with same CATH homology
 1AYU A;  3BWK A;  9PAP A;  4YYV A;  2O6X A;  2DZZ A;  2Y5B A;  1PPD A;  1QXP A;  3F5V A;  4CDC B;  2DC6 A;  3LFY A;  2AUX A;  2AS8 A;  3F75 A;  1PAD A;  1PXV A;  3V6E A;  1AYV A;  2BDZ A;  4QRV A;  3RVW A;  4XR7 A;  3M99 A;  3N4C A;  1PPN A;  1KFX L;  3IUT A;  3LXS A;  4N79 A;  4X6I A;  1A6R A;  2VHS A;  3O1G A;  3D6S A;  1CQD A;  3HWN A;  4X6H A;  4AXL A;  2XU4 A;  2JQF R;  2HHN A;  1IWD A;  1AYW A;  2C0Y A;  4DMY A;  3CBK A;  1FH0 A;  3I3T A;  3KWZ A;  5PAD A;  1GCB A;  1MHW A;  5CVO B;  3NHE A;  2E00 A;  1CB5 A;  3PNR A;  2G7Y A;  2YJB A;  2HH5 A;  1XKG A;  4P6G A;  2FO5 A;  4P6E A;  1U9W A;  4Q8H A;  3P5X A;  3OF9 A;  4YYW A;  3KX1 A;  4FJC A;  3AI8 A;  4NV7 A;  4AXM A;  1MEM A;  3IV2 A;  2DJF B;  3CH3 X;  1ITO A;  2IPP B;  1CTE A;  4X6J A;  2R9C A;  3GCB A;  2E03 A;  3H8C A;  2YJC A;  1W5R A;  4W4U A;  1MEG A;  2FTD A;  3KKU A;  3IMA A;  2G8E A;  2DC7 A;  4PP2 E;  5F02 A;  3K24 A;  5J94 A;  1CJL A;  1M6D A;  4GUZ A;  1HUC B;  3QJ3 A;  1S4V A;  1AU2 A;  1JQP A;  1THE A;  2XU5 A;  3LTW A;  5EF4 A;  2Y6E A;  2DC9 A;  3KW9 A;  1YAL A;  1EWL A;  2R9N A;  3K8U A;  4OEM A;  4FIP A;  4DMX A;  4PI3 A;  1X9Y A;  2OP3 A;  2VFC A;  1YT7 A;  1MS6 A;  1CS8 A;  1CSB B;  1U9Q X;  4QH6 A;  2NQA A;  2R9M A;  2FRA A;  2FYE A;  1E2T A;  3TNX A;  1BP4 A;  2P7U A;  3IHP A;  4N8W A;  2PRE A;  4MZS A;  2R6N A;  2G8J A;  4FK5 A;  5JA7 A;  5CHT A;  1STF E;  1MIR A;  3CH2 X;  1DF0 A;  2F7D A;  3WXF A;  2BDL A;  4K7C A;  2ACT A;  2FQ9 A;  1QMY A;  2PAD A;  4KLB A;  3S3R A;  2DCA A;  4W5C A;  2WBF X;  2GFO A;  3OF8 A;  1GX3 A;  3HHA A;  4PP1 A;  2DJG B;  3O0U A;  3P5W A;  2NQD B;  2AIM A;  2YJ9 A;  1KHP A;  1W4T A;  1F2C A;  1PBH A;  4CDD B;  2AUZ A;  1PPO A;  4YYR A;  4BPV A;  1CV8 A;  3USV A;  4MSX A;  1W6F A;  4CDE B;  4MZO A;  1NPZ A;  4OEL A;  2AYO A;  2NQG A;  4CZW A;  2AU1 A;  5CHV A;  2AYN A;  5A24 A;  1BY8 A;  3MTN A;  1POP A;  5CVM A;  2PNS A;  3ERV A;  3H8B A;  3QT4 A;  1TU6 A;  1DEU A;  4QRG A;  5JH3 A;  1MDW A;  3KWB X;  4BQV A;  2ATO A;  1EWO A;  1ZCM A;  3IOQ A;  1TL9 A;  6PAD A;  1NB3 A;  3B79 A;  1KXR A;  2YJ2 A;  2H7J A;  4PAD A;  1ATK A;  3ZUA A;  3OVX A;  2JQG R;  1Q6K A;  2FT2 A;  4N4Z A;  3H89 A;  4NV8 A;  1NL6 A;  1PPP A;  2E02 A;  1BGO A;  2DCC A;  4Q8G A;  1PIP A;  3BOW A;  8PCH A;  1AEC A;  2CB5 A;  3C9E A;  5EGW A;  1CPJ A;  1F29 A;  2FRQ A;  2AVW A;  2VFB A;  4I04 A;  3BPM A;  2P0R A;  3D9W A;  1NQC A;  2VHF A;  3BPF A;  2E01 A;  3OIS A;  3U8E A;  1ME3 A;  1GLO A;  1YK8 A;  1BQI A;  4BSQ A;  1KHQ A;  4QBB A;  1U9X A;  4ZUX U;  2OUL A;  1SNK A;  1QDQ A;  3CBJ A;  1AU3 A;  1VJV A;  1AU0 A;  1U9V A;  2HD5 A;  1K3B B;  3P5U A;  4I05 A;  1CVZ A;  3H7D A;  3MHH A;  1F2B A;  3H6S A;  2DZY A;  3DF0 A;  4BS5 A;  3KFQ A;  1O0E A;  2NQI A;  4YYS A;  2BSZ A;  3KSE A;  1AIM A;  3WXG A;  1SP4 B;  1NB5 A;  2XU1 A;  1Y4H A;  3OVZ A;  4HWY A;  4WA6 A;  1ZIV A;  1KFU L;  2P86 A;  2FUD A;  1GEC E;  4BS6 A;  4G54 A;  2YJ8 A;  2HXZ A;  3MHS A;  2R9F A;  4W5B A;  1YVB A;  3HHI A;  4YVA A;  4XUI A;  2ARY A;  1QOL A;  2G6D A;  3RVX A;  3PW3 A;  2OZ2 A;  5FPW A;  1NLJ A;  3IEJ A;  1AU4 A;  5CVN B;  1ICF A;  2B1N A;  3QSD A;  2DCB A;  1EF7 A;  1GMY A;  3N3K A;  7PCK A;  4RY2 A;  1Y08 A;  4QRX A;  4CDF B;  3E1Z B;  2B1M A;  4YYQ A;  3P5V A;  2F1G A;  1EWP A;  3BCN A;  3I06 A;  1PE6 A;  2DC8 A;  1TLO A;  4C5P A;  3PDF A;  3RVV A;  2R9O A;  3N3G A;  4I07 A;  2IBI A;  2DCD A;  2XU3 A;  3V6C A;  1PCI A;  3BC3 A;  3K9M A;  1ME4 A;  3HD3 A;  3MOR A;  3WXE A;  2PBH A;  1U5I A;  3PBH A;  4B55 A;  1YK7 A;  1EWM A;  5K16 A;  2GHU A;  1VSN A;  2CIO A;  4YYU A;  4YV8 A;  4BGF A;  1F2A A;  3S3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...