4WA6A

Structure of yeast saga dubm with sgf73 n59d mutant at 2.36 angstroms resolution
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
471
structure length
440
Chain Sequence
MSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALNRQTGFIYLLTCAWKIQDAHEFWQFIINQIHQSYVLDLPNAKEVSRANNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNYHCGECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transcription
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
total genus 141
structure length 440
sequence length 471
chains with identical sequence D
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4wa6A01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4wa6A02
4UI9B 2OULA 3CBKA 2E02A 3O33A 4BS5A 2H0DA 4KLBA 1U9WA 2VP7A 1AU2A 2L43A 2C0YA 4ZDTA 4YBSA 2MA5A 2P0RA 1NB3A 3LFYA 2PUYA 5FERA 2KFTA 5TBNA 1ME4A 1U5IA 2BDZA 2D8SA 3U5OA 5B76A 4LKAA 2QIZA 3SHBA 2ACTA 2IBIA 3SOXA 1QDQA 1PE6A 2YT5A 1O0EA 4YATA 2YQMA 3L1XA 4V3LC 2KWOA 4Q8HA 2DCDA 2F6JA 4X6HA 2C2LA 4L58A 4QF3A 4X3GA 4IC3A 3FL2A 3BCNA 2MUMA 3ZYQA 3PHDA 1XWHA 1F2AA 1WEQA 4GNGA 4I7CA 4CDCB 2RI7A 3MHHA 4ZUXU 2FO5A 2LDRA 2MNYA 2ZETC 3CH3X 4K7CA 4A49A 2CKLB 2MT5A 2QJ0A 3O35A 3BPMA 5CVOB 1WEWA 5JH3A 5CVMA 3K9MA 3PDFA 4XR7A 1CHCA 2G7YA 1EWOA 1CTEA 3IV2A 2LQ6A 2ECWA 3IHPA 3O34A 4FK5A 4ZQLA 2AVWA 5TABA 1CVZA 3KV6A 4R7EA 3NG2A 4AXLA 3ZUAA 3LQJA 2XU5A 2LXPC 1VD4A 5FEYA 3N3KA 1WILA 3PW3A 2AU1A 2C2VS 4S3OB 3T7LA 3ZVZB 1VYXA 1MM3A 3BOWA 3LQHA 2OXQC 1ZCMA 3IEJA 2IDAA 3QZVA 2HYED 4YV8A 1Z60A 2OP3A 1ME3A 3EB5A 4YC9A 1JM7B 2M1RA 2VPBA 2VPGA 3M99A 4O64A 2NQAA 4BHWA 4OELA 3I3TA 4YBMA 3LXSA 2YW8A 3HTKC 1X4IA 2R9NA 3P5XA 4AXMA 4V3KC 2JMIA 3O1GA 1AU3A 3F75A 1BGOA 1G25A 1HYIA 4QRVA 1YVBA 3D6SA 1QMYA 4X6IA 3SOWA 4GNDA 3S3RA 1HUCB 2KGGA 5LKUA 2JQFR 2DX8A 4Q6FA 1FH0A 2K4DA 2NAAA 3KX1A 4QBBA 1NL6A 2CSYA 2YQLA 4I7DA 3KSEA 3PURA 4AP4A 5J3XA 2FT2A 2KREA 5B79A 1GLOA 1F2BA 2F1GA 2G6DA 3HHAA 4CCGX 1CS8A 2KU3A 1WEUA 2Y5BA 3P5UA 1NB5A 3DPLR 1PPOA 3V6CA 3KKUA 2B1MA 2KIZA 2FYEA 1THEA 5I3LA 4A0CD 3ZTGA 2Y43A 4QRXA 2KWNA 1T1HA 1N87A 2UZGA 1TU6A 2AYNA 4I7BA 5AIUA 1VFYA 4RY2A 5H1UA 4WZ0A 3OVXA 3T6RA 2DZYA 1PPPA 4GNEA 2VJEA 2YU4A 1NPZA 5TRBA 3KV5A 1AYVA 2K1JA 2VHSA 1PPNA 5A24A 3OISA 2RSDA 2JRJA 1AU0A 3VK6A 1MDWA 2HDPA 2YUCA 3V6EA 1U9QX 2G43A 2R6NA 2L0BA 2PREA 1CB5A 2P7UA 2VJFA 4GB0A 2PADA 1GCBA 2OZ2A 4W5BA 2R9OA 5D1LB 3DF0A 2MD8C 3ASLA 5DKAA 3RPGC 5AITA 1JM7A 1K3BB 3S3QA 4UP0A 2BDLA 3AI8A 1PBHA 7PCKA 1QOLA 3HCUA 2QICA 5CHTA 1U9VA 5H1VA 4PI3A 4BSQA 3O7AA 4P6GA 3GL6A 5H9MA 2YHOA 2VJEB 2YHNA 3KFQA 2KR4A 2PNSA 2VPDA 2EA6A 3HD3A 4AYCB 3MORA 5K16A 1CSBB 2JMDA 2R9FA 4YABA 5JG6A 1Y4HA 3BWKA 3QT4A 2L80A 3M62A 3U5MA 3B79A 4G54A 2E03A 2CIOA 4IC2A 5B75A 3WXFA 1X9YA 3LQIA 2ECJA 1FP0A 5FB0A 4P5OB 2KYUA 2IPPB 2YJ9A 3HWNA 1ITOA 4W5CA 3KQIA 2JMJA 3N9PA 3TNXA 4HWYA 4FO9A 1MEMA 2I50A 2FUUA 4YYUA 2YSJA 1Z2QA 4TKPB 3N9QA 1MIRA 4OEMA 3M63A 2R9CA 1F29A 4QF2A 2DZZA 3ERVA 2G8EA 4Q8GA 3L11A 4PPEA 2AUXA 1MEGA 3QJ3A 4QH6A 1MHWA 1PCIA 2JQGR 2AS8A 2ECGA 2XU1A 4BBQA 3WXGA 5H1TA 2CKLA 3L1ZB 2DC6A 1V87A 3IUTA 4A4CA 2G6QA 4WZ2A 1ATKA 1M6DA 1KFXL 1U9XA 3H8CA 2XEUA 3HHIA 5LKTA 5CHVA 5C11A 4DMYA 4YADA 4S3OC 3P5WA 3N9LA 4YBTA 3OF9A 4LJNA 4BS6A 2DC7A 4AYCA 2DJGB 3I06A 3N9NA 1DF0A 2LV9A 2LGLA 5CVNB 3U8EA 3KNVA 2AIMA 2FUIA 1U6GB 2CB5A 3PUQA 4WA6A 1POPA 2F42A 5F02A 1BP4A 4F52B 6PADA 4QRGA 1WEPA 1STFE 4DMXA 1WFKA 1WGMA 5D1MB 3H6SA 4CDEB 2GFOA 2VPEA 1WEOA 4I04A 3RVWA 2AUZA 3OF8A 1PIPA 2DCBA 3K24A 3H7DA 1SNKA 1EWPA 4PP2E 1RMDA 2GHUA 4R8PK 5EYAF 2YSMA 5D1KB 4GNFA 5TDRA 2MA6A 1MM2A 2H0DB 1KHPA 4N8WA 1HYJA 3NHEA 2FQ9A 2YJCA 3C6WA 4L7XA 2FRAA 2Y1NA 5C13A 1PADA 3WXEA 3RPGB 4MSXA 2LGKA 4W4UA 3CBJA 1WEEA 5KH3A 4R2YA 5LKZA 5PADA 9PAPA 3LRQA 3O36A 3ZPV1 1CV8A 5EGWA 1NLJA 2H7JA 2DCCA 4LK9A 4YYSA 2F6NA 2EGPA 2YYRA 1AYUA 3ZVYA 2L5UA 3C5KA 1K2FA 3DQVR 3U5PA 1Y08A 1Z6UA 2HD5A 4MZSA 4XUIA 1KHQA 3EB6A 4A4BA 2Y6EA 3IMAA 3ZPVE 2XU4A 4FJCA 2MIQA 2YJ8A 2E6SA 2VNFA 2KGIA 3N9OA 4BQVA 4UP5A 1ICFA 3P5VA 2ECVA 1ZIVA 5B77A 2DC8A 4MZOA 3U5NA 2FUDA 2VJFB 1QXPA 2ECIA 3HCTA 2E01A 1WIMA 5FB1A 5G05B 2NQGA 1YK8A 2DJFB 2F7DA 2XB1A 1KXRA 2LN0A 1Q6KA 4AVXA 3MHSA 1LDJB 3USVA 3BC3A 2YURA 4B86C 1IWDA 1SP4B 4YYWA 4PTBA 4CA1A 2KE1A 5G04B 5KH9A 4PP1A 8PCHA 3KWBX 2ARYA 3MTNA 1KFUL 2VHFA 1CJLA 3I2DA 4C9ZA 2AN6A 2Y1MA 2WBFX 2KWKA 1AYWA 4YVAA 3O0UA 1LDKC 2AYOA 2E6RA 3ZNIA 2ATOA 4YYQA 1A6RA 4N4FA 1BORA 1WEVA 1WEMA 1IYMA 1F2CA 5B78A 3F5VA 4YYRA 1PPDA 5J94A 5FPWA 5DINA 3H8BA 1EWMA 3KW9A 2B1NA 1AECA 4FIPA 1DEUA 3O70A 3KWZA 2DCAA 3N3GA 3O37A 4N4ZA 2L75A 1WENA 3V43A 1XKGA 1FBVA 2HXZA 2BAYA 4N79A 5LCWB 3SOUA 2FTDA 3K8UA 3E1ZB 2FSAA 4BPVA 4AUQB 4YYVA 2LGGA 1WESA 2G8JA 1CQDA 2HH5A 1WE9A 3HCSA 4I07A 1TL9A 2K17A 3RVVA 5JA7A 3BPFA 2E00A 5EF4A 2P86A 4LLBA 3PBHA 5TDWA 5B8DA 1EF7A 2R9MA 1TLOA 3OVZA 4LADB 1YT7A 2DC9A 5KH7A 2K16A 4X6JA 1NQCA 1JOCA 4N3WA 1BY8A 4MVTA 1AIMA 1GMYA 1BQIA 2NQDB 2PNXA 1EWLA 5LKXA 3QSDA 1F62A 1PXVA 2YJ2A 3N4CA 2FRQA 4CDFB 2M6MA 3RVXA 2YREA 4B7YC 1YK7A 2PBHA 1CPJA 3N9MA 1E4UA 1AU4A 2CSZA 2LGVA 1X4JA 1ZBDB 1X4UA 4PADA 2LRIC 2CT2A 2M85A 4CDDB 3PNRA 1S4VA 3C9EA 2ECNA 1DVPA 4NN2A 4XI1A 4P6EA 2MNZA 2O6XA 4WZ3B 2ECTA 2KWJA 5G0FA 1MS6A 4CZWA 3GV4A 2NQIA 4I05A 2HHNA 1VSNA 2M3HA 2LXHC 1JQPA 1VJVA 2G45A 2YJBA 1GECE 3RTRB 2XU3A 1YALA 4YAXA 3IOQA 2MD7B 3CH2X 3GCBA 3H89A 2EODA
chains in the Genus database with same CATH superfamily
4UI9B 2OULA 2DSMA 3CBKA 2E02A 3E2DA 3O33A 4BS5A 2H0DA 4KLBA 1U9WA 2UZJA 2VP7A 4R3DA 1AU2A 2L43A 2C0YA 4ZDTA 4YBSA 4HXDB 2MA5A 2P0RA 1NB3A 3LFYA 2PUYA 5FERA 2KFTA 5TBNA 1ME4A 1U5IA 2BDZA 2D8SA 3U5OA 5B76A 4LKAA 2QIZA 3SHBA 2ACTA 2IBIA 3SOXA 1QDQA 1PE6A 2YT5A 1O0EA 4YATA 2YQMA 3L1XA 4V3LC 2KWOA 4Q8HA 2FFWA 2DCDA 2F6JA 4X6HA 2C2LA 4L58A 4QF3A 3KDEC 4X3GA 5KO3A 4IC3A 3FL2A 3BCNA 2MUMA 5E6JA 4OGCA 3ZYQA 3PHDA 1XWHA 1F2AA 1WEQA 4GNGA 4I7CA 4CDCB 3OQCA 2RI7A 3MHHA 4ZUXU 2FO5A 2LDRA 2MNYA 2ZETC 3CH3X 4RNAA 3PHUA 4K7CA 4A49A 2CKLB 2MT5A 2QJ0A 3LVRE 3O35A 3BPMA 1WEWA 5CVOB 5JH3A 5CVMA 3K9MA 3PDFA 4XR7A 4D8BA 1CHCA 2G7YA 1EWOA 1CTEA 3IV2A 2LQ6A 2ECWA 3IHPA 3O34A 4FK5A 4ZQLA 2AVWA 5SVXA 5TABA 1CVZA 3PSEA 3KV6A 4R7EA 3NG2A 4AXLA 3ZUAA 3LQJA 2XU5A 2LXPC 1VD4A 5FEYA 3N3KA 1WILA 3PW3A 2AU1A 2C2VS 4S3OB 3T7LA 3ZVZB 2FE8A 1VYXA 1MM3A 3BOWA 3LQHA 2OXQC 1ZCMA 3IEJA 2IDAA 3QZVA 2HYED 3M7KA 4YV8A 3LVQE 1Z60A 3PRPA 2OP3A 1ME3A 3EB5A 5SVYA 4YC9A 1JM7B 2M1RA 2VPBA 2VPGA 3M99A 4O64A 2NQAA 4BHWA 4OELA 3I3TA 4YBMA 3LXSA 2YW8A 3HTKC 1X4IA 2R9NA 3P5XA 4AXMA 4V3KC 2JMIA 3O1GA 2HWKA 1AU3A 3MTVA 3F75A 1BGOA 1G25A 1HYIA 4Z0RA 1UKFA 4QRVA 1YVBA 3D6SA 1QMYA 4X6IA 3SOWA 4GNDA 3S3RA 1HUCB 2KGGA 5LKUA 2JQFR 4MM3B 2DX8A 2KKYA 4Q6FA 1FH0A 3MP2A 2K4DA 2NAAA 3BB7A 3KX1A 1NL6A 4QBBA 2CSYA 4OVZB 2YQLA 4I7DA 3KSEA 3PURA 4AP4A 5J3XA 2FT2A 2KREA 5B79A 1GLOA 1F2BA 2F1GA 2G6DA 3HHAA 4CCGX 1CS8A 2KU3A 1WEUA 3O65A 2Y5BA 2EGMA 3JUEA 3P5UA 1NB5A 3DPLR 1PPOA 3V6CA 3KKUA 2B1MA 2KIZA 2FYEA 1THEA 5I3LA 3ZTGA 4A0CD 2Y43A 4QRXA 2LAUA 2KWNA 1T1HA 1N87A 2UZGA 1TU6A 2AYNA 4I7BA 5AIUA 1VFYA 4RY2A 5H1UA 4WZ0A 3OVXA 3T6RA 2DZYA 1PPPA 4GNEA 2VJEA 2YU4A 1NPZA 5TRBA 3KV5A 1AYVA 2K1JA 2VHSA 1PPNA 5A24A 2J7QA 3OISA 2RSDA 2YVRA 2OWAA 2JRJA 1AU0A 4OVZA 3VK6A 1MDWA 2HDPA 2YUCA 3V6EA 1U9QX 2G43A 2JUNA 2DJAA 2R6NA 4MI7A 2L0BA 2PREA 1CB5A 2P7UA 2VJFA 4GB0A 2PADA 1GCBA 2CONA 2OZ2A 4W5BA 2R9OA 5D1LB 3DF0A 2MD8C 3ASLA 5DKAA 3RPGC 5AITA 1JM7A 1K3BB 3S3QA 4UP0A 2BDLA 2CSVA 2E61A 3AI8A 1PBHA 7PCKA 1QOLA 3C0RA 3PRMA 4D8IA 3HCUA 3T9KA 2QICA 5CHTA 1U9VA 5H1VA 4PI3A 4BSQA 3O7AA 4P6GA 3GL6A 5H9MA 4IUMA 2YHOA 2VJEB 2YHNA 3KFQA 4ZTBA 2KR4A 2PNSA 2VPDA 2EA6A 3HD3A 4AYCB 5SVIB 3MORA 5K16A 2JM3A 1CSBB 2JMDA 2R9FA 4YABA 5JG6A 1Y4HA 3BWKA 3QT4A 2AGAA 4BOZA 2L80A 3M62A 3U5MA 3B79A 4G54A 2E03A 2CIOA 4IC2A 5B75A 4RF1A 3WXFA 1X9YA 3LQIA 2ECJA 1FP0A 5FB0A 4P5OB 2KYUA 2IPPB 2YJ9A 3HWNA 1ITOA 4W5CA 3KQIA 2JMJA 3N9PA 2KKXA 3TNXA 4HWYA 4FO9A 1MEMA 2I50A 2FUUA 4YYUA 2YSJA 1Z2QA 4TKPB 1MBMA 4BOSA 3N9QA 1MIRA 4OEMA 3M63A 1PVJA 2R9CA 1F29A 4QF2A 2DZZA 3ERVA 2G8EA 4Q8GA 3L11A 4PPEA 2AUXA 1MEGA 3MJ5A 3QJ3A 4QH6A 1MHWA 1PCIA 2JQGR 2AS8A 2ECGA 2XU1A 3W30A 4BBQA 3WXGA 2FD4A 5H1TA 2CKLA 3L1ZB 2DC6A 1V87A 3IUTA 4A4CA 2G6QA 4D8EA 4WZ2A 1ATKA 1M6DA 4F1PA 1KFXL 1U9XA 3H8CA 2XEUA 3HHIA 5LKTA 5CHVA 5C11A 4DMYA 4YADA 4S3OC 3P5WA 3N9LA 3FANA 4YBTA 3OF9A 4LJNA 4BS6A 2DC7A 4AYCA 3FAOA 2DJGB 2BTWA 4REZA 3TRKA 3I06A 3N9NA 2XOYA 3LDYA 3Q1DA 2D8UA 1DF0A 2LV9A 2IQJA 2LGLA 5CVNB 3SUBA 3KNVA 2AIMA 2FUIA 4XZXA 3U8EA 1U6GB 2CB5A 3PUQA 4WA6A 1POPA 2F42A 5F02A 1BP4A 4OW0A 4F52B 6PADA 4QRGA 1WEPA 1STFE 4DMXA 3FEHA 1WFKA 1WGMA 5D1MB 3H6SA 4CDEB 2GFOA 4WURA 2VPEA 1WEOA 4I04A 3RVWA 2AUZA 3OF8A 1PIPA 2DCBA 3K24A 3H7DA 3FM8C 1SNKA 1EWPA 4PP2E 1RMDA 3PLWA 2GHUA 4R8PK 5EYAF 2YSMA 5D1KB 4GNFA 5TDRA 2MA6A 1MM2A 2H0DB 1KHPA 4N8WA 1HYJA 3PHWA 3NHEA 2FQ9A 5EZQA 4QQ4A 2YJCA 3C6WA 4L7XA 2FRAA 2Y1NA 5C13A 1PADA 3WXEA 3RPGB 4MSXA 2LGKA 4W4UA 3E9SA 3H7HA 1WEEA 5KH3A 4R2YA 5LKZA 3BY4A 3CBJA 3LRQA 5PADA 3O36A 3ZPV1 1CV8A 5EGWA 9PAPA 1NLJA 2H7JA 2DCCA 4LK9A 4YYSA 2F6NA 3RNVA 2EGPA 2YYRA 1AYUA 3ZVYA 3ZNHA 4Z0OA 2L5UA 3C5KA 1K2FA 3DQVR 3U5PA 1Y08A 1Z6UA 2HD5A 1YZBA 4MZSA 4RF0A 4XUIA 1KHQA 3EB6A 4A4BA 2BTWB 2Y6EA 2XOCA 3IMAA 3ZPVE 2XU4A 5EZSA 4FJCA 2MIQA 2YJ8A 2E6SA 2VNFA 2KGIA 3N9OA 4BQVA 2RR4A 4UP5A 1ICFA 2ECVA 1ZIVA 5B77A 3P5VA 2DC8A 4MZOA 4BOQA 3U5NA 2FUDA 2VJFB 1QXPA 2ECIA 3HCTA 2E01A 1WIMA 5FB1A 5G05B 2NQGA 1YK8A 2DJFB 2F7DA 2XB1A 1KXRA 2LN0A 1Q6KA 4AVXA 3BBAA 3MHSA 4P16A 1LDJB 3USVA 3BC3A 2YURA 2XP0A 4A5UA 4B86C 1IWDA 1SP4B 2L7PA 4YYWA 2B0OE 4PTBA 4CA1A 2KE1A 5G04B 5KH9A 4PP1A 8PCHA 2CRWA 3KWBX 2ARYA 3MTNA 1KFUL 2VHFA 1CJLA 3I2DA 4C9ZA 2BU3A 2AN6A 2Y1MA 2WBFX 2KWKA 4BOPA 1AYWA 2J7QC 4YVAA 3O0UA 1LDKC 5SVIA 2AYOA 2E6RA 3DDTA 3ZNIA 2ATOA 4YYQA 1A6RA 4N4FA 1BORA 1WEVA 1WEMA 2CRRA 4GUAA 1IYMA 1F2CA 5B78A 3F5VA 3W31A 4YYRA 1PPDA 5J94A 5FPWA 5DINA 3PT2A 3H8BA 3O47A 1EWMA 3KW9A 2B1NA 1AECA 4M0WA 4FIPA 1DEUA 3O70A 3KWZA 1DCQA 2DCAA 2JTCA 3B21A 3N3GA 3O37A 4N4ZA 2L75A 1WENA 3V43A 1XKGA 1FBVA 2HXZA 2BAYA 4N79A 5LCWB 3SOUA 2FTDA 3K8UA 3E1ZB 2FSAA 2P57A 2MKEA 4BPVA 5K3QA 4AUQB 4YYVA 2LGGA 1WESA 2G8JA 1CQDA 2HH5A 1WE9A 3HCSA 4I07A 1TL9A 2K17A 3RVVA 5JA7A 2DOSA 3IFUA 3BPFA 2E00A 5EF4A 2P86A 4LLBA 3PBHA 5TDWA 5B8DA 1EF7A 2R9MA 1TLOA 3OVZA 4LADB 1YT7A 4O62A 3DWDA 2DC9A 5KH7A 2K16A 4X6JA 1NQCA 5JZEA 1JOCA 4N3WA 1BY8A 4MVTA 4RKXA 1AIMA 1GMYA 4OGEA 1BQIA 2NQDB 2PNXA 1EWLA 5LKXA 3QSDA 4IP3A 1F62A 1PXVA 2YJ2A 2JRIA 3N4CA 2FRQA 4CDFB 2M6MA 3RVXA 2YREA 4B7YC 1YK7A 2PBHA 1CPJA 3FJUB 3N9MA 1E4UA 1AU4A 1DKIA 3LJUX 4H9DA 2CSZA 2EXUA 2LGVA 3MDBC 1X4JA 1ZBDB 1X4UA 4PADA 2LRIC 2CT2A 3PHXA 2M85A 4CDDB 3PNRA 1S4VA 3C9EA 2ECNA 1DVPA 4NN2A 4XI1A 4P6EA 2MNZA 4PT5A 2O6XA 4WZ3B 2ECTA 2KWJA 5G0FA 2XOZA 4BOUA 3TMPA 1MS6A 4CZWA 3GV4A 2NQIA 2Z84A 2HHNA 1VSNA 2M3HA 2LXHC 1JQPA 1VJVA 4I05A 2G45A 2YJBA 1GECE 3RTRB 2XU3A 1YALA 4YAXA 3IOQA 2MD7B 3CH2X 3GCBA 2M13A 3H89A 2EODA
chains in the Genus database with same CATH topology
4UI9B 2OULA 3CBKA 2E02A 3O33A 1W4TA 2H0DA 4KLBA 4BS5A 1U9WA 2VP7A 1AU2A 2L43A 2C0YA 4ZDTA 4YBSA 2MA5A 2P0RA 1NB3A 3LFYA 2PUYA 5FERA 2KFTA 5TBNA 1ME4A 1U5IA 2BDZA 3D9WA 2D8SA 3U5OA 5B76A 4LKAA 2QIZA 3SHBA 2ACTA 2IBIA 3SOXA 1QDQA 1PE6A 2YT5A 1O0EA 4YATA 2YQMA 3L1XA 4V3LC 2KWOA 4Q8HA 2DCDA 2F6JA 4X6HA 2C2LA 4L58A 4QF3A 4X3GA 4IC3A 3FL2A 3BCNA 2MUMA 3ZYQA 3PHDA 1XWHA 1F2AA 1WEQA 4GNGA 4I7CA 4CDCB 2RI7A 3MHHA 4ZUXU 2FO5A 2LDRA 2MNYA 2ZETC 3CH3X 1W5RA 4K7CA 4A49A 2CKLB 2MT5A 2QJ0A 3O35A 3BPMA 5CVOB 1WEWA 5JH3A 5CVMA 3K9MA 3PDFA 4XR7A 1CHCA 2G7YA 1EWOA 1CTEA 3IV2A 2LQ6A 2ECWA 3IHPA 3O34A 4FK5A 4ZQLA 2AVWA 5TABA 1CVZA 3KV6A 4R7EA 3NG2A 4AXLA 3ZUAA 3LQJA 2XU5A 2LXPC 1VD4A 5FEYA 3N3KA 1WILA 3PW3A 2AU1A 2C2VS 4S3OB 3T7LA 3ZVZB 1VYXA 1MM3A 3BOWA 3LQHA 2OXQC 1ZCMA 3IEJA 2IDAA 3QZVA 2HYED 4YV8A 1Z60A 2OP3A 1ME3A 3EB5A 4YC9A 1JM7B 2M1RA 2VPBA 2VPGA 3M99A 2VFBA 4O64A 2NQAA 4BHWA 4OELA 3I3TA 4YBMA 3LXSA 2YW8A 3HTKC 1X4IA 2R9NA 3P5XA 4AXMA 4V3KC 2JMIA 3O1GA 1AU3A 3F75A 1BGOA 1G25A 1HYIA 4QRVA 1YVBA 3D6SA 1QMYA 4X6IA 3SOWA 4GNDA 3S3RA 1HUCB 2KGGA 5LKUA 2JQFR 4NV8A 2DX8A 4Q6FA 1FH0A 2K4DA 2NAAA 3KX1A 4QBBA 1NL6A 2CSYA 2YQLA 4I7DA 3KSEA 3PURA 4AP4A 5J3XA 2FT2A 2KREA 5B79A 1GLOA 1F2BA 2F1GA 2G6DA 3HHAA 4CCGX 1CS8A 2KU3A 1WEUA 2Y5BA 3P5UA 1NB5A 3DPLR 1PPOA 3V6CA 3KKUA 2B1MA 2KIZA 2FYEA 1THEA 5I3LA 4A0CD 3ZTGA 2Y43A 4QRXA 2KWNA 1T1HA 1N87A 2UZGA 1TU6A 2AYNA 4I7BA 5AIUA 2BSZA 1VFYA 4RY2A 5H1UA 4WZ0A 3OVXA 3T6RA 2DZYA 1PPPA 4GNEA 2VJEA 2YU4A 1E2TA 1NPZA 5TRBA 3KV5A 1AYVA 2K1JA 2VHSA 1PPNA 5A24A 4C5PA 3OISA 2RSDA 2JRJA 1AU0A 3VK6A 1MDWA 2HDPA 2YUCA 3V6EA 1U9QX 2G43A 2R6NA 2L0BA 2PREA 1CB5A 2P7UA 2VJFA 4GB0A 2PADA 1GCBA 2OZ2A 4W5BA 2R9OA 5D1LB 3DF0A 2MD8C 3ASLA 5DKAA 3RPGC 5AITA 1JM7A 1K3BB 3S3QA 4UP0A 2BDLA 3AI8A 1PBHA 7PCKA 1QOLA 3HCUA 2QICA 5CHTA 1U9VA 5H1VA 4PI3A 4BSQA 3O7AA 4P6GA 3GL6A 5H9MA 2YHOA 2VJEB 2YHNA 3KFQA 2KR4A 2PNSA 2VPDA 2EA6A 3HD3A 4AYCB 3MORA 5K16A 1CSBB 2JMDA 2R9FA 4YABA 5JG6A 1Y4HA 3BWKA 3QT4A 2L80A 3M62A 4B55A 3U5MA 3B79A 4G54A 2E03A 2CIOA 4IC2A 5B75A 3WXFA 1X9YA 3LQIA 2ECJA 1FP0A 5FB0A 4P5OB 2KYUA 2IPPB 2YJ9A 3HWNA 1ITOA 4W5CA 3KQIA 2JMJA 3N9PA 3TNXA 4HWYA 4FO9A 1MEMA 2I50A 2FUUA 4YYUA 2YSJA 1Z2QA 4TKPB 3N9QA 1MIRA 4OEMA 3M63A 2R9CA 1F29A 4QF2A 2DZZA 3ERVA 2G8EA 4Q8GA 3L11A 4PPEA 2AUXA 1MEGA 3QJ3A 4QH6A 1MHWA 1PCIA 2JQGR 2AS8A 2ECGA 2XU1A 4BBQA 3WXGA 5H1TA 2CKLA 3L1ZB 2DC6A 1V87A 3IUTA 4A4CA 2G6QA 4WZ2A 1ATKA 1M6DA 1KFXL 1U9XA 3H8CA 2XEUA 3HHIA 5LKTA 5CHVA 5C11A 4DMYA 4YADA 4S3OC 3P5WA 3N9LA 4YBTA 3OF9A 4LJNA 4BS6A 2DC7A 4AYCA 2DJGB 2VFCA 3I06A 3N9NA 1DF0A 2LV9A 2LGLA 5CVNB 3U8EA 3KNVA 2AIMA 2FUIA 1U6GB 2CB5A 3PUQA 4WA6A 1POPA 2F42A 5F02A 1BP4A 4F52B 6PADA 4QRGA 1WEPA 1STFE 4DMXA 1WFKA 1WGMA 5D1MB 3H6SA 4CDEB 2GFOA 2VPEA 1WEOA 4I04A 3RVWA 2AUZA 3OF8A 1PIPA 2DCBA 3K24A 3H7DA 1SNKA 1EWPA 4PP2E 1RMDA 2GHUA 4R8PK 5EYAF 2YSMA 5D1KB 4GNFA 5TDRA 2MA6A 1MM2A 2H0DB 1KHPA 4N8WA 1HYJA 3NHEA 2FQ9A 2YJCA 3C6WA 4L7XA 2FRAA 2Y1NA 5C13A 1PADA 3WXEA 3RPGB 4MSXA 2LGKA 4W4UA 3CBJA 1WEEA 5KH3A 4R2YA 5LKZA 5PADA 9PAPA 3LRQA 3O36A 3ZPV1 1CV8A 5EGWA 1NLJA 2H7JA 2DCCA 4LK9A 4YYSA 2F6NA 2EGPA 2YYRA 1AYUA 3ZVYA 2L5UA 3C5KA 1K2FA 3DQVR 3U5PA 1Y08A 1Z6UA 2HD5A 4MZSA 4XUIA 1KHQA 3EB6A 4A4BA 2Y6EA 3IMAA 3ZPVE 2XU4A 4FJCA 2MIQA 2YJ8A 2E6SA 2VNFA 2KGIA 3N9OA 4BQVA 4UP5A 1ICFA 3P5VA 2ECVA 1ZIVA 5B77A 2DC8A 4MZOA 3U5NA 2FUDA 2VJFB 1QXPA 2ECIA 3HCTA 2E01A 1WIMA 5FB1A 5G05B 2NQGA 1YK8A 2DJFB 2F7DA 2XB1A 1KXRA 2LN0A 1Q6KA 4AVXA 3MHSA 4GUZA 1LDJB 3USVA 3BC3A 2YURA 4B86C 1IWDA 1SP4B 4YYWA 4PTBA 4CA1A 2KE1A 5G04B 5KH9A 4PP1A 8PCHA 3KWBX 2ARYA 3MTNA 1KFUL 2VHFA 1CJLA 3I2DA 4C9ZA 2AN6A 2Y1MA 2WBFX 2KWKA 1AYWA 4YVAA 3O0UA 1LDKC 2AYOA 2E6RA 3ZNIA 2ATOA 4YYQA 1A6RA 4N4FA 1BORA 1WEVA 1WEMA 1IYMA 1F2CA 5B78A 3F5VA 4YYRA 1PPDA 5J94A 5FPWA 5DINA 3H8BA 1EWMA 3KW9A 4BGFA 2B1NA 1AECA 4FIPA 1DEUA 3O70A 3KWZA 2DCAA 3N3GA 4NV7A 3O37A 4N4ZA 2L75A 1WENA 3V43A 1XKGA 1FBVA 2HXZA 2BAYA 4N79A 5LCWB 3SOUA 2FTDA 3K8UA 3E1ZB 2FSAA 4BPVA 4AUQB 4YYVA 2LGGA 1WESA 2G8JA 1CQDA 2HH5A 1WE9A 3HCSA 4I07A 1TL9A 2K17A 3RVVA 1W6FA 5JA7A 3BPFA 2E00A 5EF4A 2P86A 4LLBA 3PBHA 5TDWA 5B8DA 1EF7A 2R9MA 1TLOA 1GX3A 3OVZA 4LADB 1YT7A 2DC9A 5KH7A 2K16A 4X6JA 1NQCA 1JOCA 4N3WA 1BY8A 4MVTA 1AIMA 1GMYA 1BQIA 2NQDB 2PNXA 1EWLA 5LKXA 3QSDA 1F62A 1PXVA 2YJ2A 3N4CA 2FRQA 4CDFB 2M6MA 3LTWA 3RVXA 2YREA 4B7YC 1YK7A 2PBHA 1CPJA 3N9MA 1E4UA 1AU4A 2CSZA 2LGVA 1X4JA 1ZBDB 1X4UA 4PADA 2LRIC 2CT2A 2M85A 4CDDB 3PNRA 1S4VA 3C9EA 2ECNA 1DVPA 4NN2A 4XI1A 4P6EA 2MNZA 2O6XA 4WZ3B 2ECTA 2KWJA 5G0FA 1MS6A 4CZWA 3GV4A 2NQIA 4I05A 2HHNA 1VSNA 2M3HA 2LXHC 1JQPA 1VJVA 2G45A 2YJBA 1GECE 3RTRB 2XU3A 1YALA 4YAXA 3IOQA 2MD7B 3CH2X 3GCBA 3H89A 2EODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UI9 B;  2OUL A;  3CBK A;  2E02 A;  3O33 A;  4BS5 A;  2H0D A;  4KLB A;  1U9W A;  2VP7 A;  1AU2 A;  2L43 A;  2C0Y A;  4ZDT A;  4YBS A;  2MA5 A;  2P0R A;  1NB3 A;  3LFY A;  2PUY A;  5FER A;  2KFT A;  5TBN A;  1ME4 A;  1U5I A;  2BDZ A;  2D8S A;  3U5O A;  5B76 A;  4LKA A;  2QIZ A;  3SHB A;  2ACT A;  2IBI A;  3SOX A;  1QDQ A;  1PE6 A;  2YT5 A;  1O0E A;  4YAT A;  2YQM A;  3L1X A;  4V3L C;  2KWO A;  4Q8H A;  2DCD A;  2F6J A;  4X6H A;  2C2L A;  4L58 A;  4QF3 A;  4X3G A;  4IC3 A;  3FL2 A;  3BCN A;  2MUM A;  3ZYQ A;  3PHD A;  1XWH A;  1F2A A;  1WEQ A;  4GNG A;  4I7C A;  4CDC B;  2RI7 A;  3MHH A;  4ZUX U;  2FO5 A;  2LDR A;  2MNY A;  2ZET C;  3CH3 X;  4K7C A;  4A49 A;  2CKL B;  2MT5 A;  2QJ0 A;  3O35 A;  3BPM A;  5CVO B;  1WEW A;  5JH3 A;  5CVM A;  3K9M A;  3PDF A;  4XR7 A;  1CHC A;  2G7Y A;  1EWO A;  1CTE A;  3IV2 A;  2LQ6 A;  2ECW A;  3IHP A;  3O34 A;  4FK5 A;  4ZQL A;  2AVW A;  5TAB A;  1CVZ A;  3KV6 A;  4R7E A;  3NG2 A;  4AXL A;  3ZUA A;  3LQJ A;  2XU5 A;  2LXP C;  1VD4 A;  5FEY A;  3N3K A;  1WIL A;  3PW3 A;  2AU1 A;  2C2V S;  4S3O B;  3T7L A;  3ZVZ B;  1VYX A;  1MM3 A;  3BOW A;  3LQH A;  2OXQ C;  1ZCM A;  3IEJ A;  2IDA A;  3QZV A;  2HYE D;  4YV8 A;  1Z60 A;  2OP3 A;  1ME3 A;  3EB5 A;  4YC9 A;  1JM7 B;  2M1R A;  2VPB A;  2VPG A;  3M99 A;  4O64 A;  2NQA A;  4BHW A;  4OEL A;  3I3T A;  4YBM A;  3LXS A;  2YW8 A;  3HTK C;  1X4I A;  2R9N A;  3P5X A;  4AXM A;  4V3K C;  2JMI A;  3O1G A;  1AU3 A;  3F75 A;  1BGO A;  1G25 A;  1HYI A;  4QRV A;  1YVB A;  3D6S A;  1QMY A;  4X6I A;  3SOW A;  4GND A;  3S3R A;  1HUC B;  2KGG A;  5LKU A;  2JQF R;  2DX8 A;  4Q6F A;  1FH0 A;  2K4D A;  2NAA A;  3KX1 A;  4QBB A;  1NL6 A;  2CSY A;  2YQL A;  4I7D A;  3KSE A;  3PUR A;  4AP4 A;  5J3X A;  2FT2 A;  2KRE A;  5B79 A;  1GLO A;  1F2B A;  2F1G A;  2G6D A;  3HHA A;  4CCG X;  1CS8 A;  2KU3 A;  1WEU A;  2Y5B A;  3P5U A;  1NB5 A;  3DPL R;  1PPO A;  3V6C A;  3KKU A;  2B1M A;  2KIZ A;  2FYE A;  1THE A;  5I3L A;  4A0C D;  3ZTG A;  2Y43 A;  4QRX A;  2KWN A;  1T1H A;  1N87 A;  2UZG A;  1TU6 A;  2AYN A;  4I7B A;  5AIU A;  1VFY A;  4RY2 A;  5H1U A;  4WZ0 A;  3OVX A;  3T6R A;  2DZY A;  1PPP A;  4GNE A;  2VJE A;  2YU4 A;  1NPZ A;  5TRB A;  3KV5 A;  1AYV A;  2K1J A;  2VHS A;  1PPN A;  5A24 A;  3OIS A;  2RSD A;  2JRJ A;  1AU0 A;  3VK6 A;  1MDW A;  2HDP A;  2YUC A;  3V6E A;  1U9Q X;  2G43 A;  2R6N A;  2L0B A;  2PRE A;  1CB5 A;  2P7U A;  2VJF A;  4GB0 A;  2PAD A;  1GCB A;  2OZ2 A;  4W5B A;  2R9O A;  5D1L B;  3DF0 A;  2MD8 C;  3ASL A;  5DKA A;  3RPG C;  5AIT A;  1JM7 A;  1K3B B;  3S3Q A;  4UP0 A;  2BDL A;  3AI8 A;  1PBH A;  7PCK A;  1QOL A;  3HCU A;  2QIC A;  5CHT A;  1U9V A;  5H1V A;  4PI3 A;  4BSQ A;  3O7A A;  4P6G A;  3GL6 A;  5H9M A;  2YHO A;  2VJE B;  2YHN A;  3KFQ A;  2KR4 A;  2PNS A;  2VPD A;  2EA6 A;  3HD3 A;  4AYC B;  3MOR A;  5K16 A;  1CSB B;  2JMD A;  2R9F A;  4YAB A;  5JG6 A;  1Y4H A;  3BWK A;  3QT4 A;  2L80 A;  3M62 A;  3U5M A;  3B79 A;  4G54 A;  2E03 A;  2CIO A;  4IC2 A;  5B75 A;  3WXF A;  1X9Y A;  3LQI A;  2ECJ A;  1FP0 A;  5FB0 A;  4P5O B;  2KYU A;  2IPP B;  2YJ9 A;  3HWN A;  1ITO A;  4W5C A;  3KQI A;  2JMJ A;  3N9P A;  3TNX A;  4HWY A;  4FO9 A;  1MEM A;  2I50 A;  2FUU A;  4YYU A;  2YSJ A;  1Z2Q A;  4TKP B;  3N9Q A;  1MIR A;  4OEM A;  3M63 A;  2R9C A;  1F29 A;  4QF2 A;  2DZZ A;  3ERV A;  2G8E A;  4Q8G A;  3L11 A;  4PPE A;  2AUX A;  1MEG A;  3QJ3 A;  4QH6 A;  1MHW A;  1PCI A;  2JQG R;  2AS8 A;  2ECG A;  2XU1 A;  4BBQ A;  3WXG A;  5H1T A;  2CKL A;  3L1Z B;  2DC6 A;  1V87 A;  3IUT A;  4A4C A;  2G6Q A;  4WZ2 A;  1ATK A;  1M6D A;  1KFX L;  1U9X A;  3H8C A;  2XEU A;  3HHI A;  5LKT A;  5CHV A;  5C11 A;  4DMY A;  4YAD A;  4S3O C;  3P5W A;  3N9L A;  4YBT A;  3OF9 A;  4LJN A;  4BS6 A;  2DC7 A;  4AYC A;  2DJG B;  3I06 A;  3N9N A;  1DF0 A;  2LV9 A;  2LGL A;  5CVN B;  3U8E A;  3KNV A;  2AIM A;  2FUI A;  1U6G B;  2CB5 A;  3PUQ A;  4WA6 A;  1POP A;  2F42 A;  5F02 A;  1BP4 A;  4F52 B;  6PAD A;  4QRG A;  1WEP A;  1STF E;  4DMX A;  1WFK A;  1WGM A;  5D1M B;  3H6S A;  4CDE B;  2GFO A;  2VPE A;  1WEO A;  4I04 A;  3RVW A;  2AUZ A;  3OF8 A;  1PIP A;  2DCB A;  3K24 A;  3H7D A;  1SNK A;  1EWP A;  4PP2 E;  1RMD A;  2GHU A;  4R8P K;  5EYA F;  2YSM A;  5D1K B;  4GNF A;  5TDR A;  2MA6 A;  1MM2 A;  2H0D B;  1KHP A;  4N8W A;  1HYJ A;  3NHE A;  2FQ9 A;  2YJC A;  3C6W A;  4L7X A;  2FRA A;  2Y1N A;  5C13 A;  1PAD A;  3WXE A;  3RPG B;  4MSX A;  2LGK A;  4W4U A;  3CBJ A;  1WEE A;  5KH3 A;  4R2Y A;  5LKZ A;  5PAD A;  9PAP A;  3LRQ A;  3O36 A;  3ZPV 1;  1CV8 A;  5EGW A;  1NLJ A;  2H7J A;  2DCC A;  4LK9 A;  4YYS A;  2F6N A;  2EGP A;  2YYR A;  1AYU A;  3ZVY A;  2L5U A;  3C5K A;  1K2F A;  3DQV R;  3U5P A;  1Y08 A;  1Z6U A;  2HD5 A;  4MZS A;  4XUI A;  1KHQ A;  3EB6 A;  4A4B A;  2Y6E A;  3IMA A;  3ZPV E;  2XU4 A;  4FJC A;  2MIQ A;  2YJ8 A;  2E6S A;  2VNF A;  2KGI A;  3N9O A;  4BQV A;  4UP5 A;  1ICF A;  3P5V A;  2ECV A;  1ZIV A;  5B77 A;  2DC8 A;  4MZO A;  3U5N A;  2FUD A;  2VJF B;  1QXP A;  2ECI A;  3HCT A;  2E01 A;  1WIM A;  5FB1 A;  5G05 B;  2NQG A;  1YK8 A;  2DJF B;  2F7D A;  2XB1 A;  1KXR A;  2LN0 A;  1Q6K A;  4AVX A;  3MHS A;  1LDJ B;  3USV A;  3BC3 A;  2YUR A;  4B86 C;  1IWD A;  1SP4 B;  4YYW A;  4PTB A;  4CA1 A;  2KE1 A;  5G04 B;  5KH9 A;  4PP1 A;  8PCH A;  3KWB X;  2ARY A;  3MTN A;  1KFU L;  2VHF A;  1CJL A;  3I2D A;  4C9Z A;  2AN6 A;  2Y1M A;  2WBF X;  2KWK A;  1AYW A;  4YVA A;  3O0U A;  1LDK C;  2AYO A;  2E6R A;  3ZNI A;  2ATO A;  4YYQ A;  1A6R A;  4N4F A;  1BOR A;  1WEV A;  1WEM A;  1IYM A;  1F2C A;  5B78 A;  3F5V A;  4YYR A;  1PPD A;  5J94 A;  5FPW A;  5DIN A;  3H8B A;  1EWM A;  3KW9 A;  2B1N A;  1AEC A;  4FIP A;  1DEU A;  3O70 A;  3KWZ A;  2DCA A;  3N3G A;  3O37 A;  4N4Z A;  2L75 A;  1WEN A;  3V43 A;  1XKG A;  1FBV A;  2HXZ A;  2BAY A;  4N79 A;  5LCW B;  3SOU A;  2FTD A;  3K8U A;  3E1Z B;  2FSA A;  4BPV A;  4AUQ B;  4YYV A;  2LGG A;  1WES A;  2G8J A;  1CQD A;  2HH5 A;  1WE9 A;  3HCS A;  4I07 A;  1TL9 A;  2K17 A;  3RVV A;  5JA7 A;  3BPF A;  2E00 A;  5EF4 A;  2P86 A;  4LLB A;  3PBH A;  5TDW A;  5B8D A;  1EF7 A;  2R9M A;  1TLO A;  3OVZ A;  4LAD B;  1YT7 A;  2DC9 A;  5KH7 A;  2K16 A;  4X6J A;  1NQC A;  1JOC A;  4N3W A;  1BY8 A;  4MVT A;  1AIM A;  1GMY A;  1BQI A;  2NQD B;  2PNX A;  1EWL A;  5LKX A;  3QSD A;  1F62 A;  1PXV A;  2YJ2 A;  3N4C A;  2FRQ A;  4CDF B;  2M6M A;  3RVX A;  2YRE A;  4B7Y C;  1YK7 A;  2PBH A;  1CPJ A;  3N9M A;  1E4U A;  1AU4 A;  2CSZ A;  2LGV A;  1X4J A;  1ZBD B;  1X4U A;  4PAD A;  2LRI C;  2CT2 A;  2M85 A;  4CDD B;  3PNR A;  1S4V A;  3C9E A;  2ECN A;  1DVP A;  4NN2 A;  4XI1 A;  4P6E A;  2MNZ A;  2O6X A;  4WZ3 B;  2ECT A;  2KWJ A;  5G0F A;  1MS6 A;  4CZW A;  3GV4 A;  2NQI A;  4I05 A;  2HHN A;  1VSN A;  2M3H A;  2LXH C;  1JQP A;  1VJV A;  2G45 A;  2YJB A;  1GEC E;  3RTR B;  2XU3 A;  1YAL A;  4YAX A;  3IOQ A;  2MD7 B;  3CH2 X;  3GCB A;  3H89 A;  2EOD A; 
#chains in the Genus database with same CATH topology
 4UI9 B;  2OUL A;  2DSM A;  3CBK A;  2E02 A;  3E2D A;  3O33 A;  4BS5 A;  2H0D A;  4KLB A;  1U9W A;  2UZJ A;  2VP7 A;  4R3D A;  1AU2 A;  2L43 A;  2C0Y A;  4ZDT A;  4YBS A;  4HXD B;  2MA5 A;  2P0R A;  1NB3 A;  3LFY A;  2PUY A;  5FER A;  2KFT A;  5TBN A;  1ME4 A;  1U5I A;  2BDZ A;  2D8S A;  3U5O A;  5B76 A;  4LKA A;  2QIZ A;  3SHB A;  2ACT A;  2IBI A;  3SOX A;  1QDQ A;  1PE6 A;  2YT5 A;  1O0E A;  4YAT A;  2YQM A;  3L1X A;  4V3L C;  2KWO A;  4Q8H A;  2FFW A;  2DCD A;  2F6J A;  4X6H A;  2C2L A;  4L58 A;  4QF3 A;  3KDE C;  4X3G A;  5KO3 A;  4IC3 A;  3FL2 A;  3BCN A;  2MUM A;  5E6J A;  4OGC A;  3ZYQ A;  3PHD A;  1XWH A;  1F2A A;  1WEQ A;  4GNG A;  4I7C A;  4CDC B;  3OQC A;  2RI7 A;  3MHH A;  4ZUX U;  2FO5 A;  2LDR A;  2MNY A;  2ZET C;  3CH3 X;  4RNA A;  3PHU A;  4K7C A;  4A49 A;  2CKL B;  2MT5 A;  2QJ0 A;  3LVR E;  3O35 A;  3BPM A;  1WEW A;  5CVO B;  5JH3 A;  5CVM A;  3K9M A;  3PDF A;  4XR7 A;  4D8B A;  1CHC A;  2G7Y A;  1EWO A;  1CTE A;  3IV2 A;  2LQ6 A;  2ECW A;  3IHP A;  3O34 A;  4FK5 A;  4ZQL A;  2AVW A;  5SVX A;  5TAB A;  1CVZ A;  3PSE A;  3KV6 A;  4R7E A;  3NG2 A;  4AXL A;  3ZUA A;  3LQJ A;  2XU5 A;  2LXP C;  1VD4 A;  5FEY A;  3N3K A;  1WIL A;  3PW3 A;  2AU1 A;  2C2V S;  4S3O B;  3T7L A;  3ZVZ B;  2FE8 A;  1VYX A;  1MM3 A;  3BOW A;  3LQH A;  2OXQ C;  1ZCM A;  3IEJ A;  2IDA A;  3QZV A;  2HYE D;  3M7K A;  4YV8 A;  3LVQ E;  1Z60 A;  3PRP A;  2OP3 A;  1ME3 A;  3EB5 A;  5SVY A;  4YC9 A;  1JM7 B;  2M1R A;  2VPB A;  2VPG A;  3M99 A;  4O64 A;  2NQA A;  4BHW A;  4OEL A;  3I3T A;  4YBM A;  3LXS A;  2YW8 A;  3HTK C;  1X4I A;  2R9N A;  3P5X A;  4AXM A;  4V3K C;  2JMI A;  3O1G A;  2HWK A;  1AU3 A;  3MTV A;  3F75 A;  1BGO A;  1G25 A;  1HYI A;  4Z0R A;  1UKF A;  4QRV A;  1YVB A;  3D6S A;  1QMY A;  4X6I A;  3SOW A;  4GND A;  3S3R A;  1HUC B;  2KGG A;  5LKU A;  2JQF R;  4MM3 B;  2DX8 A;  2KKY A;  4Q6F A;  1FH0 A;  3MP2 A;  2K4D A;  2NAA A;  3BB7 A;  3KX1 A;  1NL6 A;  4QBB A;  2CSY A;  4OVZ B;  2YQL A;  4I7D A;  3KSE A;  3PUR A;  4AP4 A;  5J3X A;  2FT2 A;  2KRE A;  5B79 A;  1GLO A;  1F2B A;  2F1G A;  2G6D A;  3HHA A;  4CCG X;  1CS8 A;  2KU3 A;  1WEU A;  3O65 A;  2Y5B A;  2EGM A;  3JUE A;  3P5U A;  1NB5 A;  3DPL R;  1PPO A;  3V6C A;  3KKU A;  2B1M A;  2KIZ A;  2FYE A;  1THE A;  5I3L A;  3ZTG A;  4A0C D;  2Y43 A;  4QRX A;  2LAU A;  2KWN A;  1T1H A;  1N87 A;  2UZG A;  1TU6 A;  2AYN A;  4I7B A;  5AIU A;  1VFY A;  4RY2 A;  5H1U A;  4WZ0 A;  3OVX A;  3T6R A;  2DZY A;  1PPP A;  4GNE A;  2VJE A;  2YU4 A;  1NPZ A;  5TRB A;  3KV5 A;  1AYV A;  2K1J A;  2VHS A;  1PPN A;  5A24 A;  2J7Q A;  3OIS A;  2RSD A;  2YVR A;  2OWA A;  2JRJ A;  1AU0 A;  4OVZ A;  3VK6 A;  1MDW A;  2HDP A;  2YUC A;  3V6E A;  1U9Q X;  2G43 A;  2JUN A;  2DJA A;  2R6N A;  4MI7 A;  2L0B A;  2PRE A;  1CB5 A;  2P7U A;  2VJF A;  4GB0 A;  2PAD A;  1GCB A;  2CON A;  2OZ2 A;  4W5B A;  2R9O A;  5D1L B;  3DF0 A;  2MD8 C;  3ASL A;  5DKA A;  3RPG C;  5AIT A;  1JM7 A;  1K3B B;  3S3Q A;  4UP0 A;  2BDL A;  2CSV A;  2E61 A;  3AI8 A;  1PBH A;  7PCK A;  1QOL A;  3C0R A;  3PRM A;  4D8I A;  3HCU A;  3T9K A;  2QIC A;  5CHT A;  1U9V A;  5H1V A;  4PI3 A;  4BSQ A;  3O7A A;  4P6G A;  3GL6 A;  5H9M A;  4IUM A;  2YHO A;  2VJE B;  2YHN A;  3KFQ A;  4ZTB A;  2KR4 A;  2PNS A;  2VPD A;  2EA6 A;  3HD3 A;  4AYC B;  5SVI B;  3MOR A;  5K16 A;  2JM3 A;  1CSB B;  2JMD A;  2R9F A;  4YAB A;  5JG6 A;  1Y4H A;  3BWK A;  3QT4 A;  2AGA A;  4BOZ A;  2L80 A;  3M62 A;  3U5M A;  3B79 A;  4G54 A;  2E03 A;  2CIO A;  4IC2 A;  5B75 A;  4RF1 A;  3WXF A;  1X9Y A;  3LQI A;  2ECJ A;  1FP0 A;  5FB0 A;  4P5O B;  2KYU A;  2IPP B;  2YJ9 A;  3HWN A;  1ITO A;  4W5C A;  3KQI A;  2JMJ A;  3N9P A;  2KKX A;  3TNX A;  4HWY A;  4FO9 A;  1MEM A;  2I50 A;  2FUU A;  4YYU A;  2YSJ A;  1Z2Q A;  4TKP B;  1MBM A;  4BOS A;  3N9Q A;  1MIR A;  4OEM A;  3M63 A;  1PVJ A;  2R9C A;  1F29 A;  4QF2 A;  2DZZ A;  3ERV A;  2G8E A;  4Q8G A;  3L11 A;  4PPE A;  2AUX A;  1MEG A;  3MJ5 A;  3QJ3 A;  4QH6 A;  1MHW A;  1PCI A;  2JQG R;  2AS8 A;  2ECG A;  2XU1 A;  3W30 A;  4BBQ A;  3WXG A;  2FD4 A;  5H1T A;  2CKL A;  3L1Z B;  2DC6 A;  1V87 A;  3IUT A;  4A4C A;  2G6Q A;  4D8E A;  4WZ2 A;  1ATK A;  1M6D A;  4F1P A;  1KFX L;  1U9X A;  3H8C A;  2XEU A;  3HHI A;  5LKT A;  5CHV A;  5C11 A;  4DMY A;  4YAD A;  4S3O C;  3P5W A;  3N9L A;  3FAN A;  4YBT A;  3OF9 A;  4LJN A;  4BS6 A;  2DC7 A;  4AYC A;  3FAO A;  2DJG B;  2BTW A;  4REZ A;  3TRK A;  3I06 A;  3N9N A;  2XOY A;  3LDY A;  3Q1D A;  2D8U A;  1DF0 A;  2LV9 A;  2IQJ A;  2LGL A;  5CVN B;  3SUB A;  3KNV A;  2AIM A;  2FUI A;  4XZX A;  3U8E A;  1U6G B;  2CB5 A;  3PUQ A;  4WA6 A;  1POP A;  2F42 A;  5F02 A;  1BP4 A;  4OW0 A;  4F52 B;  6PAD A;  4QRG A;  1WEP A;  1STF E;  4DMX A;  3FEH A;  1WFK A;  1WGM A;  5D1M B;  3H6S A;  4CDE B;  2GFO A;  4WUR A;  2VPE A;  1WEO A;  4I04 A;  3RVW A;  2AUZ A;  3OF8 A;  1PIP A;  2DCB A;  3K24 A;  3H7D A;  3FM8 C;  1SNK A;  1EWP A;  4PP2 E;  1RMD A;  3PLW A;  2GHU A;  4R8P K;  5EYA F;  2YSM A;  5D1K B;  4GNF A;  5TDR A;  2MA6 A;  1MM2 A;  2H0D B;  1KHP A;  4N8W A;  1HYJ A;  3PHW A;  3NHE A;  2FQ9 A;  5EZQ A;  4QQ4 A;  2YJC A;  3C6W A;  4L7X A;  2FRA A;  2Y1N A;  5C13 A;  1PAD A;  3WXE A;  3RPG B;  4MSX A;  2LGK A;  4W4U A;  3E9S A;  3H7H A;  1WEE A;  5KH3 A;  4R2Y A;  5LKZ A;  3BY4 A;  3CBJ A;  3LRQ A;  5PAD A;  3O36 A;  3ZPV 1;  1CV8 A;  5EGW A;  9PAP A;  1NLJ A;  2H7J A;  2DCC A;  4LK9 A;  4YYS A;  2F6N A;  3RNV A;  2EGP A;  2YYR A;  1AYU A;  3ZVY A;  3ZNH A;  4Z0O A;  2L5U A;  3C5K A;  1K2F A;  3DQV R;  3U5P A;  1Y08 A;  1Z6U A;  2HD5 A;  1YZB A;  4MZS A;  4RF0 A;  4XUI A;  1KHQ A;  3EB6 A;  4A4B A;  2BTW B;  2Y6E A;  2XOC A;  3IMA A;  3ZPV E;  2XU4 A;  5EZS A;  4FJC A;  2MIQ A;  2YJ8 A;  2E6S A;  2VNF A;  2KGI A;  3N9O A;  4BQV A;  2RR4 A;  4UP5 A;  1ICF A;  2ECV A;  1ZIV A;  5B77 A;  3P5V A;  2DC8 A;  4MZO A;  4BOQ A;  3U5N A;  2FUD A;  2VJF B;  1QXP A;  2ECI A;  3HCT A;  2E01 A;  1WIM A;  5FB1 A;  5G05 B;  2NQG A;  1YK8 A;  2DJF B;  2F7D A;  2XB1 A;  1KXR A;  2LN0 A;  1Q6K A;  4AVX A;  3BBA A;  3MHS A;  4P16 A;  1LDJ B;  3USV A;  3BC3 A;  2YUR A;  2XP0 A;  4A5U A;  4B86 C;  1IWD A;  1SP4 B;  2L7P A;  4YYW A;  2B0O E;  4PTB A;  4CA1 A;  2KE1 A;  5G04 B;  5KH9 A;  4PP1 A;  8PCH A;  2CRW A;  3KWB X;  2ARY A;  3MTN A;  1KFU L;  2VHF A;  1CJL A;  3I2D A;  4C9Z A;  2BU3 A;  2AN6 A;  2Y1M A;  2WBF X;  2KWK A;  4BOP A;  1AYW A;  2J7Q C;  4YVA A;  3O0U A;  1LDK C;  5SVI A;  2AYO A;  2E6R A;  3DDT A;  3ZNI A;  2ATO A;  4YYQ A;  1A6R A;  4N4F A;  1BOR A;  1WEV A;  1WEM A;  2CRR A;  4GUA A;  1IYM A;  1F2C A;  5B78 A;  3F5V A;  3W31 A;  4YYR A;  1PPD A;  5J94 A;  5FPW A;  5DIN A;  3PT2 A;  3H8B A;  3O47 A;  1EWM A;  3KW9 A;  2B1N A;  1AEC A;  4M0W A;  4FIP A;  1DEU A;  3O70 A;  3KWZ A;  1DCQ A;  2DCA A;  2JTC A;  3B21 A;  3N3G A;  3O37 A;  4N4Z A;  2L75 A;  1WEN A;  3V43 A;  1XKG A;  1FBV A;  2HXZ A;  2BAY A;  4N79 A;  5LCW B;  3SOU A;  2FTD A;  3K8U A;  3E1Z B;  2FSA A;  2P57 A;  2MKE A;  4BPV A;  5K3Q A;  4AUQ B;  4YYV A;  2LGG A;  1WES A;  2G8J A;  1CQD A;  2HH5 A;  1WE9 A;  3HCS A;  4I07 A;  1TL9 A;  2K17 A;  3RVV A;  5JA7 A;  2DOS A;  3IFU A;  3BPF A;  2E00 A;  5EF4 A;  2P86 A;  4LLB A;  3PBH A;  5TDW A;  5B8D A;  1EF7 A;  2R9M A;  1TLO A;  3OVZ A;  4LAD B;  1YT7 A;  4O62 A;  3DWD A;  2DC9 A;  5KH7 A;  2K16 A;  4X6J A;  1NQC A;  5JZE A;  1JOC A;  4N3W A;  1BY8 A;  4MVT A;  4RKX A;  1AIM A;  1GMY A;  4OGE A;  1BQI A;  2NQD B;  2PNX A;  1EWL A;  5LKX A;  3QSD A;  4IP3 A;  1F62 A;  1PXV A;  2YJ2 A;  2JRI A;  3N4C A;  2FRQ A;  4CDF B;  2M6M A;  3RVX A;  2YRE A;  4B7Y C;  1YK7 A;  2PBH A;  1CPJ A;  3FJU B;  3N9M A;  1E4U A;  1AU4 A;  1DKI A;  3LJU X;  4H9D A;  2CSZ A;  2EXU A;  2LGV A;  3MDB C;  1X4J A;  1ZBD B;  1X4U A;  4PAD A;  2LRI C;  2CT2 A;  3PHX A;  2M85 A;  4CDD B;  3PNR A;  1S4V A;  3C9E A;  2ECN A;  1DVP A;  4NN2 A;  4XI1 A;  4P6E A;  2MNZ A;  4PT5 A;  2O6X A;  4WZ3 B;  2ECT A;  2KWJ A;  5G0F A;  2XOZ A;  4BOU A;  3TMP A;  1MS6 A;  4CZW A;  3GV4 A;  2NQI A;  2Z84 A;  2HHN A;  1VSN A;  2M3H A;  2LXH C;  1JQP A;  1VJV A;  4I05 A;  2G45 A;  2YJB A;  1GEC E;  3RTR B;  2XU3 A;  1YAL A;  4YAX A;  3IOQ A;  2MD7 B;  3CH2 X;  3GCB A;  2M13 A;  3H89 A;  2EOD A; 
#chains in the Genus database with same CATH homology
 4UI9 B;  2OUL A;  3CBK A;  2E02 A;  3O33 A;  1W4T A;  2H0D A;  4KLB A;  4BS5 A;  1U9W A;  2VP7 A;  1AU2 A;  2L43 A;  2C0Y A;  4ZDT A;  4YBS A;  2MA5 A;  2P0R A;  1NB3 A;  3LFY A;  2PUY A;  5FER A;  2KFT A;  5TBN A;  1ME4 A;  1U5I A;  2BDZ A;  3D9W A;  2D8S A;  3U5O A;  5B76 A;  4LKA A;  2QIZ A;  3SHB A;  2ACT A;  2IBI A;  3SOX A;  1QDQ A;  1PE6 A;  2YT5 A;  1O0E A;  4YAT A;  2YQM A;  3L1X A;  4V3L C;  2KWO A;  4Q8H A;  2DCD A;  2F6J A;  4X6H A;  2C2L A;  4L58 A;  4QF3 A;  4X3G A;  4IC3 A;  3FL2 A;  3BCN A;  2MUM A;  3ZYQ A;  3PHD A;  1XWH A;  1F2A A;  1WEQ A;  4GNG A;  4I7C A;  4CDC B;  2RI7 A;  3MHH A;  4ZUX U;  2FO5 A;  2LDR A;  2MNY A;  2ZET C;  3CH3 X;  1W5R A;  4K7C A;  4A49 A;  2CKL B;  2MT5 A;  2QJ0 A;  3O35 A;  3BPM A;  5CVO B;  1WEW A;  5JH3 A;  5CVM A;  3K9M A;  3PDF A;  4XR7 A;  1CHC A;  2G7Y A;  1EWO A;  1CTE A;  3IV2 A;  2LQ6 A;  2ECW A;  3IHP A;  3O34 A;  4FK5 A;  4ZQL A;  2AVW A;  5TAB A;  1CVZ A;  3KV6 A;  4R7E A;  3NG2 A;  4AXL A;  3ZUA A;  3LQJ A;  2XU5 A;  2LXP C;  1VD4 A;  5FEY A;  3N3K A;  1WIL A;  3PW3 A;  2AU1 A;  2C2V S;  4S3O B;  3T7L A;  3ZVZ B;  1VYX A;  1MM3 A;  3BOW A;  3LQH A;  2OXQ C;  1ZCM A;  3IEJ A;  2IDA A;  3QZV A;  2HYE D;  4YV8 A;  1Z60 A;  2OP3 A;  1ME3 A;  3EB5 A;  4YC9 A;  1JM7 B;  2M1R A;  2VPB A;  2VPG A;  3M99 A;  2VFB A;  4O64 A;  2NQA A;  4BHW A;  4OEL A;  3I3T A;  4YBM A;  3LXS A;  2YW8 A;  3HTK C;  1X4I A;  2R9N A;  3P5X A;  4AXM A;  4V3K C;  2JMI A;  3O1G A;  1AU3 A;  3F75 A;  1BGO A;  1G25 A;  1HYI A;  4QRV A;  1YVB A;  3D6S A;  1QMY A;  4X6I A;  3SOW A;  4GND A;  3S3R A;  1HUC B;  2KGG A;  5LKU A;  2JQF R;  4NV8 A;  2DX8 A;  4Q6F A;  1FH0 A;  2K4D A;  2NAA A;  3KX1 A;  4QBB A;  1NL6 A;  2CSY A;  2YQL A;  4I7D A;  3KSE A;  3PUR A;  4AP4 A;  5J3X A;  2FT2 A;  2KRE A;  5B79 A;  1GLO A;  1F2B A;  2F1G A;  2G6D A;  3HHA A;  4CCG X;  1CS8 A;  2KU3 A;  1WEU A;  2Y5B A;  3P5U A;  1NB5 A;  3DPL R;  1PPO A;  3V6C A;  3KKU A;  2B1M A;  2KIZ A;  2FYE A;  1THE A;  5I3L A;  4A0C D;  3ZTG A;  2Y43 A;  4QRX A;  2KWN A;  1T1H A;  1N87 A;  2UZG A;  1TU6 A;  2AYN A;  4I7B A;  5AIU A;  2BSZ A;  1VFY A;  4RY2 A;  5H1U A;  4WZ0 A;  3OVX A;  3T6R A;  2DZY A;  1PPP A;  4GNE A;  2VJE A;  2YU4 A;  1E2T A;  1NPZ A;  5TRB A;  3KV5 A;  1AYV A;  2K1J A;  2VHS A;  1PPN A;  5A24 A;  4C5P A;  3OIS A;  2RSD A;  2JRJ A;  1AU0 A;  3VK6 A;  1MDW A;  2HDP A;  2YUC A;  3V6E A;  1U9Q X;  2G43 A;  2R6N A;  2L0B A;  2PRE A;  1CB5 A;  2P7U A;  2VJF A;  4GB0 A;  2PAD A;  1GCB A;  2OZ2 A;  4W5B A;  2R9O A;  5D1L B;  3DF0 A;  2MD8 C;  3ASL A;  5DKA A;  3RPG C;  5AIT A;  1JM7 A;  1K3B B;  3S3Q A;  4UP0 A;  2BDL A;  3AI8 A;  1PBH A;  7PCK A;  1QOL A;  3HCU A;  2QIC A;  5CHT A;  1U9V A;  5H1V A;  4PI3 A;  4BSQ A;  3O7A A;  4P6G A;  3GL6 A;  5H9M A;  2YHO A;  2VJE B;  2YHN A;  3KFQ A;  2KR4 A;  2PNS A;  2VPD A;  2EA6 A;  3HD3 A;  4AYC B;  3MOR A;  5K16 A;  1CSB B;  2JMD A;  2R9F A;  4YAB A;  5JG6 A;  1Y4H A;  3BWK A;  3QT4 A;  2L80 A;  3M62 A;  4B55 A;  3U5M A;  3B79 A;  4G54 A;  2E03 A;  2CIO A;  4IC2 A;  5B75 A;  3WXF A;  1X9Y A;  3LQI A;  2ECJ A;  1FP0 A;  5FB0 A;  4P5O B;  2KYU A;  2IPP B;  2YJ9 A;  3HWN A;  1ITO A;  4W5C A;  3KQI A;  2JMJ A;  3N9P A;  3TNX A;  4HWY A;  4FO9 A;  1MEM A;  2I50 A;  2FUU A;  4YYU A;  2YSJ A;  1Z2Q A;  4TKP B;  3N9Q A;  1MIR A;  4OEM A;  3M63 A;  2R9C A;  1F29 A;  4QF2 A;  2DZZ A;  3ERV A;  2G8E A;  4Q8G A;  3L11 A;  4PPE A;  2AUX A;  1MEG A;  3QJ3 A;  4QH6 A;  1MHW A;  1PCI A;  2JQG R;  2AS8 A;  2ECG A;  2XU1 A;  4BBQ A;  3WXG A;  5H1T A;  2CKL A;  3L1Z B;  2DC6 A;  1V87 A;  3IUT A;  4A4C A;  2G6Q A;  4WZ2 A;  1ATK A;  1M6D A;  1KFX L;  1U9X A;  3H8C A;  2XEU A;  3HHI A;  5LKT A;  5CHV A;  5C11 A;  4DMY A;  4YAD A;  4S3O C;  3P5W A;  3N9L A;  4YBT A;  3OF9 A;  4LJN A;  4BS6 A;  2DC7 A;  4AYC A;  2DJG B;  2VFC A;  3I06 A;  3N9N A;  1DF0 A;  2LV9 A;  2LGL A;  5CVN B;  3U8E A;  3KNV A;  2AIM A;  2FUI A;  1U6G B;  2CB5 A;  3PUQ A;  4WA6 A;  1POP A;  2F42 A;  5F02 A;  1BP4 A;  4F52 B;  6PAD A;  4QRG A;  1WEP A;  1STF E;  4DMX A;  1WFK A;  1WGM A;  5D1M B;  3H6S A;  4CDE B;  2GFO A;  2VPE A;  1WEO A;  4I04 A;  3RVW A;  2AUZ A;  3OF8 A;  1PIP A;  2DCB A;  3K24 A;  3H7D A;  1SNK A;  1EWP A;  4PP2 E;  1RMD A;  2GHU A;  4R8P K;  5EYA F;  2YSM A;  5D1K B;  4GNF A;  5TDR A;  2MA6 A;  1MM2 A;  2H0D B;  1KHP A;  4N8W A;  1HYJ A;  3NHE A;  2FQ9 A;  2YJC A;  3C6W A;  4L7X A;  2FRA A;  2Y1N A;  5C13 A;  1PAD A;  3WXE A;  3RPG B;  4MSX A;  2LGK A;  4W4U A;  3CBJ A;  1WEE A;  5KH3 A;  4R2Y A;  5LKZ A;  5PAD A;  9PAP A;  3LRQ A;  3O36 A;  3ZPV 1;  1CV8 A;  5EGW A;  1NLJ A;  2H7J A;  2DCC A;  4LK9 A;  4YYS A;  2F6N A;  2EGP A;  2YYR A;  1AYU A;  3ZVY A;  2L5U A;  3C5K A;  1K2F A;  3DQV R;  3U5P A;  1Y08 A;  1Z6U A;  2HD5 A;  4MZS A;  4XUI A;  1KHQ A;  3EB6 A;  4A4B A;  2Y6E A;  3IMA A;  3ZPV E;  2XU4 A;  4FJC A;  2MIQ A;  2YJ8 A;  2E6S A;  2VNF A;  2KGI A;  3N9O A;  4BQV A;  4UP5 A;  1ICF A;  3P5V A;  2ECV A;  1ZIV A;  5B77 A;  2DC8 A;  4MZO A;  3U5N A;  2FUD A;  2VJF B;  1QXP A;  2ECI A;  3HCT A;  2E01 A;  1WIM A;  5FB1 A;  5G05 B;  2NQG A;  1YK8 A;  2DJF B;  2F7D A;  2XB1 A;  1KXR A;  2LN0 A;  1Q6K A;  4AVX A;  3MHS A;  4GUZ A;  1LDJ B;  3USV A;  3BC3 A;  2YUR A;  4B86 C;  1IWD A;  1SP4 B;  4YYW A;  4PTB A;  4CA1 A;  2KE1 A;  5G04 B;  5KH9 A;  4PP1 A;  8PCH A;  3KWB X;  2ARY A;  3MTN A;  1KFU L;  2VHF A;  1CJL A;  3I2D A;  4C9Z A;  2AN6 A;  2Y1M A;  2WBF X;  2KWK A;  1AYW A;  4YVA A;  3O0U A;  1LDK C;  2AYO A;  2E6R A;  3ZNI A;  2ATO A;  4YYQ A;  1A6R A;  4N4F A;  1BOR A;  1WEV A;  1WEM A;  1IYM A;  1F2C A;  5B78 A;  3F5V A;  4YYR A;  1PPD A;  5J94 A;  5FPW A;  5DIN A;  3H8B A;  1EWM A;  3KW9 A;  4BGF A;  2B1N A;  1AEC A;  4FIP A;  1DEU A;  3O70 A;  3KWZ A;  2DCA A;  3N3G A;  4NV7 A;  3O37 A;  4N4Z A;  2L75 A;  1WEN A;  3V43 A;  1XKG A;  1FBV A;  2HXZ A;  2BAY A;  4N79 A;  5LCW B;  3SOU A;  2FTD A;  3K8U A;  3E1Z B;  2FSA A;  4BPV A;  4AUQ B;  4YYV A;  2LGG A;  1WES A;  2G8J A;  1CQD A;  2HH5 A;  1WE9 A;  3HCS A;  4I07 A;  1TL9 A;  2K17 A;  3RVV A;  1W6F A;  5JA7 A;  3BPF A;  2E00 A;  5EF4 A;  2P86 A;  4LLB A;  3PBH A;  5TDW A;  5B8D A;  1EF7 A;  2R9M A;  1TLO A;  1GX3 A;  3OVZ A;  4LAD B;  1YT7 A;  2DC9 A;  5KH7 A;  2K16 A;  4X6J A;  1NQC A;  1JOC A;  4N3W A;  1BY8 A;  4MVT A;  1AIM A;  1GMY A;  1BQI A;  2NQD B;  2PNX A;  1EWL A;  5LKX A;  3QSD A;  1F62 A;  1PXV A;  2YJ2 A;  3N4C A;  2FRQ A;  4CDF B;  2M6M A;  3LTW A;  3RVX A;  2YRE A;  4B7Y C;  1YK7 A;  2PBH A;  1CPJ A;  3N9M A;  1E4U A;  1AU4 A;  2CSZ A;  2LGV A;  1X4J A;  1ZBD B;  1X4U A;  4PAD A;  2LRI C;  2CT2 A;  2M85 A;  4CDD B;  3PNR A;  1S4V A;  3C9E A;  2ECN A;  1DVP A;  4NN2 A;  4XI1 A;  4P6E A;  2MNZ A;  2O6X A;  4WZ3 B;  2ECT A;  2KWJ A;  5G0F A;  1MS6 A;  4CZW A;  3GV4 A;  2NQI A;  4I05 A;  2HHN A;  1VSN A;  2M3H A;  2LXH C;  1JQP A;  1VJV A;  2G45 A;  2YJB A;  1GEC E;  3RTR B;  2XU3 A;  1YAL A;  4YAX A;  3IOQ A;  2MD7 B;  3CH2 X;  3GCB A;  3H89 A;  2EOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...