4WA6A

Structure of yeast saga dubm with sgf73 n59d mutant at 2.36 angstroms resolution
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
471
structure length
440
Chain Sequence
MSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALNRQTGFIYLLTCAWKIQDAHEFWQFIINQIHQSYVLDLPNAKEVSRANNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNYHCGECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transcription
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
total genus 141
structure length 440
sequence length 471
chains with identical sequence D
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4wa6A01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4wa6A02
1PPOA 3S3QA 3LQJA 2VPEA 2F42A 2DZZA 3H6SA 4I07A 4N4FA 4Q6FA 5D1KB 1U9WA 3O0UA 4YYRA 4YAXA 2H7JA 2MD7B 1WENA 3HHAA 4V3LC 3CBJA 5G04B 1NQCA 1F2CA 1ME3A 2DZYA 2HDPA 1YT7A 8PCHA 2YU4A 2E01A 1AYWA 4N3WA 3ZTGA 3U5OA 1PPDA 4YV8A 2ECGA 3O70A 4CZWA 1TL9A 3N9OA 1WEQA 1EWMA 5CHVA 5KH9A 2FT2A 4GNFA 3N9LA 1CJLA 2B1NA 2LRIC 3E1ZB 3PHDA 3EB5A 2LGGA 2G45A 2O6XA 1WEWA 4DMYA 2BDZA 3H8BA 1NB5A 4F52B 4LLBA 1EF7A 3KV6A 3HHIA 1HUCB 3HTKC 5H1UA 4TKPB 1CS8A 3KQIA 4FJCA 1XKGA 2C2VS 3BOWA 1WEPA 4MZOA 4X6IA 2AUXA 2PREA 3HCUA 4AXLA 1LDJB 2G7YA 1VD4A 3C5KA 2FUIA 2H0DB 4A49A 1VYXA 3MHHA 1CPJA 1WESA 1PXVA 2AIMA 4I7CA 4BPVA 1SP4B 1WEVA 2Y6EA 3OF8A 2EGPA 1K3BB 2RI7A 2DCDA 3KNVA 2ACTA 2FO5A 2AUZA 3PURA 4LKAA 5J3XA 2ARYA 4QH6A 1KXRA 1CTEA 1ITOA 2C0YA 3FL2A 1K2FA 4WZ3B 5TBNA 2E03A 5B75A 3EB6A 1GMYA 5DKAA 4YADA 3OISA 5CVMA 5I3LA 5DINA 2Y1MA 3IEJA 3N4CA 2KIZA 3LRQA 4N79A 5TDWA 4QRGA 2E00A 1E4UA 2JMDA 4YC9A 1WEEA 2YW8A 1F62A 2DCCA 4X6HA 4R7EA 3ZYQA 1VSNA 1PIPA 2KFTA 4YBTA 3K8UA 3S3RA 1X4IA 5H1VA 2KREA 1PBHA 1VJVA 5B77A 2AN6A 1QMYA 1F29A 4AVXA 1U9VA 1U9XA 3CH2X 3H89A 4I7BA 2Y43A 1NLJA 1AU2A 3P5VA 4BS6A 2M6MA 2ECNA 4YBSA 1TLOA 2VJEB 3HD3A 2YURA 1WIMA 2LGVA 5LKTA 1NB3A 2D8SA 2KWJA 1NL6A 2QIZA 2R6NA 1LDKC 3K9MA 2NQDB 1MIRA 4CDDB 3KV5A 2K4DA 2BDLA 3I06A 3PNRA 3LQHA 5AIUA 5D1MB 5LKUA 1X9YA 4MSXA 4WZ2A 5CVNB 5FPWA 2P86A 1AECA 3QZVA 5B79A 3N9PA 1CB5A 2GHUA 4QBBA 2E02A 2Y5BA 2NQGA 1ZIVA 3SHBA 4LADB 4UP5A 2G8EA 3DPLR 1DVPA 4FO9A 1KHQA 1XWHA 2DCAA 3OVXA 2K16A 5H9MA 3KFQA 1MM3A 4C9ZA 5JA7A 3O33A 1KFUL 1ZCMA 3V6CA 2JRJA 2K1JA 2PADA 4YYSA 3O7AA 5G05B 4FIPA 2YSMA 2XU5A 4Q8HA 4ZDTA 2LQ6A 1WEUA 2CKLB 2M85A 3HCTA 1MHWA 2YREA 2OP3A 3KSEA 4CDEB 5PADA 2PNSA 2ZETC 3BWKA 1JM7A 4AUQB 5B8DA 4N4ZA 2F7DA 2LGKA 1WGMA 3BC3A 4QRVA 4MVTA 3SOUA 2FYEA 2YJCA 1HYIA 3RVWA 3KX1A 1N87A 1RMDA 5G0FA 2YJ8A 2CIOA 3ZPVE 2L43A 2DX8A 4P6GA 3BPMA 5H1TA 5LKXA 4PI3A 1HYJA 2XU1A 2DC7A 5F02A 3H7DA 3L1ZB 4CDCB 2VPDA 1JQPA 2E6SA 3N9MA 4WA6A 2QICA 3I2DA 2VPGA 1MDWA 2DC6A 4YYQA 5TABA 4PPEA 2FRQA 4CA1A 3DQVR 4WZ0A 2XU3A 5EF4A 5C13A 1WEMA 3O37A 1AIMA 2BAYA 2KWOA 4G54A 2YJ9A 3O1GA 5FEYA 4GNEA 2L80A 3IOQA 4HWYA 4XI1A 3P5XA 1NPZA 4P6EA 2FSAA 2LXHC 3ZNIA 5FB1A 2YQMA 4X3GA 1PCIA 1PE6A 4AYCB 3ASLA 1MEGA 3I3TA 3BPFA 4IC2A 4PTBA 4YATA 3SOWA 2LGLA 2PBHA 1CSBB 2KGIA 4I05A 5K16A 1IWDA 2K17A 3RVVA 4GB0A 3P5WA 1A6RA 3WXGA 2IDAA 4QF2A 5JH3A 3H8CA 3SOXA 4PP2E 1BORA 2FUUA 2YSJA 2R9MA 2FUDA 3V43A 1EWPA 2CSYA 1BQIA 2YJ2A 5KH7A 4XUIA 2KYUA 2MD8C 3PW3A 1AYVA 4BHWA 1KFXL 1QDQA 5CVOB 4CDFB 5D1LB 2YT5A 5B78A 2R9FA 3GV4A 3IV2A 2QJ0A 3C9EA 2YUCA 1THEA 2YQLA 3N9NA 4BBQA 3MTNA 2YHNA 4O64A 1JOCA 3RTRB 3PUQA 3BCNA 5J94A 4IC3A 2IPPB 5FERA 2F6NA 3F5VA 5EGWA 2KWNA 3CH3X 4AXMA 2AU1A 5CHTA 3LQIA 2HXZA 2JQGR 4I04A 1X4JA 3M63A 2M1RA 3O35A 1QOLA 2R9NA 3ERVA 2DCBA 1Z6UA 3MHSA 2I50A 1F2AA 2E6RA 4L58A 2ECTA 4W5BA 1AU4A 2VPBA 2NAAA 2VJFB 1BY8A 1S4VA 1STFE 3TNXA 2JMJA 1X4UA 1U6GB 4UP0A 4V3KC 2P0RA 2F1GA 4S3OC 3C6WA 4YBMA 2KE1A 2HD5A 3U8EA 3OF9A 3USVA 3HWNA 2CKLA 3RPGC 2DJFB 2L5UA 1Z2QA 2LN0A 1MS6A 3HCSA 2MA6A 3VK6A 2R9CA 4OELA 3GL6A 4YYWA 3NHEA 2CSZA 1PPPA 9PAPA 2MUMA 4A0CD 5C11A 5FB0A 1Q6KA 2ECJA 4ZUXU 4RY2A 5LCWB 3IMAA 4LJNA 5AITA 2FTDA 1EWOA 2MIQA 4GNGA 1KHPA 2CB5A 6PADA 3KKUA 2EA6A 2Y1NA 2JQFR 1AU3A 4YABA 1GLOA 7PCKA 2OZ2A 4AYCA 4ZQLA 3V6EA 2C2LA 1CQDA 3F75A 4A4CA 3B79A 1WEOA 1T1HA 1BGOA 4QF3A 4QRXA 1V87A 4PADA 4S3OB 3D6SA 1IYMA 3ZVYA 4N8WA 5LKZA 4A4BA 1PPNA 4NN2A 4W4UA 3N3GA 2CT2A 1Y08A 4BQVA 3RPGB 4B86C 1ICFA 2L75A 1FH0A 2G6QA 5A24A 1TU6A 1DF0A 4BSQA 1POPA 4UI9B 1ATKA 3ZPV1 3M62A 1ZBDB 2YJBA 4YYVA 3LFYA 3IUTA 2PUYA 2XEUA 1GCBA 3QJ3A 1GECE 3KWBX 1JM7B 3KWZA 2L0BA 3T7LA 4AP4A 1CVZA 3L1XA 3LXSA 1QXPA 2EODA 2M3HA 1U5IA 4YYUA 2NQAA 2R9OA 4L7XA 2LXPC 2MNZA 3O36A 2KR4A 3NG2A 2GFOA 1AU0A 4XR7A 2G43A 2HYED 5EYAF 5B76A 2LDRA 3QT4A 4R2YA 1YVBA 4Q8GA 3M99A 2AYNA 3ZVZB 2DC8A 2P7UA 3QSDA 1Y4HA 2ECWA 1BP4A 3U5MA 2KU3A 1O0EA 2MT5A 1PADA 4R8PK 2B1MA 2G6DA 2G8JA 3U5PA 1ME4A 1YK7A 4CCGX 2OXQC 1DEUA 5TRBA 2OULA 2WBFX 3GCBA 2NQIA 5TDRA 1FBVA 1U9QX 3T6RA 3WXEA 2VHFA 2UZGA 3O34A 3AI8A 1EWLA 2KGGA 2HH5A 3N3KA 2ECIA 1M6DA 2ATOA 2FQ9A 2KWKA 3N9QA 4K7CA 1AYUA 3ZUAA 1F2BA 4I7DA 4W5CA 4MZSA 4B7YC 2MA5A 4FK5A 1CV8A 2DJGB 3OVZA 5KH3A 2LV9A 2IBIA 2AYOA 2VJEA 3KW9A 3U5NA 2XB1A 2MNYA 1MEMA 3CBKA 4GNDA 4DMXA 2VJFA 1YK8A 4PP1A 2YYRA 1CHCA 3RVXA 1VFYA 2F6JA 3P5UA 2H0DA 3PDFA 2ECVA 3PBHA 1YALA 1SNKA 4X6JA 2AVWA 2DC9A 2HHNA 3DF0A 1Z60A 3WXFA 1WILA 2RSDA 4KLBA 3IHPA 4OEMA 3MORA 4P5OB 2JMIA 2VP7A 2YHOA 4YVAA 2FRAA 2VNFA 1G25A 4LK9A 2VHSA 1WE9A 3L11A 1WFKA 5JG6A 2AS8A 3K24A 2XU4A 1FP0A 1MM2A 4BS5A 2PNXA
chains in the Genus database with same CATH superfamily
1PPOA 3Q1DA 3PT2A 3S3QA 3LQJA 1DKIA 2VPEA 3B21A 2F42A 2DZZA 3H6SA 4I07A 4N4FA 4Q6FA 4IP3A 5D1KB 1U9WA 3O0UA 4YYRA 4YAXA 2H7JA 2MD7B 1WENA 3HHAA 4V3LC 3CBJA 5G04B 1NQCA 1F2CA 1ME3A 2DZYA 4REZA 2HDPA 1YT7A 8PCHA 2YU4A 2E01A 1AYWA 4N3WA 3ZTGA 3U5OA 3C0RA 1PPDA 4YV8A 2ECGA 3O70A 4CZWA 3FAOA 1TL9A 3N9OA 1WEQA 1EWMA 5CHVA 5KH9A 2FT2A 4GNFA 3N9LA 1CJLA 2B1NA 2LRIC 3E1ZB 2J7QA 3FM8C 3PHDA 3EB5A 2LGGA 3TRKA 2G45A 4RNAA 2O6XA 1WEWA 3MDBC 4DMYA 2BDZA 3H8BA 1NB5A 4F52B 4LLBA 3O65A 1EF7A 3KV6A 3HHIA 1HUCB 3HTKC 4PT5A 5H1UA 4TKPB 1CS8A 2UZJA 3KQIA 4FJCA 1XKGA 2C2VS 3BOWA 1WEPA 3PRPA 4MZOA 4X6IA 2AUXA 2PREA 3HCUA 4AXLA 1LDJB 2G7YA 1VD4A 3C5KA 2FUIA 2H0DB 4A49A 2XOYA 1VYXA 3MHHA 1CPJA 1WESA 1PXVA 2AIMA 4I7CA 4BPVA 1SP4B 1WEVA 2Y6EA 3OF8A 2EGPA 1K3BB 2RI7A 2DCDA 2B0OE 3KNVA 2ACTA 2FO5A 2AUZA 3PURA 4LKAA 5J3XA 2ARYA 4QH6A 1KXRA 1CTEA 2E61A 1ITOA 2C0YA 3FL2A 1K2FA 4WZ3B 5TBNA 2E03A 5B75A 3EB6A 1GMYA 5DKAA 4YADA 3PRMA 3OISA 5CVMA 5I3LA 5DINA 2Y1MA 3IEJA 3N4CA 2KIZA 3LRQA 4N79A 4OGCA 2L7PA 5TDWA 4QRGA 2E00A 1E4UA 2JMDA 4YC9A 1WEEA 2YW8A 1F62A 2DCCA 4X6HA 4R7EA 3ZYQA 1YZBA 1VSNA 1PIPA 2KFTA 4YBTA 3K8UA 3S3RA 1X4IA 5H1VA 2KREA 1PBHA 1VJVA 5B77A 2AN6A 1QMYA 1F29A 5SVXA 4AVXA 1U9VA 1U9XA 3CH2X 3H89A 4I7BA 2Y43A 1NLJA 1AU2A 4WURA 3P5VA 4BS6A 2M6MA 2D8UA 2ECNA 4YBSA 4XZXA 1TLOA 2VJEB 3T9KA 3HD3A 2YURA 1WIMA 2LGVA 5LKTA 1NB3A 2M13A 2D8SA 2KWJA 1NL6A 2QIZA 2R6NA 1LDKC 2JRIA 2RR4A 3K9MA 2XOZA 2NQDB 3MP2A 1MIRA 4CDDB 3KV5A 2K4DA 2BDLA 3I06A 3PNRA 3LQHA 3ZNHA 2KKYA 5AIUA 5D1MB 5LKUA 1X9YA 4MSXA 4OVZA 4WZ2A 5CVNB 3RNVA 4P16A 2P86A 1AECA 5EZSA 5FPWA 3QZVA 4GUAA 5B79A 3N9PA 1CB5A 2GHUA 4QBBA 2E02A 2Y5BA 2NQGA 1ZIVA 3SHBA 4LADB 4UP5A 2G8EA 3DPLR 1DVPA 4FO9A 1KHQA 4HXDB 1XWHA 2DCAA 3OVXA 2K16A 5H9MA 3KFQA 1MM3A 4C9ZA 5JA7A 3O33A 1KFUL 2OWAA 3MTVA 1ZCMA 3V6CA 2LAUA 3W31A 2JRJA 5SVYA 2CRRA 2K1JA 2PADA 2JM3A 4YYSA 3O7AA 5G05B 4FIPA 2YSMA 2XU5A 4Q8HA 4ZDTA 2LQ6A 1WEUA 2CKLB 2M85A 3HCTA 1MHWA 2YREA 2OP3A 3KSEA 4R3DA 5PADA 4CDEB 2PNSA 2ZETC 3BWKA 1JM7A 4AUQB 5B8DA 4N4ZA 2F7DA 2LGKA 1WGMA 3BC3A 4QRVA 4MVTA 3SOUA 4D8EA 2FYEA 2YJCA 1HYIA 3RVWA 3KX1A 4BOPA 5KO3A 1N87A 1RMDA 5G0FA 2YJ8A 2CIOA 2L43A 3ZPVE 2DX8A 4P6GA 3BPMA 5H1TA 5LKXA 4PI3A 1HYJA 2XU1A 2CRWA 2DC7A 5F02A 3H7DA 3L1ZB 4CDCB 2VPDA 1JQPA 2E6SA 3N9MA 4WA6A 2QICA 3I2DA 2VPGA 1MDWA 2CONA 2DC6A 4YYQA 5TABA 2FFWA 4PPEA 3PSEA 2FRQA 4CA1A 3DQVR 4MM3B 4WZ0A 2XU3A 5EF4A 5C13A 1WEMA 3O37A 1AIMA 2BAYA 2KWOA 2HWKA 4G54A 3E2DA 2YJ9A 3O1GA 5FEYA 4GNEA 2L80A 3IOQA 4HWYA 4XI1A 3P5XA 3BY4A 1NPZA 4P6EA 2FSAA 2LXHC 3ZNIA 5FB1A 2YQMA 4X3GA 3SUBA 1PCIA 1PE6A 2BTWA 3TMPA 4OW0A 4AYCB 3ASLA 3FJUB 1MEGA 3I3TA 3BPFA 4IC2A 4PTBA 4YATA 3SOWA 2IQJA 2LGLA 3JUEA 4RF1A 2PBHA 1CSBB 3DDTA 2KGIA 4ZTBA 4I05A 5K16A 1IWDA 2K17A 3RVVA 4GB0A 3P5WA 1A6RA 3WXGA 4F1PA 2IDAA 4QF2A 5JH3A 4O62A 3H8CA 4A5UA 3SOXA 4PP2E 1BORA 3IFUA 2FUUA 2YSJA 2R9MA 2FUDA 3V43A 1EWPA 3BB7A 1PVJA 2CSYA 1BQIA 3E9SA 2YJ2A 3FANA 5KH7A 4XUIA 2KYUA 2MD8C 3PW3A 1AYVA 3BBAA 3H7HA 4BHWA 1KFXL 1QDQA 5CVOB 4CDFB 5D1LB 2YT5A 5B78A 2R9FA 3GV4A 3IV2A 2QJ0A 3C9EA 2YUCA 1THEA 2YQLA 3N9NA 4BBQA 3MTNA 2DJAA 2YHNA 4O64A 4BOSA 1JOCA 3RTRB 3PUQA 3BCNA 5J94A 4IC3A 2IPPB 5FERA 2F6NA 3F5VA 5EGWA 5EZQA 2KWNA 3CH3X 4AXMA 2AU1A 5CHTA 4Z0RA 4BOQA 3LQIA 2HXZA 2JQGR 4I04A 1X4JA 3M63A 2M1RA 3O35A 1QOLA 1UKFA 2R9NA 2JTCA 2EXUA 3ERVA 2DCBA 1Z6UA 3MHSA 4QQ4A 2I50A 1F2AA 2E6RA 2XOCA 4L58A 2ECTA 4W5BA 1AU4A 2VPBA 2NAAA 2VJFB 5E6JA 1BY8A 1S4VA 1STFE 3TNXA 2FE8A 2JMJA 1X4UA 1U6GB 4UP0A 4V3KC 3LJUX 4D8BA 3PHXA 2P0RA 2F1GA 4S3OC 3C6WA 4Z0OA 4YBMA 2KE1A 2HD5A 3U8EA 3OF9A 1MBMA 3USVA 5K3QA 3HWNA 2CKLA 3RPGC 3MJ5A 2DJFB 2L5UA 1Z2QA 2LN0A 1MS6A 3HCSA 2MA6A 3VK6A 2R9CA 4OELA 3GL6A 4YYWA 3NHEA 2CSZA 3FEHA 1PPPA 9PAPA 2MUMA 4A0CD 5C11A 5FB0A 1Q6KA 2ECJA 4ZUXU 4RY2A 5LCWB 3IMAA 4LJNA 5AITA 2FTDA 1EWOA 2MIQA 4GNGA 1KHPA 2CB5A 6PADA 3KKUA 3DWDA 2EA6A 2Y1NA 2JQFR 1AU3A 4YABA 4D8IA 1GLOA 4MI7A 7PCKA 2OZ2A 4AYCA 4ZQLA 3V6EA 2C2LA 1CQDA 3F75A 4A4CA 3B79A 1WEOA 1T1HA 2MKEA 4QF3A 1BGOA 1V87A 2BU3A 4S3OB 2DOSA 3D6SA 4PADA 4RF0A 2KKXA 1IYMA 3ZVYA 4OGEA 4N8WA 5LKZA 5SVIA 4A4BA 1PPNA 4BOZA 4NN2A 4W4UA 3N3GA 2CT2A 1Y08A 4BQVA 3W30A 3OQCA 3RPGB 4B86C 3M7KA 1ICFA 2L75A 1FH0A 2G6QA 5A24A 1TU6A 2BTWB 1DF0A 4BSQA 3O47A 1POPA 4UI9B 1ATKA 3ZPV1 3M62A 1ZBDB 2YJBA 4YYVA 3LFYA 3IUTA 2PUYA 2XEUA 1GCBA 3KDEC 3QJ3A 1GECE 3KWBX 1JM7B 3KWZA 2L0BA 3T7LA 4AP4A 1CVZA 2P57A 3L1XA 3LXSA 1QXPA 3PHWA 4QRXA 4BOUA 2CSVA 2EODA 2M3HA 1U5IA 4YYUA 2NQAA 2R9OA 1DCQA 2FD4A 4L7XA 2LXPC 2MNZA 2AGAA 3O36A 2KR4A 3NG2A 2YVRA 2GFOA 1AU0A 4XR7A 2G43A 2HYED 5EYAF 5B76A 2LDRA 3QT4A 4M0WA 4R2YA 1YVBA 4Q8GA 3M99A 2AYNA 3ZVZB 2DC8A 2P7UA 3QSDA 5JZEA 1Y4HA 2ECWA 1BP4A 3U5MA 2KU3A 1O0EA 2MT5A 1PADA 4R8PK 3LVRE 2B1MA 2G6DA 2G8JA 3U5PA 1ME4A 1YK7A 4CCGX 2OXQC 1DEUA 5TRBA 2OULA 2WBFX 2J7QC 3GCBA 3LDYA 2NQIA 5TDRA 2Z84A 1FBVA 1U9QX 3T6RA 3WXEA 2VHFA 2UZGA 3O34A 3AI8A 1EWLA 2KGGA 2HH5A 3N3KA 2DSMA 2ECIA 3LVQE 1M6DA 2KWKA 3N9QA 2ATOA 1AYUA 2FQ9A 5SVIB 1F2BA 4I7DA 4K7CA 4W5CA 3ZUAA 4H9DA 4MZSA 4B7YC 2MA5A 4FK5A 1CV8A 2DJGB 3OVZA 5KH3A 2LV9A 2IBIA 2AYOA 2VJEA 3KW9A 3U5NA 2XB1A 2MNYA 1MEMA 3CBKA 3PHUA 4GNDA 4DMXA 3PLWA 4RKXA 4IUMA 2VJFA 1YK8A 4PP1A 2YYRA 1CHCA 3RVXA 4OVZB 1VFYA 2F6JA 3P5UA 2H0DA 3PDFA 2ECVA 3PBHA 1YALA 1SNKA 4X6JA 2AVWA 2DC9A 2HHNA 3DF0A 1Z60A 2EGMA 3WXFA 1WILA 2RSDA 2JUNA 2XP0A 4KLBA 3IHPA 4OEMA 3MORA 4P5OB 2JMIA 2VP7A 2YHOA 4YVAA 2FRAA 2VNFA 1G25A 4LK9A 2VHSA 1WE9A 3L11A 1WFKA 5JG6A 2AS8A 3K24A 2XU4A 1FP0A 1MM2A 4BS5A 2PNXA
chains in the Genus database with same CATH topology
1PPOA 3S3QA 3LQJA 2VPEA 2F42A 2DZZA 3H6SA 4I07A 4N4FA 4Q6FA 5D1KB 1U9WA 3O0UA 4YYRA 4YAXA 2H7JA 2MD7B 1WENA 3HHAA 4V3LC 3CBJA 5G04B 1NQCA 1F2CA 1ME3A 2DZYA 2HDPA 1YT7A 8PCHA 2YU4A 2E01A 1AYWA 4N3WA 3ZTGA 3U5OA 1PPDA 4YV8A 2ECGA 3O70A 4CZWA 1TL9A 3N9OA 1WEQA 1EWMA 5CHVA 5KH9A 2FT2A 4GNFA 3N9LA 1CJLA 2B1NA 2LRIC 3E1ZB 3PHDA 3EB5A 2LGGA 2G45A 2O6XA 1WEWA 4DMYA 2BDZA 3H8BA 1NB5A 4F52B 4LLBA 1EF7A 3KV6A 3HHIA 1HUCB 4BGFA 3HTKC 5H1UA 4TKPB 3LTWA 1CS8A 3KQIA 4FJCA 1XKGA 2C2VS 3BOWA 1WEPA 4MZOA 4X6IA 2AUXA 2PREA 3HCUA 4AXLA 1LDJB 2G7YA 1VD4A 3C5KA 2FUIA 2H0DB 4A49A 1VYXA 3MHHA 1CPJA 1WESA 1PXVA 2AIMA 4I7CA 4BPVA 1SP4B 1WEVA 2Y6EA 3OF8A 2EGPA 1K3BB 2RI7A 2DCDA 3KNVA 2ACTA 2FO5A 2AUZA 3PURA 4GUZA 4LKAA 5J3XA 2ARYA 4QH6A 1KXRA 1CTEA 1ITOA 2C0YA 3FL2A 1K2FA 4WZ3B 5TBNA 2E03A 5B75A 3EB6A 1GMYA 5DKAA 4YADA 3OISA 5CVMA 5I3LA 5DINA 2Y1MA 1W4TA 3IEJA 3N4CA 2KIZA 3LRQA 4N79A 5TDWA 4QRGA 2E00A 1E4UA 2JMDA 4YC9A 1WEEA 2YW8A 1F62A 2DCCA 4X6HA 4R7EA 3ZYQA 1VSNA 2VFCA 1PIPA 2KFTA 4YBTA 3K8UA 3S3RA 1X4IA 5H1VA 2KREA 1PBHA 1GX3A 1VJVA 5B77A 2AN6A 1QMYA 1F29A 4AVXA 1U9VA 1U9XA 4B55A 3CH2X 3H89A 4I7BA 2Y43A 1NLJA 1AU2A 1E2TA 3P5VA 4BS6A 2M6MA 2ECNA 4YBSA 1TLOA 2VJEB 3HD3A 2YURA 1WIMA 2LGVA 5LKTA 1NB3A 2D8SA 2KWJA 1NL6A 2QIZA 2R6NA 1LDKC 3K9MA 2NQDB 1MIRA 4CDDB 3KV5A 2K4DA 2BDLA 3I06A 3PNRA 3LQHA 4NV8A 5AIUA 5D1MB 5LKUA 1X9YA 4MSXA 4WZ2A 5CVNB 5FPWA 2P86A 1AECA 3QZVA 5B79A 3N9PA 1CB5A 2GHUA 4QBBA 2E02A 2Y5BA 2NQGA 1ZIVA 3SHBA 4LADB 4UP5A 2G8EA 3DPLR 1DVPA 4FO9A 1KHQA 1XWHA 2DCAA 3OVXA 2K16A 5H9MA 3KFQA 1MM3A 4C9ZA 5JA7A 3O33A 1KFUL 1ZCMA 3V6CA 2JRJA 2BSZA 2K1JA 2PADA 4YYSA 3O7AA 5G05B 4C5PA 4FIPA 2YSMA 2XU5A 4Q8HA 4ZDTA 2LQ6A 1WEUA 2CKLB 2M85A 3HCTA 1MHWA 2YREA 2OP3A 3KSEA 4CDEB 5PADA 2PNSA 2ZETC 3BWKA 1JM7A 4AUQB 5B8DA 4N4ZA 2F7DA 2LGKA 1WGMA 3BC3A 4QRVA 4MVTA 3SOUA 2FYEA 2YJCA 1HYIA 3RVWA 3KX1A 1N87A 1RMDA 5G0FA 2YJ8A 2CIOA 3ZPVE 2L43A 2DX8A 4P6GA 3BPMA 5H1TA 5LKXA 4PI3A 1HYJA 2XU1A 2DC7A 5F02A 3H7DA 3L1ZB 4CDCB 2VPDA 1JQPA 2E6SA 3N9MA 4WA6A 2QICA 3I2DA 2VPGA 1MDWA 2DC6A 4YYQA 5TABA 4PPEA 2FRQA 4CA1A 3DQVR 4WZ0A 2XU3A 5EF4A 5C13A 3D9WA 1WEMA 3O37A 1AIMA 2BAYA 2KWOA 4G54A 2YJ9A 3O1GA 5FEYA 4GNEA 2L80A 3IOQA 4HWYA 4XI1A 3P5XA 1NPZA 4P6EA 2FSAA 2LXHC 3ZNIA 5FB1A 2YQMA 4X3GA 1PCIA 1PE6A 4AYCB 3ASLA 1MEGA 3I3TA 3BPFA 4IC2A 4PTBA 4YATA 3SOWA 2LGLA 2PBHA 1CSBB 2KGIA 4I05A 5K16A 1IWDA 2K17A 3RVVA 4GB0A 3P5WA 1A6RA 3WXGA 2IDAA 4QF2A 5JH3A 3H8CA 3SOXA 4PP2E 1BORA 2FUUA 2YSJA 2R9MA 2FUDA 3V43A 1EWPA 2CSYA 1BQIA 2YJ2A 5KH7A 4XUIA 2KYUA 2MD8C 3PW3A 1AYVA 4BHWA 1KFXL 1QDQA 5CVOB 4CDFB 5D1LB 2YT5A 5B78A 2R9FA 3GV4A 3IV2A 2QJ0A 3C9EA 2YUCA 1THEA 2YQLA 3N9NA 4BBQA 3MTNA 2YHNA 4O64A 1JOCA 3RTRB 3PUQA 3BCNA 5J94A 4IC3A 2IPPB 5FERA 2F6NA 3F5VA 5EGWA 2KWNA 3CH3X 4AXMA 2AU1A 5CHTA 3LQIA 2HXZA 2JQGR 4I04A 1X4JA 3M63A 2M1RA 3O35A 1QOLA 2R9NA 3ERVA 2DCBA 1Z6UA 3MHSA 2I50A 1F2AA 2E6RA 4L58A 2ECTA 4W5BA 1AU4A 2VPBA 2NAAA 2VJFB 1BY8A 1S4VA 1STFE 3TNXA 2JMJA 1X4UA 1U6GB 4UP0A 4V3KC 2P0RA 2F1GA 4S3OC 3C6WA 4YBMA 2KE1A 2HD5A 3U8EA 3OF9A 3USVA 3HWNA 2CKLA 3RPGC 2DJFB 2L5UA 1Z2QA 2LN0A 1MS6A 3HCSA 2MA6A 3VK6A 2R9CA 4OELA 3GL6A 4YYWA 3NHEA 2CSZA 1PPPA 9PAPA 2MUMA 4A0CD 5C11A 5FB0A 1Q6KA 2ECJA 4ZUXU 4RY2A 5LCWB 3IMAA 4LJNA 5AITA 2FTDA 1EWOA 2MIQA 4GNGA 1KHPA 2CB5A 6PADA 3KKUA 2EA6A 4NV7A 2Y1NA 2JQFR 1AU3A 4YABA 1GLOA 7PCKA 2OZ2A 4AYCA 4ZQLA 3V6EA 2C2LA 1CQDA 3F75A 4A4CA 3B79A 1WEOA 1T1HA 1BGOA 4QF3A 4QRXA 1V87A 4PADA 4S3OB 3D6SA 1IYMA 3ZVYA 4N8WA 5LKZA 4A4BA 1PPNA 4NN2A 4W4UA 3N3GA 2CT2A 1Y08A 4BQVA 3RPGB 4B86C 1ICFA 2L75A 1FH0A 2G6QA 5A24A 1TU6A 2VFBA 1DF0A 4BSQA 1POPA 4UI9B 1ATKA 3ZPV1 3M62A 1ZBDB 2YJBA 4YYVA 3LFYA 3IUTA 2PUYA 2XEUA 1GCBA 3QJ3A 1GECE 3KWBX 1JM7B 3KWZA 2L0BA 3T7LA 4AP4A 1CVZA 3L1XA 3LXSA 1QXPA 2EODA 2M3HA 1U5IA 4YYUA 2NQAA 2R9OA 4L7XA 2LXPC 2MNZA 3O36A 2KR4A 3NG2A 2GFOA 1AU0A 4XR7A 2G43A 2HYED 5EYAF 5B76A 2LDRA 1W5RA 3QT4A 4R2YA 1YVBA 4Q8GA 3M99A 2AYNA 3ZVZB 2DC8A 2P7UA 3QSDA 1Y4HA 2ECWA 1BP4A 3U5MA 2KU3A 1O0EA 2MT5A 1PADA 4R8PK 2B1MA 2G6DA 2G8JA 3U5PA 1ME4A 1YK7A 4CCGX 2OXQC 1DEUA 5TRBA 2OULA 2WBFX 3GCBA 2NQIA 5TDRA 1FBVA 1U9QX 3T6RA 3WXEA 2VHFA 2UZGA 3O34A 3AI8A 1EWLA 2KGGA 2HH5A 3N3KA 2ECIA 1M6DA 2ATOA 2FQ9A 2KWKA 3N9QA 4K7CA 1AYUA 3ZUAA 1F2BA 4I7DA 4W5CA 4MZSA 4B7YC 2MA5A 4FK5A 1CV8A 2DJGB 3OVZA 5KH3A 2LV9A 2IBIA 2AYOA 2VJEA 3KW9A 3U5NA 2XB1A 2MNYA 1MEMA 3CBKA 4GNDA 4DMXA 2VJFA 1YK8A 4PP1A 2YYRA 1W6FA 1CHCA 3RVXA 1VFYA 2F6JA 3P5UA 2H0DA 3PDFA 2ECVA 3PBHA 1YALA 1SNKA 4X6JA 2AVWA 2DC9A 2HHNA 3DF0A 1Z60A 3WXFA 1WILA 2RSDA 4KLBA 3IHPA 4OEMA 3MORA 4P5OB 2JMIA 2VP7A 2YHOA 4YVAA 2FRAA 2VNFA 1G25A 4LK9A 2VHSA 1WE9A 3L11A 1WFKA 5JG6A 2AS8A 3K24A 2XU4A 1FP0A 1MM2A 4BS5A 2PNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PPO A;  3S3Q A;  3LQJ A;  2VPE A;  2F42 A;  2DZZ A;  3H6S A;  4I07 A;  4N4F A;  4Q6F A;  5D1K B;  1U9W A;  3O0U A;  4YYR A;  4YAX A;  2H7J A;  2MD7 B;  1WEN A;  3HHA A;  4V3L C;  3CBJ A;  5G04 B;  1NQC A;  1F2C A;  1ME3 A;  2DZY A;  2HDP A;  1YT7 A;  8PCH A;  2YU4 A;  2E01 A;  1AYW A;  4N3W A;  3ZTG A;  3U5O A;  1PPD A;  4YV8 A;  2ECG A;  3O70 A;  4CZW A;  1TL9 A;  3N9O A;  1WEQ A;  1EWM A;  5CHV A;  5KH9 A;  2FT2 A;  4GNF A;  3N9L A;  1CJL A;  2B1N A;  2LRI C;  3E1Z B;  3PHD A;  3EB5 A;  2LGG A;  2G45 A;  2O6X A;  1WEW A;  4DMY A;  2BDZ A;  3H8B A;  1NB5 A;  4F52 B;  4LLB A;  1EF7 A;  3KV6 A;  3HHI A;  1HUC B;  3HTK C;  5H1U A;  4TKP B;  1CS8 A;  3KQI A;  4FJC A;  1XKG A;  2C2V S;  3BOW A;  1WEP A;  4MZO A;  4X6I A;  2AUX A;  2PRE A;  3HCU A;  4AXL A;  1LDJ B;  2G7Y A;  1VD4 A;  3C5K A;  2FUI A;  2H0D B;  4A49 A;  1VYX A;  3MHH A;  1CPJ A;  1WES A;  1PXV A;  2AIM A;  4I7C A;  4BPV A;  1SP4 B;  1WEV A;  2Y6E A;  3OF8 A;  2EGP A;  1K3B B;  2RI7 A;  2DCD A;  3KNV A;  2ACT A;  2FO5 A;  2AUZ A;  3PUR A;  4LKA A;  5J3X A;  2ARY A;  4QH6 A;  1KXR A;  1CTE A;  1ITO A;  2C0Y A;  3FL2 A;  1K2F A;  4WZ3 B;  5TBN A;  2E03 A;  5B75 A;  3EB6 A;  1GMY A;  5DKA A;  4YAD A;  3OIS A;  5CVM A;  5I3L A;  5DIN A;  2Y1M A;  3IEJ A;  3N4C A;  2KIZ A;  3LRQ A;  4N79 A;  5TDW A;  4QRG A;  2E00 A;  1E4U A;  2JMD A;  4YC9 A;  1WEE A;  2YW8 A;  1F62 A;  2DCC A;  4X6H A;  4R7E A;  3ZYQ A;  1VSN A;  1PIP A;  2KFT A;  4YBT A;  3K8U A;  3S3R A;  1X4I A;  5H1V A;  2KRE A;  1PBH A;  1VJV A;  5B77 A;  2AN6 A;  1QMY A;  1F29 A;  4AVX A;  1U9V A;  1U9X A;  3CH2 X;  3H89 A;  4I7B A;  2Y43 A;  1NLJ A;  1AU2 A;  3P5V A;  4BS6 A;  2M6M A;  2ECN A;  4YBS A;  1TLO A;  2VJE B;  3HD3 A;  2YUR A;  1WIM A;  2LGV A;  5LKT A;  1NB3 A;  2D8S A;  2KWJ A;  1NL6 A;  2QIZ A;  2R6N A;  1LDK C;  3K9M A;  2NQD B;  1MIR A;  4CDD B;  3KV5 A;  2K4D A;  2BDL A;  3I06 A;  3PNR A;  3LQH A;  5AIU A;  5D1M B;  5LKU A;  1X9Y A;  4MSX A;  4WZ2 A;  5CVN B;  5FPW A;  2P86 A;  1AEC A;  3QZV A;  5B79 A;  3N9P A;  1CB5 A;  2GHU A;  4QBB A;  2E02 A;  2Y5B A;  2NQG A;  1ZIV A;  3SHB A;  4LAD B;  4UP5 A;  2G8E A;  3DPL R;  1DVP A;  4FO9 A;  1KHQ A;  1XWH A;  2DCA A;  3OVX A;  2K16 A;  5H9M A;  3KFQ A;  1MM3 A;  4C9Z A;  5JA7 A;  3O33 A;  1KFU L;  1ZCM A;  3V6C A;  2JRJ A;  2K1J A;  2PAD A;  4YYS A;  3O7A A;  5G05 B;  4FIP A;  2YSM A;  2XU5 A;  4Q8H A;  4ZDT A;  2LQ6 A;  1WEU A;  2CKL B;  2M85 A;  3HCT A;  1MHW A;  2YRE A;  2OP3 A;  3KSE A;  4CDE B;  5PAD A;  2PNS A;  2ZET C;  3BWK A;  1JM7 A;  4AUQ B;  5B8D A;  4N4Z A;  2F7D A;  2LGK A;  1WGM A;  3BC3 A;  4QRV A;  4MVT A;  3SOU A;  2FYE A;  2YJC A;  1HYI A;  3RVW A;  3KX1 A;  1N87 A;  1RMD A;  5G0F A;  2YJ8 A;  2CIO A;  3ZPV E;  2L43 A;  2DX8 A;  4P6G A;  3BPM A;  5H1T A;  5LKX A;  4PI3 A;  1HYJ A;  2XU1 A;  2DC7 A;  5F02 A;  3H7D A;  3L1Z B;  4CDC B;  2VPD A;  1JQP A;  2E6S A;  3N9M A;  4WA6 A;  2QIC A;  3I2D A;  2VPG A;  1MDW A;  2DC6 A;  4YYQ A;  5TAB A;  4PPE A;  2FRQ A;  4CA1 A;  3DQV R;  4WZ0 A;  2XU3 A;  5EF4 A;  5C13 A;  1WEM A;  3O37 A;  1AIM A;  2BAY A;  2KWO A;  4G54 A;  2YJ9 A;  3O1G A;  5FEY A;  4GNE A;  2L80 A;  3IOQ A;  4HWY A;  4XI1 A;  3P5X A;  1NPZ A;  4P6E A;  2FSA A;  2LXH C;  3ZNI A;  5FB1 A;  2YQM A;  4X3G A;  1PCI A;  1PE6 A;  4AYC B;  3ASL A;  1MEG A;  3I3T A;  3BPF A;  4IC2 A;  4PTB A;  4YAT A;  3SOW A;  2LGL A;  2PBH A;  1CSB B;  2KGI A;  4I05 A;  5K16 A;  1IWD A;  2K17 A;  3RVV A;  4GB0 A;  3P5W A;  1A6R A;  3WXG A;  2IDA A;  4QF2 A;  5JH3 A;  3H8C A;  3SOX A;  4PP2 E;  1BOR A;  2FUU A;  2YSJ A;  2R9M A;  2FUD A;  3V43 A;  1EWP A;  2CSY A;  1BQI A;  2YJ2 A;  5KH7 A;  4XUI A;  2KYU A;  2MD8 C;  3PW3 A;  1AYV A;  4BHW A;  1KFX L;  1QDQ A;  5CVO B;  4CDF B;  5D1L B;  2YT5 A;  5B78 A;  2R9F A;  3GV4 A;  3IV2 A;  2QJ0 A;  3C9E A;  2YUC A;  1THE A;  2YQL A;  3N9N A;  4BBQ A;  3MTN A;  2YHN A;  4O64 A;  1JOC A;  3RTR B;  3PUQ A;  3BCN A;  5J94 A;  4IC3 A;  2IPP B;  5FER A;  2F6N A;  3F5V A;  5EGW A;  2KWN A;  3CH3 X;  4AXM A;  2AU1 A;  5CHT A;  3LQI A;  2HXZ A;  2JQG R;  4I04 A;  1X4J A;  3M63 A;  2M1R A;  3O35 A;  1QOL A;  2R9N A;  3ERV A;  2DCB A;  1Z6U A;  3MHS A;  2I50 A;  1F2A A;  2E6R A;  4L58 A;  2ECT A;  4W5B A;  1AU4 A;  2VPB A;  2NAA A;  2VJF B;  1BY8 A;  1S4V A;  1STF E;  3TNX A;  2JMJ A;  1X4U A;  1U6G B;  4UP0 A;  4V3K C;  2P0R A;  2F1G A;  4S3O C;  3C6W A;  4YBM A;  2KE1 A;  2HD5 A;  3U8E A;  3OF9 A;  3USV A;  3HWN A;  2CKL A;  3RPG C;  2DJF B;  2L5U A;  1Z2Q A;  2LN0 A;  1MS6 A;  3HCS A;  2MA6 A;  3VK6 A;  2R9C A;  4OEL A;  3GL6 A;  4YYW A;  3NHE A;  2CSZ A;  1PPP A;  9PAP A;  2MUM A;  4A0C D;  5C11 A;  5FB0 A;  1Q6K A;  2ECJ A;  4ZUX U;  4RY2 A;  5LCW B;  3IMA A;  4LJN A;  5AIT A;  2FTD A;  1EWO A;  2MIQ A;  4GNG A;  1KHP A;  2CB5 A;  6PAD A;  3KKU A;  2EA6 A;  2Y1N A;  2JQF R;  1AU3 A;  4YAB A;  1GLO A;  7PCK A;  2OZ2 A;  4AYC A;  4ZQL A;  3V6E A;  2C2L A;  1CQD A;  3F75 A;  4A4C A;  3B79 A;  1WEO A;  1T1H A;  1BGO A;  4QF3 A;  4QRX A;  1V87 A;  4PAD A;  4S3O B;  3D6S A;  1IYM A;  3ZVY A;  4N8W A;  5LKZ A;  4A4B A;  1PPN A;  4NN2 A;  4W4U A;  3N3G A;  2CT2 A;  1Y08 A;  4BQV A;  3RPG B;  4B86 C;  1ICF A;  2L75 A;  1FH0 A;  2G6Q A;  5A24 A;  1TU6 A;  1DF0 A;  4BSQ A;  1POP A;  4UI9 B;  1ATK A;  3ZPV 1;  3M62 A;  1ZBD B;  2YJB A;  4YYV A;  3LFY A;  3IUT A;  2PUY A;  2XEU A;  1GCB A;  3QJ3 A;  1GEC E;  3KWB X;  1JM7 B;  3KWZ A;  2L0B A;  3T7L A;  4AP4 A;  1CVZ A;  3L1X A;  3LXS A;  1QXP A;  2EOD A;  2M3H A;  1U5I A;  4YYU A;  2NQA A;  2R9O A;  4L7X A;  2LXP C;  2MNZ A;  3O36 A;  2KR4 A;  3NG2 A;  2GFO A;  1AU0 A;  4XR7 A;  2G43 A;  2HYE D;  5EYA F;  5B76 A;  2LDR A;  3QT4 A;  4R2Y A;  1YVB A;  4Q8G A;  3M99 A;  2AYN A;  3ZVZ B;  2DC8 A;  2P7U A;  3QSD A;  1Y4H A;  2ECW A;  1BP4 A;  3U5M A;  2KU3 A;  1O0E A;  2MT5 A;  1PAD A;  4R8P K;  2B1M A;  2G6D A;  2G8J A;  3U5P A;  1ME4 A;  1YK7 A;  4CCG X;  2OXQ C;  1DEU A;  5TRB A;  2OUL A;  2WBF X;  3GCB A;  2NQI A;  5TDR A;  1FBV A;  1U9Q X;  3T6R A;  3WXE A;  2VHF A;  2UZG A;  3O34 A;  3AI8 A;  1EWL A;  2KGG A;  2HH5 A;  3N3K A;  2ECI A;  1M6D A;  2ATO A;  2FQ9 A;  2KWK A;  3N9Q A;  4K7C A;  1AYU A;  3ZUA A;  1F2B A;  4I7D A;  4W5C A;  4MZS A;  4B7Y C;  2MA5 A;  4FK5 A;  1CV8 A;  2DJG B;  3OVZ A;  5KH3 A;  2LV9 A;  2IBI A;  2AYO A;  2VJE A;  3KW9 A;  3U5N A;  2XB1 A;  2MNY A;  1MEM A;  3CBK A;  4GND A;  4DMX A;  2VJF A;  1YK8 A;  4PP1 A;  2YYR A;  1CHC A;  3RVX A;  1VFY A;  2F6J A;  3P5U A;  2H0D A;  3PDF A;  2ECV A;  3PBH A;  1YAL A;  1SNK A;  4X6J A;  2AVW A;  2DC9 A;  2HHN A;  3DF0 A;  1Z60 A;  3WXF A;  1WIL A;  2RSD A;  4KLB A;  3IHP A;  4OEM A;  3MOR A;  4P5O B;  2JMI A;  2VP7 A;  2YHO A;  4YVA A;  2FRA A;  2VNF A;  1G25 A;  4LK9 A;  2VHS A;  1WE9 A;  3L11 A;  1WFK A;  5JG6 A;  2AS8 A;  3K24 A;  2XU4 A;  1FP0 A;  1MM2 A;  4BS5 A;  2PNX A; 
#chains in the Genus database with same CATH topology
 1PPO A;  3Q1D A;  3PT2 A;  3S3Q A;  3LQJ A;  1DKI A;  2VPE A;  3B21 A;  2F42 A;  2DZZ A;  3H6S A;  4I07 A;  4N4F A;  4Q6F A;  4IP3 A;  5D1K B;  1U9W A;  3O0U A;  4YYR A;  4YAX A;  2H7J A;  2MD7 B;  1WEN A;  3HHA A;  4V3L C;  3CBJ A;  5G04 B;  1NQC A;  1F2C A;  1ME3 A;  2DZY A;  4REZ A;  2HDP A;  1YT7 A;  8PCH A;  2YU4 A;  2E01 A;  1AYW A;  4N3W A;  3ZTG A;  3U5O A;  3C0R A;  1PPD A;  4YV8 A;  2ECG A;  3O70 A;  4CZW A;  3FAO A;  1TL9 A;  3N9O A;  1WEQ A;  1EWM A;  5CHV A;  5KH9 A;  2FT2 A;  4GNF A;  3N9L A;  1CJL A;  2B1N A;  2LRI C;  3E1Z B;  2J7Q A;  3FM8 C;  3PHD A;  3EB5 A;  2LGG A;  3TRK A;  2G45 A;  4RNA A;  2O6X A;  1WEW A;  3MDB C;  4DMY A;  2BDZ A;  3H8B A;  1NB5 A;  4F52 B;  4LLB A;  3O65 A;  1EF7 A;  3KV6 A;  3HHI A;  1HUC B;  3HTK C;  4PT5 A;  5H1U A;  4TKP B;  1CS8 A;  2UZJ A;  3KQI A;  4FJC A;  1XKG A;  2C2V S;  3BOW A;  1WEP A;  3PRP A;  4MZO A;  4X6I A;  2AUX A;  2PRE A;  3HCU A;  4AXL A;  1LDJ B;  2G7Y A;  1VD4 A;  3C5K A;  2FUI A;  2H0D B;  4A49 A;  2XOY A;  1VYX A;  3MHH A;  1CPJ A;  1WES A;  1PXV A;  2AIM A;  4I7C A;  4BPV A;  1SP4 B;  1WEV A;  2Y6E A;  3OF8 A;  2EGP A;  1K3B B;  2RI7 A;  2DCD A;  2B0O E;  3KNV A;  2ACT A;  2FO5 A;  2AUZ A;  3PUR A;  4LKA A;  5J3X A;  2ARY A;  4QH6 A;  1KXR A;  1CTE A;  2E61 A;  1ITO A;  2C0Y A;  3FL2 A;  1K2F A;  4WZ3 B;  5TBN A;  2E03 A;  5B75 A;  3EB6 A;  1GMY A;  5DKA A;  4YAD A;  3PRM A;  3OIS A;  5CVM A;  5I3L A;  5DIN A;  2Y1M A;  3IEJ A;  3N4C A;  2KIZ A;  3LRQ A;  4N79 A;  4OGC A;  2L7P A;  5TDW A;  4QRG A;  2E00 A;  1E4U A;  2JMD A;  4YC9 A;  1WEE A;  2YW8 A;  1F62 A;  2DCC A;  4X6H A;  4R7E A;  3ZYQ A;  1YZB A;  1VSN A;  1PIP A;  2KFT A;  4YBT A;  3K8U A;  3S3R A;  1X4I A;  5H1V A;  2KRE A;  1PBH A;  1VJV A;  5B77 A;  2AN6 A;  1QMY A;  1F29 A;  5SVX A;  4AVX A;  1U9V A;  1U9X A;  3CH2 X;  3H89 A;  4I7B A;  2Y43 A;  1NLJ A;  1AU2 A;  4WUR A;  3P5V A;  4BS6 A;  2M6M A;  2D8U A;  2ECN A;  4YBS A;  4XZX A;  1TLO A;  2VJE B;  3T9K A;  3HD3 A;  2YUR A;  1WIM A;  2LGV A;  5LKT A;  1NB3 A;  2M13 A;  2D8S A;  2KWJ A;  1NL6 A;  2QIZ A;  2R6N A;  1LDK C;  2JRI A;  2RR4 A;  3K9M A;  2XOZ A;  2NQD B;  3MP2 A;  1MIR A;  4CDD B;  3KV5 A;  2K4D A;  2BDL A;  3I06 A;  3PNR A;  3LQH A;  3ZNH A;  2KKY A;  5AIU A;  5D1M B;  5LKU A;  1X9Y A;  4MSX A;  4OVZ A;  4WZ2 A;  5CVN B;  3RNV A;  4P16 A;  2P86 A;  1AEC A;  5EZS A;  5FPW A;  3QZV A;  4GUA A;  5B79 A;  3N9P A;  1CB5 A;  2GHU A;  4QBB A;  2E02 A;  2Y5B A;  2NQG A;  1ZIV A;  3SHB A;  4LAD B;  4UP5 A;  2G8E A;  3DPL R;  1DVP A;  4FO9 A;  1KHQ A;  4HXD B;  1XWH A;  2DCA A;  3OVX A;  2K16 A;  5H9M A;  3KFQ A;  1MM3 A;  4C9Z A;  5JA7 A;  3O33 A;  1KFU L;  2OWA A;  3MTV A;  1ZCM A;  3V6C A;  2LAU A;  3W31 A;  2JRJ A;  5SVY A;  2CRR A;  2K1J A;  2PAD A;  2JM3 A;  4YYS A;  3O7A A;  5G05 B;  4FIP A;  2YSM A;  2XU5 A;  4Q8H A;  4ZDT A;  2LQ6 A;  1WEU A;  2CKL B;  2M85 A;  3HCT A;  1MHW A;  2YRE A;  2OP3 A;  3KSE A;  4R3D A;  5PAD A;  4CDE B;  2PNS A;  2ZET C;  3BWK A;  1JM7 A;  4AUQ B;  5B8D A;  4N4Z A;  2F7D A;  2LGK A;  1WGM A;  3BC3 A;  4QRV A;  4MVT A;  3SOU A;  4D8E A;  2FYE A;  2YJC A;  1HYI A;  3RVW A;  3KX1 A;  4BOP A;  5KO3 A;  1N87 A;  1RMD A;  5G0F A;  2YJ8 A;  2CIO A;  2L43 A;  3ZPV E;  2DX8 A;  4P6G A;  3BPM A;  5H1T A;  5LKX A;  4PI3 A;  1HYJ A;  2XU1 A;  2CRW A;  2DC7 A;  5F02 A;  3H7D A;  3L1Z B;  4CDC B;  2VPD A;  1JQP A;  2E6S A;  3N9M A;  4WA6 A;  2QIC A;  3I2D A;  2VPG A;  1MDW A;  2CON A;  2DC6 A;  4YYQ A;  5TAB A;  2FFW A;  4PPE A;  3PSE A;  2FRQ A;  4CA1 A;  3DQV R;  4MM3 B;  4WZ0 A;  2XU3 A;  5EF4 A;  5C13 A;  1WEM A;  3O37 A;  1AIM A;  2BAY A;  2KWO A;  2HWK A;  4G54 A;  3E2D A;  2YJ9 A;  3O1G A;  5FEY A;  4GNE A;  2L80 A;  3IOQ A;  4HWY A;  4XI1 A;  3P5X A;  3BY4 A;  1NPZ A;  4P6E A;  2FSA A;  2LXH C;  3ZNI A;  5FB1 A;  2YQM A;  4X3G A;  3SUB A;  1PCI A;  1PE6 A;  2BTW A;  3TMP A;  4OW0 A;  4AYC B;  3ASL A;  3FJU B;  1MEG A;  3I3T A;  3BPF A;  4IC2 A;  4PTB A;  4YAT A;  3SOW A;  2IQJ A;  2LGL A;  3JUE A;  4RF1 A;  2PBH A;  1CSB B;  3DDT A;  2KGI A;  4ZTB A;  4I05 A;  5K16 A;  1IWD A;  2K17 A;  3RVV A;  4GB0 A;  3P5W A;  1A6R A;  3WXG A;  4F1P A;  2IDA A;  4QF2 A;  5JH3 A;  4O62 A;  3H8C A;  4A5U A;  3SOX A;  4PP2 E;  1BOR A;  3IFU A;  2FUU A;  2YSJ A;  2R9M A;  2FUD A;  3V43 A;  1EWP A;  3BB7 A;  1PVJ A;  2CSY A;  1BQI A;  3E9S A;  2YJ2 A;  3FAN A;  5KH7 A;  4XUI A;  2KYU A;  2MD8 C;  3PW3 A;  1AYV A;  3BBA A;  3H7H A;  4BHW A;  1KFX L;  1QDQ A;  5CVO B;  4CDF B;  5D1L B;  2YT5 A;  5B78 A;  2R9F A;  3GV4 A;  3IV2 A;  2QJ0 A;  3C9E A;  2YUC A;  1THE A;  2YQL A;  3N9N A;  4BBQ A;  3MTN A;  2DJA A;  2YHN A;  4O64 A;  4BOS A;  1JOC A;  3RTR B;  3PUQ A;  3BCN A;  5J94 A;  4IC3 A;  2IPP B;  5FER A;  2F6N A;  3F5V A;  5EGW A;  5EZQ A;  2KWN A;  3CH3 X;  4AXM A;  2AU1 A;  5CHT A;  4Z0R A;  4BOQ A;  3LQI A;  2HXZ A;  2JQG R;  4I04 A;  1X4J A;  3M63 A;  2M1R A;  3O35 A;  1QOL A;  1UKF A;  2R9N A;  2JTC A;  2EXU A;  3ERV A;  2DCB A;  1Z6U A;  3MHS A;  4QQ4 A;  2I50 A;  1F2A A;  2E6R A;  2XOC A;  4L58 A;  2ECT A;  4W5B A;  1AU4 A;  2VPB A;  2NAA A;  2VJF B;  5E6J A;  1BY8 A;  1S4V A;  1STF E;  3TNX A;  2FE8 A;  2JMJ A;  1X4U A;  1U6G B;  4UP0 A;  4V3K C;  3LJU X;  4D8B A;  3PHX A;  2P0R A;  2F1G A;  4S3O C;  3C6W A;  4Z0O A;  4YBM A;  2KE1 A;  2HD5 A;  3U8E A;  3OF9 A;  1MBM A;  3USV A;  5K3Q A;  3HWN A;  2CKL A;  3RPG C;  3MJ5 A;  2DJF B;  2L5U A;  1Z2Q A;  2LN0 A;  1MS6 A;  3HCS A;  2MA6 A;  3VK6 A;  2R9C A;  4OEL A;  3GL6 A;  4YYW A;  3NHE A;  2CSZ A;  3FEH A;  1PPP A;  9PAP A;  2MUM A;  4A0C D;  5C11 A;  5FB0 A;  1Q6K A;  2ECJ A;  4ZUX U;  4RY2 A;  5LCW B;  3IMA A;  4LJN A;  5AIT A;  2FTD A;  1EWO A;  2MIQ A;  4GNG A;  1KHP A;  2CB5 A;  6PAD A;  3KKU A;  3DWD A;  2EA6 A;  2Y1N A;  2JQF R;  1AU3 A;  4YAB A;  4D8I A;  1GLO A;  4MI7 A;  7PCK A;  2OZ2 A;  4AYC A;  4ZQL A;  3V6E A;  2C2L A;  1CQD A;  3F75 A;  4A4C A;  3B79 A;  1WEO A;  1T1H A;  2MKE A;  4QF3 A;  1BGO A;  1V87 A;  2BU3 A;  4S3O B;  2DOS A;  3D6S A;  4PAD A;  4RF0 A;  2KKX A;  1IYM A;  3ZVY A;  4OGE A;  4N8W A;  5LKZ A;  5SVI A;  4A4B A;  1PPN A;  4BOZ A;  4NN2 A;  4W4U A;  3N3G A;  2CT2 A;  1Y08 A;  4BQV A;  3W30 A;  3OQC A;  3RPG B;  4B86 C;  3M7K A;  1ICF A;  2L75 A;  1FH0 A;  2G6Q A;  5A24 A;  1TU6 A;  2BTW B;  1DF0 A;  4BSQ A;  3O47 A;  1POP A;  4UI9 B;  1ATK A;  3ZPV 1;  3M62 A;  1ZBD B;  2YJB A;  4YYV A;  3LFY A;  3IUT A;  2PUY A;  2XEU A;  1GCB A;  3KDE C;  3QJ3 A;  1GEC E;  3KWB X;  1JM7 B;  3KWZ A;  2L0B A;  3T7L A;  4AP4 A;  1CVZ A;  2P57 A;  3L1X A;  3LXS A;  1QXP A;  3PHW A;  4QRX A;  4BOU A;  2CSV A;  2EOD A;  2M3H A;  1U5I A;  4YYU A;  2NQA A;  2R9O A;  1DCQ A;  2FD4 A;  4L7X A;  2LXP C;  2MNZ A;  2AGA A;  3O36 A;  2KR4 A;  3NG2 A;  2YVR A;  2GFO A;  1AU0 A;  4XR7 A;  2G43 A;  2HYE D;  5EYA F;  5B76 A;  2LDR A;  3QT4 A;  4M0W A;  4R2Y A;  1YVB A;  4Q8G A;  3M99 A;  2AYN A;  3ZVZ B;  2DC8 A;  2P7U A;  3QSD A;  5JZE A;  1Y4H A;  2ECW A;  1BP4 A;  3U5M A;  2KU3 A;  1O0E A;  2MT5 A;  1PAD A;  4R8P K;  3LVR E;  2B1M A;  2G6D A;  2G8J A;  3U5P A;  1ME4 A;  1YK7 A;  4CCG X;  2OXQ C;  1DEU A;  5TRB A;  2OUL A;  2WBF X;  2J7Q C;  3GCB A;  3LDY A;  2NQI A;  5TDR A;  2Z84 A;  1FBV A;  1U9Q X;  3T6R A;  3WXE A;  2VHF A;  2UZG A;  3O34 A;  3AI8 A;  1EWL A;  2KGG A;  2HH5 A;  3N3K A;  2DSM A;  2ECI A;  3LVQ E;  1M6D A;  2KWK A;  3N9Q A;  2ATO A;  1AYU A;  2FQ9 A;  5SVI B;  1F2B A;  4I7D A;  4K7C A;  4W5C A;  3ZUA A;  4H9D A;  4MZS A;  4B7Y C;  2MA5 A;  4FK5 A;  1CV8 A;  2DJG B;  3OVZ A;  5KH3 A;  2LV9 A;  2IBI A;  2AYO A;  2VJE A;  3KW9 A;  3U5N A;  2XB1 A;  2MNY A;  1MEM A;  3CBK A;  3PHU A;  4GND A;  4DMX A;  3PLW A;  4RKX A;  4IUM A;  2VJF A;  1YK8 A;  4PP1 A;  2YYR A;  1CHC A;  3RVX A;  4OVZ B;  1VFY A;  2F6J A;  3P5U A;  2H0D A;  3PDF A;  2ECV A;  3PBH A;  1YAL A;  1SNK A;  4X6J A;  2AVW A;  2DC9 A;  2HHN A;  3DF0 A;  1Z60 A;  2EGM A;  3WXF A;  1WIL A;  2RSD A;  2JUN A;  2XP0 A;  4KLB A;  3IHP A;  4OEM A;  3MOR A;  4P5O B;  2JMI A;  2VP7 A;  2YHO A;  4YVA A;  2FRA A;  2VNF A;  1G25 A;  4LK9 A;  2VHS A;  1WE9 A;  3L11 A;  1WFK A;  5JG6 A;  2AS8 A;  3K24 A;  2XU4 A;  1FP0 A;  1MM2 A;  4BS5 A;  2PNX A; 
#chains in the Genus database with same CATH homology
 1PPO A;  3S3Q A;  3LQJ A;  2VPE A;  2F42 A;  2DZZ A;  3H6S A;  4I07 A;  4N4F A;  4Q6F A;  5D1K B;  1U9W A;  3O0U A;  4YYR A;  4YAX A;  2H7J A;  2MD7 B;  1WEN A;  3HHA A;  4V3L C;  3CBJ A;  5G04 B;  1NQC A;  1F2C A;  1ME3 A;  2DZY A;  2HDP A;  1YT7 A;  8PCH A;  2YU4 A;  2E01 A;  1AYW A;  4N3W A;  3ZTG A;  3U5O A;  1PPD A;  4YV8 A;  2ECG A;  3O70 A;  4CZW A;  1TL9 A;  3N9O A;  1WEQ A;  1EWM A;  5CHV A;  5KH9 A;  2FT2 A;  4GNF A;  3N9L A;  1CJL A;  2B1N A;  2LRI C;  3E1Z B;  3PHD A;  3EB5 A;  2LGG A;  2G45 A;  2O6X A;  1WEW A;  4DMY A;  2BDZ A;  3H8B A;  1NB5 A;  4F52 B;  4LLB A;  1EF7 A;  3KV6 A;  3HHI A;  1HUC B;  4BGF A;  3HTK C;  5H1U A;  4TKP B;  3LTW A;  1CS8 A;  3KQI A;  4FJC A;  1XKG A;  2C2V S;  3BOW A;  1WEP A;  4MZO A;  4X6I A;  2AUX A;  2PRE A;  3HCU A;  4AXL A;  1LDJ B;  2G7Y A;  1VD4 A;  3C5K A;  2FUI A;  2H0D B;  4A49 A;  1VYX A;  3MHH A;  1CPJ A;  1WES A;  1PXV A;  2AIM A;  4I7C A;  4BPV A;  1SP4 B;  1WEV A;  2Y6E A;  3OF8 A;  2EGP A;  1K3B B;  2RI7 A;  2DCD A;  3KNV A;  2ACT A;  2FO5 A;  2AUZ A;  3PUR A;  4GUZ A;  4LKA A;  5J3X A;  2ARY A;  4QH6 A;  1KXR A;  1CTE A;  1ITO A;  2C0Y A;  3FL2 A;  1K2F A;  4WZ3 B;  5TBN A;  2E03 A;  5B75 A;  3EB6 A;  1GMY A;  5DKA A;  4YAD A;  3OIS A;  5CVM A;  5I3L A;  5DIN A;  2Y1M A;  1W4T A;  3IEJ A;  3N4C A;  2KIZ A;  3LRQ A;  4N79 A;  5TDW A;  4QRG A;  2E00 A;  1E4U A;  2JMD A;  4YC9 A;  1WEE A;  2YW8 A;  1F62 A;  2DCC A;  4X6H A;  4R7E A;  3ZYQ A;  1VSN A;  2VFC A;  1PIP A;  2KFT A;  4YBT A;  3K8U A;  3S3R A;  1X4I A;  5H1V A;  2KRE A;  1PBH A;  1GX3 A;  1VJV A;  5B77 A;  2AN6 A;  1QMY A;  1F29 A;  4AVX A;  1U9V A;  1U9X A;  4B55 A;  3CH2 X;  3H89 A;  4I7B A;  2Y43 A;  1NLJ A;  1AU2 A;  1E2T A;  3P5V A;  4BS6 A;  2M6M A;  2ECN A;  4YBS A;  1TLO A;  2VJE B;  3HD3 A;  2YUR A;  1WIM A;  2LGV A;  5LKT A;  1NB3 A;  2D8S A;  2KWJ A;  1NL6 A;  2QIZ A;  2R6N A;  1LDK C;  3K9M A;  2NQD B;  1MIR A;  4CDD B;  3KV5 A;  2K4D A;  2BDL A;  3I06 A;  3PNR A;  3LQH A;  4NV8 A;  5AIU A;  5D1M B;  5LKU A;  1X9Y A;  4MSX A;  4WZ2 A;  5CVN B;  5FPW A;  2P86 A;  1AEC A;  3QZV A;  5B79 A;  3N9P A;  1CB5 A;  2GHU A;  4QBB A;  2E02 A;  2Y5B A;  2NQG A;  1ZIV A;  3SHB A;  4LAD B;  4UP5 A;  2G8E A;  3DPL R;  1DVP A;  4FO9 A;  1KHQ A;  1XWH A;  2DCA A;  3OVX A;  2K16 A;  5H9M A;  3KFQ A;  1MM3 A;  4C9Z A;  5JA7 A;  3O33 A;  1KFU L;  1ZCM A;  3V6C A;  2JRJ A;  2BSZ A;  2K1J A;  2PAD A;  4YYS A;  3O7A A;  5G05 B;  4C5P A;  4FIP A;  2YSM A;  2XU5 A;  4Q8H A;  4ZDT A;  2LQ6 A;  1WEU A;  2CKL B;  2M85 A;  3HCT A;  1MHW A;  2YRE A;  2OP3 A;  3KSE A;  4CDE B;  5PAD A;  2PNS A;  2ZET C;  3BWK A;  1JM7 A;  4AUQ B;  5B8D A;  4N4Z A;  2F7D A;  2LGK A;  1WGM A;  3BC3 A;  4QRV A;  4MVT A;  3SOU A;  2FYE A;  2YJC A;  1HYI A;  3RVW A;  3KX1 A;  1N87 A;  1RMD A;  5G0F A;  2YJ8 A;  2CIO A;  3ZPV E;  2L43 A;  2DX8 A;  4P6G A;  3BPM A;  5H1T A;  5LKX A;  4PI3 A;  1HYJ A;  2XU1 A;  2DC7 A;  5F02 A;  3H7D A;  3L1Z B;  4CDC B;  2VPD A;  1JQP A;  2E6S A;  3N9M A;  4WA6 A;  2QIC A;  3I2D A;  2VPG A;  1MDW A;  2DC6 A;  4YYQ A;  5TAB A;  4PPE A;  2FRQ A;  4CA1 A;  3DQV R;  4WZ0 A;  2XU3 A;  5EF4 A;  5C13 A;  3D9W A;  1WEM A;  3O37 A;  1AIM A;  2BAY A;  2KWO A;  4G54 A;  2YJ9 A;  3O1G A;  5FEY A;  4GNE A;  2L80 A;  3IOQ A;  4HWY A;  4XI1 A;  3P5X A;  1NPZ A;  4P6E A;  2FSA A;  2LXH C;  3ZNI A;  5FB1 A;  2YQM A;  4X3G A;  1PCI A;  1PE6 A;  4AYC B;  3ASL A;  1MEG A;  3I3T A;  3BPF A;  4IC2 A;  4PTB A;  4YAT A;  3SOW A;  2LGL A;  2PBH A;  1CSB B;  2KGI A;  4I05 A;  5K16 A;  1IWD A;  2K17 A;  3RVV A;  4GB0 A;  3P5W A;  1A6R A;  3WXG A;  2IDA A;  4QF2 A;  5JH3 A;  3H8C A;  3SOX A;  4PP2 E;  1BOR A;  2FUU A;  2YSJ A;  2R9M A;  2FUD A;  3V43 A;  1EWP A;  2CSY A;  1BQI A;  2YJ2 A;  5KH7 A;  4XUI A;  2KYU A;  2MD8 C;  3PW3 A;  1AYV A;  4BHW A;  1KFX L;  1QDQ A;  5CVO B;  4CDF B;  5D1L B;  2YT5 A;  5B78 A;  2R9F A;  3GV4 A;  3IV2 A;  2QJ0 A;  3C9E A;  2YUC A;  1THE A;  2YQL A;  3N9N A;  4BBQ A;  3MTN A;  2YHN A;  4O64 A;  1JOC A;  3RTR B;  3PUQ A;  3BCN A;  5J94 A;  4IC3 A;  2IPP B;  5FER A;  2F6N A;  3F5V A;  5EGW A;  2KWN A;  3CH3 X;  4AXM A;  2AU1 A;  5CHT A;  3LQI A;  2HXZ A;  2JQG R;  4I04 A;  1X4J A;  3M63 A;  2M1R A;  3O35 A;  1QOL A;  2R9N A;  3ERV A;  2DCB A;  1Z6U A;  3MHS A;  2I50 A;  1F2A A;  2E6R A;  4L58 A;  2ECT A;  4W5B A;  1AU4 A;  2VPB A;  2NAA A;  2VJF B;  1BY8 A;  1S4V A;  1STF E;  3TNX A;  2JMJ A;  1X4U A;  1U6G B;  4UP0 A;  4V3K C;  2P0R A;  2F1G A;  4S3O C;  3C6W A;  4YBM A;  2KE1 A;  2HD5 A;  3U8E A;  3OF9 A;  3USV A;  3HWN A;  2CKL A;  3RPG C;  2DJF B;  2L5U A;  1Z2Q A;  2LN0 A;  1MS6 A;  3HCS A;  2MA6 A;  3VK6 A;  2R9C A;  4OEL A;  3GL6 A;  4YYW A;  3NHE A;  2CSZ A;  1PPP A;  9PAP A;  2MUM A;  4A0C D;  5C11 A;  5FB0 A;  1Q6K A;  2ECJ A;  4ZUX U;  4RY2 A;  5LCW B;  3IMA A;  4LJN A;  5AIT A;  2FTD A;  1EWO A;  2MIQ A;  4GNG A;  1KHP A;  2CB5 A;  6PAD A;  3KKU A;  2EA6 A;  4NV7 A;  2Y1N A;  2JQF R;  1AU3 A;  4YAB A;  1GLO A;  7PCK A;  2OZ2 A;  4AYC A;  4ZQL A;  3V6E A;  2C2L A;  1CQD A;  3F75 A;  4A4C A;  3B79 A;  1WEO A;  1T1H A;  1BGO A;  4QF3 A;  4QRX A;  1V87 A;  4PAD A;  4S3O B;  3D6S A;  1IYM A;  3ZVY A;  4N8W A;  5LKZ A;  4A4B A;  1PPN A;  4NN2 A;  4W4U A;  3N3G A;  2CT2 A;  1Y08 A;  4BQV A;  3RPG B;  4B86 C;  1ICF A;  2L75 A;  1FH0 A;  2G6Q A;  5A24 A;  1TU6 A;  2VFB A;  1DF0 A;  4BSQ A;  1POP A;  4UI9 B;  1ATK A;  3ZPV 1;  3M62 A;  1ZBD B;  2YJB A;  4YYV A;  3LFY A;  3IUT A;  2PUY A;  2XEU A;  1GCB A;  3QJ3 A;  1GEC E;  3KWB X;  1JM7 B;  3KWZ A;  2L0B A;  3T7L A;  4AP4 A;  1CVZ A;  3L1X A;  3LXS A;  1QXP A;  2EOD A;  2M3H A;  1U5I A;  4YYU A;  2NQA A;  2R9O A;  4L7X A;  2LXP C;  2MNZ A;  3O36 A;  2KR4 A;  3NG2 A;  2GFO A;  1AU0 A;  4XR7 A;  2G43 A;  2HYE D;  5EYA F;  5B76 A;  2LDR A;  1W5R A;  3QT4 A;  4R2Y A;  1YVB A;  4Q8G A;  3M99 A;  2AYN A;  3ZVZ B;  2DC8 A;  2P7U A;  3QSD A;  1Y4H A;  2ECW A;  1BP4 A;  3U5M A;  2KU3 A;  1O0E A;  2MT5 A;  1PAD A;  4R8P K;  2B1M A;  2G6D A;  2G8J A;  3U5P A;  1ME4 A;  1YK7 A;  4CCG X;  2OXQ C;  1DEU A;  5TRB A;  2OUL A;  2WBF X;  3GCB A;  2NQI A;  5TDR A;  1FBV A;  1U9Q X;  3T6R A;  3WXE A;  2VHF A;  2UZG A;  3O34 A;  3AI8 A;  1EWL A;  2KGG A;  2HH5 A;  3N3K A;  2ECI A;  1M6D A;  2ATO A;  2FQ9 A;  2KWK A;  3N9Q A;  4K7C A;  1AYU A;  3ZUA A;  1F2B A;  4I7D A;  4W5C A;  4MZS A;  4B7Y C;  2MA5 A;  4FK5 A;  1CV8 A;  2DJG B;  3OVZ A;  5KH3 A;  2LV9 A;  2IBI A;  2AYO A;  2VJE A;  3KW9 A;  3U5N A;  2XB1 A;  2MNY A;  1MEM A;  3CBK A;  4GND A;  4DMX A;  2VJF A;  1YK8 A;  4PP1 A;  2YYR A;  1W6F A;  1CHC A;  3RVX A;  1VFY A;  2F6J A;  3P5U A;  2H0D A;  3PDF A;  2ECV A;  3PBH A;  1YAL A;  1SNK A;  4X6J A;  2AVW A;  2DC9 A;  2HHN A;  3DF0 A;  1Z60 A;  3WXF A;  1WIL A;  2RSD A;  4KLB A;  3IHP A;  4OEM A;  3MOR A;  4P5O B;  2JMI A;  2VP7 A;  2YHO A;  4YVA A;  2FRA A;  2VNF A;  1G25 A;  4LK9 A;  2VHS A;  1WE9 A;  3L11 A;  1WFK A;  5JG6 A;  2AS8 A;  3K24 A;  2XU4 A;  1FP0 A;  1MM2 A;  4BS5 A;  2PNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...