4WA6A

Structure of yeast saga dubm with sgf73 n59d mutant at 2.36 angstroms resolution
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
471
structure length
440
Chain Sequence
MSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALNRQTGFIYLLTCAWKIQDAHEFWQFIINQIHQSYVLDLPNAKEVSRANNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNYHCGECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
publication title Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transcription
total genus 141
structure length 440
sequence length 471
chains with identical sequence D
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4wa6A01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4wa6A02
1S4VA 1F62A 3LQJA 2F42A 2ECTA 4QBBA 3BWKA 2CT2A 3SHBA 2GFOA 2MNZA 5B77A 2KGIA 2XU5A 3ZYQA 1MIRA 2MA6A 1KXRA 2YHNA 1ZCMA 4QRVA 3O37A 1MHWA 1TLOA 2HHNA 1M6DA 2CKLA 3O1GA 1VFYA 3WXFA 1A6RA 3LXSA 5F02A 1EWLA 1K2FA 2VHSA 4LADB 4ZDTA 2YJ2A 1WFKA 3KWBX 3NHEA 1CTEA 2YHOA 2L80A 3H8BA 5DKAA 2JQGR 2E02A 4CDEB 2VPGA 3KV6A 1YK8A 2IDAA 4QF3A 2VHFA 2YSMA 3BCNA 2KE1A 2K4DA 3BC3A 5CVMA 2LGKA 2ECNA 2F6NA 1GMYA 2FYEA 3EB6A 2LDRA 4NN2A 1HUCB 4YVAA 2OZ2A 3MHSA 3N9NA 3RPGC 1RMDA 4Q6FA 2VPDA 4BSQA 5CVNB 2VPEA 9PAPA 3F75A 3H89A 4Q8HA 2DC6A 2DC9A 5KH7A 2G8EA 3WXGA 2OULA 3H8CA 2P0RA 3GV4A 3V43A 3QT4A 4O64A 1ME3A 4AP4A 2C2LA 3RTRB 1KHPA 2YJ8A 5TRBA 2YQLA 3O0UA 5FPWA 1AU4A 4WA6A 4AYCB 2PADA 2DC8A 2PUYA 2K1JA 4YBMA 3OF8A 5KH9A 1Z2QA 2FSAA 3P5XA 5D1LB 3KSEA 2LRIC 4PP2E 2I50A 1AU0A 1QOLA 3M63A 1HYIA 2VPBA 2HXZA 3P5WA 4CZWA 2HYED 2MD8C 2B1NA 3NG2A 4P6GA 3KW9A 3P5VA 3ASLA 2DJFB 2F1GA 2JMDA 1IWDA 3MHHA 1EWPA 2F7DA 2R9CA 4I05A 3O34A 1X9YA 4BQVA 4S3OC 3BPFA 4A4BA 2G8JA 2H0DB 3N9PA 2XB1A 3GL6A 4BS5A 1U9QX 1G25A 4N3WA 2G6DA 1BP4A 2YURA 3QSDA 3ZNIA 5AIUA 3HTKC 1NB5A 2E01A 4OEMA 3SOWA 3LRQA 5DINA 5CHTA 3N9MA 5EGWA 2BDLA 1U6GB 1ME4A 3K24A 1WEWA 4N4ZA 2QIZA 3LFYA 1MEGA 4A0CD 5G0FA 2Y43A 2LGVA 2FT2A 1U9XA 3N9QA 4L7XA 2E6RA 2Y1NA 4AVXA 4X3GA 1FBVA 5FERA 2FTDA 3IUTA 3SOUA 3KV5A 3RPGB 1CPJA 1PCIA 1GLOA 4YBSA 2M6MA 2MD7B 4IC3A 2VJFB 2YJBA 4I7BA 5FB1A 3KWZA 1STFE 4YYWA 1VJVA 1X4IA 4X6HA 2G45A 3ZVZB 5LKZA 5H1VA 1JM7B 2XEUA 5B76A 1WE9A 3FL2A 2FQ9A 3OISA 4N79A 3F5VA 1NB3A 1YVBA 2AS8A 1ITOA 2LN0A 3L1ZB 1TL9A 3HHIA 1V87A 1WILA 4QF2A 2YSJA 2LXHC 1WENA 1FP0A 3O33A 1AYVA 5TDWA 2DZYA 2CSZA 2H7JA 2MUMA 1EF7A 3BOWA 2ECIA 8PCHA 2ACTA 5B8DA 3N9OA 2R6NA 2ECGA 2XU3A 1XWHA 1VSNA 4A49A 2OXQC 4GNDA 2FUIA 2AUZA 2Y6EA 1XKGA 3U5PA 3N4CA 4DMYA 2AU1A 1POPA 2LGLA 2YJ9A 3I2DA 4S3OB 5TABA 2NQDB 4I7DA 5B79A 1DVPA 2EGPA 4AYCA 3CBJA 2R9FA 3IV2A 2VNFA 3LQHA 1PPOA 1BQIA 1KFXL 2AIMA 2BAYA 1Y08A 3RVWA 5J3XA 2DC7A 3QJ3A 4R8PK 4AXLA 3OVXA 1FH0A 3LQIA 1PPDA 5AITA 5JG6A 2CIOA 2K16A 2DCDA 3IMAA 5EF4A 2L5UA 4FIPA 4XI1A 1YALA 4MSXA 1Y4HA 2DCAA 3ZPVE 4N8WA 3M99A 1AYWA 2AYOA 2LV9A 3S3RA 5D1MB 1QDQA 4N4FA 4A4CA 4I04A 2QJ0A 1TU6A 4IC2A 2CB5A 2H0DA 1U9VA 4PTBA 3ZUAA 1VYXA 4YABA 5FB0A 1BORA 2DJGB 2KIZA 4LK9A 2M85A 1CQDA 2WBFX 3KX1A 3IHPA 3H6SA 1WEUA 4BPVA 1MEMA 2CSYA 1EWOA 1AECA 2DCCA 2VJEB 1DF0A 3PDFA 4YV8A 3IOQA 1BY8A 5TBNA 4AXMA 4CDCB 4R7EA 4B7YC 2D8SA 2LQ6A 4OELA 2DX8A 3K8UA 4QH6A 5PADA 2VJFA 1PPPA 3OF9A 2NQIA 3V6CA 2PREA 5B78A 3CBKA 4UI9B 3PW3A 1JM7A 1JOCA 4YADA 4CA1A 2E00A 5KH3A 2IPPB 2F6JA 2O6XA 3IEJA 2DCBA 3ZTGA 3RVXA 1VD4A 2JMIA 2YYRA 4HWYA 3DPLR 1CHCA 3MORA 3OVZA 1U9WA 4WZ0A 1ZBDB 2P86A 1N87A 4LLBA 2HH5A 4G54A 1F29A 2FUDA 5K16A 1WEMA 5LCWB 2YJCA 3L11A 4CDFB 5CHVA 3CH3X 4B86C 5J94A 3C5KA 1F2AA 2PNXA 2B1MA 2ATOA 1NQCA 3S3QA 5A24A 4FK5A 4C9ZA 4GNFA 1U5IA 1CV8A 4L58A 1AU2A 3K9MA 6PADA 1WEVA 5G05B 1AU3A 1LDKC 4AUQB 2NAAA 4P6EA 3P5UA 3N3KA 2DZZA 2FRAA 1ICFA 3ZVYA 4CCGX 1PE6A 1YK7A 3PURA 2FUUA 4ZQLA 1WGMA 3B79A 1CS8A 2JRJA 1WEEA 2LXPC 2QICA 1CVZA 4W5BA 4YYVA 4YYSA 2ZETC 5H1UA 3KQIA 2MA5A 3RVVA 1PADA 2ARYA 1LDJB 3DF0A 4BBQA 3GCBA 4DMXA 3O70A 4K7CA 2YW8A 2PBHA 4KLBA 2YREA 2C2VS 1THEA 1X4JA 2ECVA 1PXVA 3I3TA 2FRQA 2EA6A 1CSBB 3AI8A 2R9OA 3QZVA 1MDWA 2BDZA 3BPMA 4P5OB 4PADA 2L75A 4QRXA 1F2CA 4YYQA 1WEQA 3U5OA 3HCSA 1NL6A 2M3HA 5JH3A 5B75A 1IYMA 1WIMA 1PBHA 4BHWA 3U8EA 2KREA 4W4UA 3MTNA 2JQFR 2VJEA 2KU3A 4CDDB 5I3LA 4YYRA 4YATA 1HYJA 1QMYA 3I06A 4I07A 3U5NA 1GECE 1KHQA 2KR4A 1KFUL 3KFQA 3HCUA 3C9EA 1PIPA 2MIQA 3D6SA 3V6EA 4GB0A 2VP7A 1NPZA 4PP1A 4V3KC 2YT5A 2KYUA 4PPEA 4R2YA 3U5MA 3H7DA 2KWNA 2M1RA 4X6JA 1X4UA 3T7LA 3C6WA 2AVWA 3USVA 2Y5BA 2RI7A 4WZ2A 5LKUA 1WESA 2NQGA 4MZSA 2HDPA 2EODA 3O36A 4V3LC 4QRGA 4MZOA 2L43A 2JMJA 2CKLB 2G6QA 3KKUA 1WEPA 2R9MA 2L0BA 4XR7A 3O35A 1GCBA 3EB5A 4PI3A 3DQVR 3KNVA 1MM2A 2KWOA 1AIMA 1YT7A 2YQMA 3L1XA 4F52B 1K3BB 1ZIVA 2XU1A 4YC9A 5EYAF 2PNSA 2R9NA 1Z60A 7PCKA 4FO9A 2P7UA 3T6RA 3O7AA 3VK6A 1AYUA 1E4UA 2AYNA 1MM3A 3HHAA 2E6SA 2ECWA 2G43A 2OP3A 2LGGA 4TKPB 3M62A 1Q6KA 4W5CA 1SP4B 1F2BA 3E1ZB 3N9LA 5C11A 3TNXA 3HD3A 3PUQA 5H9MA 2YUCA 1BGOA 2HD5A 5D1KB 3PBHA 5H1TA 4I7CA 1WEOA 4UP5A 4XUIA 4YYUA 4ZUXU 4YAXA 1DEUA 2MT5A 2KFTA 2KGGA 3HCTA 2GHUA 4MVTA 1NLJA 3PNRA 1SNKA 2YU4A 2FO5A 2K17A 2XU4A 2UZGA 5TDRA 3PHDA 1JQPA 4Q8GA 4BS6A 5JA7A 1T1HA 4WZ3B 2KWJA 2Y1MA 5LKXA 3N3GA 4LJNA 3WXEA 4UP0A 2ECJA 1Z6UA 4FJCA 4X6IA 1EWMA 3SOXA 3CH2X 5G04B 4LKAA 2E03A 5C13A 2NQAA 3HWNA 1ATKA 4GNEA 2MNYA 5LKTA 1QXPA 1CJLA 1CB5A 4RY2A 4YBTA 2AUXA 2G7YA 1MS6A 2RSDA 4GNGA 3ZPV1 2IBIA 2KWKA 2C0YA 2AN6A 5FEYA 3ERVA 5CVOB 1O0EA 1PPNA
chains in the Genus database with same CATH superfamily
1S4VA 1F62A 3LQJA 3W30A 2F42A 2ECTA 4QBBA 3BWKA 2CT2A 3SHBA 2GFOA 1DCQA 2MNZA 5B77A 2KGIA 2XOCA 4F1PA 2XU5A 3ZYQA 1MIRA 2MA6A 1KXRA 2YHNA 1ZCMA 4QRVA 2JTCA 3O37A 1MHWA 1TLOA 2HHNA 1M6DA 2CKLA 3O1GA 1VFYA 3H7HA 1A6RA 3WXFA 3LXSA 5F02A 1EWLA 1K2FA 2VHSA 4LADB 4ZDTA 2YJ2A 3O65A 1WFKA 3KWBX 3NHEA 1CTEA 2YHOA 2L80A 3H8BA 3PRPA 5DKAA 2JQGR 2E02A 4CDEB 2VPGA 3KV6A 1YK8A 2IDAA 3TMPA 4QF3A 5SVIA 2P57A 2YSMA 2VHFA 3BCNA 2KE1A 2K4DA 3BC3A 2D8UA 5CVMA 2LGKA 2ECNA 2F6NA 2XOYA 3FANA 1GMYA 2FYEA 3EB6A 2LDRA 2XOZA 4NN2A 1HUCB 4YVAA 2OZ2A 3MHSA 3N9NA 4REZA 3RPGC 1RMDA 4Q6FA 2VPDA 4BSQA 4GUAA 5CVNB 2VPEA 2FE8A 9PAPA 3F75A 3H89A 4Q8HA 2DC6A 2J7QC 2DC9A 5KH7A 2G8EA 3WXGA 3FM8C 2OULA 3H8CA 2P0RA 3GV4A 3V43A 3QT4A 4O64A 1ME3A 4AP4A 2C2LA 3RTRB 1KHPA 2YJ8A 5TRBA 2YQLA 3O0UA 5FPWA 1AU4A 4WA6A 4AYCB 2PADA 4HXDB 2DC8A 4Z0OA 2PUYA 2K1JA 4YBMA 5EZQA 4D8EA 3OF8A 3Q1DA 1Z2QA 2FSAA 5KH9A 3P5XA 5D1LB 3KSEA 2LRIC 3PHUA 4PP2E 3W31A 2I50A 1AU0A 1QOLA 3M63A 1HYIA 3TRKA 2VPBA 2HXZA 3P5WA 4CZWA 3BY4A 2HYED 2MD8C 2B1NA 3NG2A 4P6GA 3KW9A 3P5VA 3ASLA 2DJFB 2F1GA 2JMDA 1IWDA 3MHHA 1EWPA 2F7DA 2R9CA 4I05A 3O34A 1X9YA 4BQVA 4S3OC 5SVXA 3BPFA 2CRWA 4A4BA 2G8JA 2H0DB 3N9PA 2XB1A 3GL6A 1YZBA 1U9QX 4BOUA 1G25A 4BS5A 4N3WA 2G6DA 1BP4A 3E9SA 2YURA 3QSDA 3ZNIA 2CRRA 3HTKC 5AIUA 2E01A 1NB5A 4OEMA 3SOWA 3LRQA 4OGCA 5DINA 5CHTA 2HWKA 3N9MA 5EGWA 2BDLA 1U6GB 1ME4A 3K24A 1WEWA 4N4ZA 2QIZA 3LFYA 1MEGA 4A0CD 5G0FA 2Y43A 2LGVA 2FT2A 1U9XA 3MP2A 3N9QA 4L7XA 2E6RA 2Y1NA 4AVXA 4X3GA 1FBVA 4OGEA 5FERA 2FTDA 3IUTA 2RR4A 3SOUA 3KV5A 3RPGB 1CPJA 1PCIA 1GLOA 4YBSA 2M6MA 2MD7B 4IC3A 2VJFB 2YJBA 4I7BA 3IFUA 5FB1A 3KWZA 1STFE 4YYWA 3PHXA 1VJVA 1X4IA 4X6HA 5JZEA 2G45A 3ZVZB 5LKZA 5H1VA 5K3QA 1JM7B 2XEUA 5B76A 1WE9A 3FL2A 2FQ9A 3OISA 4N79A 1MBMA 3F5VA 1NB3A 1YVBA 2AS8A 1ITOA 2LN0A 3L1ZB 1TL9A 3HHIA 3MJ5A 1V87A 1WILA 4QF2A 2YSJA 2LXHC 1WENA 1FP0A 3O33A 1AYVA 5TDWA 2DZYA 2CSZA 2H7JA 2MUMA 1EF7A 3BOWA 2ECIA 4MM3B 5EZSA 8PCHA 2ACTA 4ZTBA 3LJUX 5B8DA 2UZJA 3BBAA 3N9OA 2R6NA 2ECGA 4OW0A 2XU3A 1XWHA 5KO3A 1VSNA 4A49A 2OXQC 4GNDA 2FUIA 2AUZA 2Y6EA 1XKGA 3U5PA 3N4CA 4PT5A 4DMYA 2AU1A 1POPA 2LGLA 3E2DA 3I2DA 4S3OB 5TABA 2YJ9A 2NQDB 4I7DA 5B79A 2JRIA 1DVPA 2EGPA 4AYCA 3CBJA 2R9FA 3IV2A 2VNFA 3LQHA 1PPOA 1BQIA 1KFXL 2AIMA 2BAYA 4QQ4A 1Y08A 3RVWA 5J3XA 2DC7A 3QJ3A 4R8PK 4AXLA 3OVXA 1FH0A 3LQIA 1PPDA 5AITA 5JG6A 2CIOA 2K16A 2DCDA 3IMAA 5EF4A 2L5UA 4FIPA 4XI1A 2EXUA 1YALA 2OWAA 4MSXA 1Y4HA 2DCAA 3ZPVE 1DKIA 4N8WA 3M99A 1AYWA 2AYOA 2BTWB 3LDYA 2LV9A 3S3RA 5D1MB 1QDQA 4N4FA 4A4CA 4I04A 2QJ0A 3FEHA 1TU6A 4IC2A 2CB5A 2H0DA 1U9VA 4PTBA 3LVRE 3ZUAA 4D8IA 4H9DA 1VYXA 3PRMA 3MDBC 4YABA 4P16A 5FB0A 1BORA 4RF1A 2DJGB 2KIZA 2KKXA 4LK9A 2M85A 1CQDA 2WBFX 3KX1A 3IHPA 4BOSA 3H6SA 1WEUA 4BPVA 3KDEC 1MEMA 2CSYA 1EWOA 2M13A 1AECA 2XP0A 2DCCA 4BOPA 2VJEB 1DF0A 2DJAA 3PDFA 4YV8A 3IOQA 1BY8A 5TBNA 4AXMA 4CDCB 4R7EA 4B7YC 4R3DA 2D8SA 2LQ6A 4OELA 2DX8A 3K8UA 4QH6A 5PADA 2VJFA 1PPPA 2BU3A 3OF9A 2NQIA 3V6CA 2J7QA 2PREA 5B78A 3CBKA 2FD4A 4UI9B 3PW3A 1JM7A 1JOCA 4YADA 4CA1A 2E00A 5KH3A 2IPPB 2F6JA 2O6XA 3IEJA 2DCBA 3ZTGA 3RVXA 1VD4A 3RNVA 2JMIA 2YYRA 4HWYA 3DPLR 5SVYA 1CHCA 3MORA 3OVZA 2FFWA 1U9WA 4WZ0A 1ZBDB 2P86A 1N87A 4LLBA 2HH5A 4G54A 4XZXA 3DDTA 1F29A 2FUDA 5K16A 1WEMA 5LCWB 2YJCA 3L11A 4CDFB 5CHVA 3CH3X 4B86C 5J94A 3C5KA 1F2AA 2PNXA 2E61A 2B1MA 2ATOA 1NQCA 3S3QA 5A24A 4FK5A 4C9ZA 4GNFA 1U5IA 1CV8A 4L58A 1AU2A 3K9MA 2MKEA 4RNAA 2L7PA 6PADA 1WEVA 5G05B 2DSMA 1AU3A 1LDKC 4AUQB 2NAAA 4P6EA 3P5UA 3N3KA 2DZZA 2FRAA 4OVZB 1ICFA 3PHWA 3ZVYA 2KKYA 4CCGX 1PE6A 3PURA 2FUUA 4ZQLA 1WGMA 1YK7A 1PVJA 3B79A 2EGMA 1CS8A 4BOQA 2JRJA 1WEEA 2LXPC 2QICA 1CVZA 4W5BA 4YYVA 4YYSA 2ZETC 5H1UA 2YVRA 3ZNHA 3KQIA 2MA5A 3RVVA 1PADA 2ARYA 3JUEA 1LDJB 3DF0A 4D8BA 2BTWA 4BBQA 3GCBA 4DMXA 2AGAA 3O70A 4K7CA 2YW8A 2PBHA 4KLBA 2YREA 2C2VS 1THEA 3T9KA 3OQCA 1X4JA 2ECVA 1PXVA 3I3TA 2FRQA 2EA6A 1CSBB 3AI8A 2R9OA 3QZVA 1MDWA 2BDZA 3BPMA 4P5OB 4PADA 2L75A 4QRXA 1F2CA 4YYQA 1WEQA 3U5OA 3HCSA 1NL6A 2M3HA 5JH3A 5B75A 1IYMA 1WIMA 1PBHA 4BHWA 3U8EA 4BOZA 2KREA 4W4UA 3MTNA 2JQFR 2VJEA 2KU3A 3SUBA 4CDDB 3C0RA 5I3LA 4YYRA 4YATA 1HYJA 1QMYA 3FAOA 3I06A 4I07A 3U5NA 1GECE 1KHQA 2KR4A 1KFUL 3KFQA 3HCUA 2LAUA 3C9EA 1PIPA 2MIQA 3D6SA 2CONA 3V6EA 4GB0A 2VP7A 1NPZA 4PP1A 3FJUB 4V3KC 2YT5A 2KYUA 4PPEA 4R2YA 3U5MA 3H7DA 2KWNA 2M1RA 4X6JA 1X4UA 3T7LA 3C6WA 2AVWA 3USVA 2Y5BA 2RI7A 4WZ2A 4Z0RA 5LKUA 1UKFA 1WESA 2NQGA 4MZSA 2B0OE 2HDPA 2EODA 3O36A 5E6JA 4V3LC 4QRGA 4MZOA 2L43A 2CSVA 2JMJA 2CKLB 3O47A 2G6QA 3KKUA 3M7KA 3PT2A 1WEPA 2R9MA 2L0BA 4XR7A 3O35A 3B21A 1GCBA 3EB5A 4PI3A 3DQVR 3KNVA 1MM2A 2JM3A 2KWOA 1AIMA 1YT7A 2YQMA 3L1XA 4RF0A 4F52B 1K3BB 1ZIVA 2JUNA 5SVIB 4M0WA 2XU1A 4YC9A 5EYAF 2PNSA 2R9NA 1Z60A 7PCKA 4FO9A 2P7UA 3T6RA 3O7AA 3VK6A 1AYUA 4O62A 1E4UA 2AYNA 1MM3A 3HHAA 2E6SA 4MI7A 2ECWA 2G43A 2OP3A 2LGGA 4IUMA 4TKPB 3M62A 4OVZA 4WURA 1Q6KA 4RKXA 4W5CA 3DWDA 1SP4B 1F2BA 2IQJA 3E1ZB 4A5UA 3N9LA 5C11A 2DOSA 3HD3A 3PUQA 3TNXA 5H9MA 2YUCA 1BGOA 2HD5A 5D1KB 3PBHA 5H1TA 4I7CA 1WEOA 4UP5A 4XUIA 4YYUA 4ZUXU 4YAXA 1DEUA 2MT5A 2KFTA 2KGGA 3HCTA 2GHUA 4MVTA 1NLJA 3PNRA 1SNKA 2YU4A 2FO5A 2K17A 3PSEA 2XU4A 2UZGA 5TDRA 3PHDA 1JQPA 4Q8GA 4BS6A 5JA7A 1T1HA 3PLWA 2KWJA 4WZ3B 2Y1MA 5LKXA 2Z84A 3N3GA 4LJNA 3MTVA 3WXEA 4UP0A 4IP3A 2ECJA 1Z6UA 4FJCA 4X6IA 1EWMA 3SOXA 3CH2X 5G04B 4LKAA 2E03A 5C13A 2NQAA 3HWNA 1ATKA 4GNEA 2MNYA 3BB7A 5LKTA 1QXPA 3LVQE 1CJLA 1CB5A 4RY2A 4YBTA 2AUXA 2G7YA 1MS6A 2RSDA 4GNGA 3ZPV1 2IBIA 2KWKA 2C0YA 2AN6A 5FEYA 3ERVA 5CVOB 1O0EA 1PPNA
chains in the Genus database with same CATH topology
1S4VA 1F62A 3LQJA 2F42A 2ECTA 4QBBA 3BWKA 2CT2A 3SHBA 2GFOA 2MNZA 5B77A 2KGIA 2XU5A 3ZYQA 1MIRA 2MA6A 1KXRA 2YHNA 1ZCMA 4QRVA 3O37A 1MHWA 1TLOA 2HHNA 1M6DA 2CKLA 3O1GA 1VFYA 3WXFA 1A6RA 3LXSA 5F02A 1EWLA 1K2FA 2VHSA 4LADB 4ZDTA 2YJ2A 1WFKA 3KWBX 3NHEA 1CTEA 2YHOA 2L80A 3H8BA 5DKAA 2JQGR 2E02A 4CDEB 2VPGA 3KV6A 1YK8A 2IDAA 4QF3A 2VHFA 2YSMA 3BCNA 2KE1A 2K4DA 4GUZA 3BC3A 5CVMA 2LGKA 2ECNA 2F6NA 1GMYA 2FYEA 3EB6A 2LDRA 4NN2A 1HUCB 4YVAA 2OZ2A 3MHSA 3N9NA 3RPGC 1RMDA 4Q6FA 2VPDA 4BSQA 5CVNB 2VPEA 9PAPA 3F75A 3H89A 4Q8HA 2DC6A 2DC9A 5KH7A 2G8EA 2BSZA 3WXGA 2OULA 3H8CA 2P0RA 3GV4A 3V43A 3QT4A 4O64A 1ME3A 4AP4A 2C2LA 3RTRB 1KHPA 2YJ8A 5TRBA 2YQLA 3O0UA 5FPWA 1AU4A 4WA6A 4AYCB 2PADA 2DC8A 2PUYA 2K1JA 4YBMA 3OF8A 5KH9A 1Z2QA 2FSAA 3P5XA 5D1LB 3KSEA 2LRIC 4PP2E 2I50A 1AU0A 1QOLA 1W6FA 3M63A 1HYIA 4C5PA 2VPBA 2VFBA 2HXZA 3P5WA 4CZWA 2HYED 2MD8C 2B1NA 3NG2A 4P6GA 3KW9A 3P5VA 3ASLA 2DJFB 2F1GA 2JMDA 1IWDA 3MHHA 1EWPA 2F7DA 2R9CA 4I05A 3O34A 1X9YA 4BQVA 4S3OC 3BPFA 4A4BA 2G8JA 2VFCA 2H0DB 3N9PA 2XB1A 3GL6A 4BS5A 1U9QX 1G25A 4N3WA 2G6DA 1BP4A 2YURA 3QSDA 3ZNIA 5AIUA 3HTKC 1NB5A 2E01A 4OEMA 3SOWA 3LRQA 5DINA 5CHTA 3N9MA 5EGWA 2BDLA 1U6GB 1ME4A 3K24A 1WEWA 4N4ZA 2QIZA 3LFYA 1MEGA 4A0CD 5G0FA 2Y43A 2LGVA 2FT2A 1U9XA 3N9QA 4L7XA 2E6RA 2Y1NA 4AVXA 4X3GA 1FBVA 5FERA 2FTDA 3IUTA 3SOUA 3KV5A 3RPGB 1CPJA 1PCIA 1GLOA 4YBSA 2M6MA 2MD7B 4IC3A 2VJFB 2YJBA 4I7BA 3LTWA 5FB1A 3KWZA 1STFE 4YYWA 1VJVA 1X4IA 4X6HA 2G45A 3ZVZB 5LKZA 5H1VA 1JM7B 2XEUA 5B76A 1WE9A 3FL2A 2FQ9A 3OISA 4N79A 3F5VA 1NB3A 1YVBA 2AS8A 1ITOA 2LN0A 3L1ZB 1TL9A 3HHIA 1V87A 1WILA 4QF2A 1GX3A 2YSJA 2LXHC 1WENA 1FP0A 3O33A 1AYVA 5TDWA 2DZYA 2CSZA 2H7JA 2MUMA 1EF7A 3BOWA 2ECIA 8PCHA 2ACTA 5B8DA 3N9OA 2R6NA 2ECGA 2XU3A 1XWHA 1VSNA 4A49A 2OXQC 4GNDA 2FUIA 2AUZA 2Y6EA 1XKGA 3U5PA 3N4CA 4DMYA 2AU1A 1POPA 2LGLA 2YJ9A 3I2DA 4S3OB 5TABA 2NQDB 4I7DA 5B79A 1DVPA 2EGPA 4AYCA 3CBJA 2R9FA 3IV2A 2VNFA 3LQHA 1PPOA 1BQIA 1KFXL 2AIMA 2BAYA 1Y08A 3RVWA 5J3XA 2DC7A 3QJ3A 4R8PK 4AXLA 3OVXA 1FH0A 3LQIA 1PPDA 5AITA 5JG6A 2CIOA 2K16A 2DCDA 3IMAA 5EF4A 2L5UA 4FIPA 4XI1A 1YALA 4MSXA 1Y4HA 2DCAA 3ZPVE 4N8WA 3D9WA 3M99A 1AYWA 4NV8A 2AYOA 4NV7A 2LV9A 3S3RA 5D1MB 1QDQA 4N4FA 4A4CA 4I04A 2QJ0A 1TU6A 4IC2A 2CB5A 2H0DA 1U9VA 4PTBA 3ZUAA 1VYXA 4YABA 5FB0A 1BORA 2DJGB 2KIZA 4LK9A 2M85A 1CQDA 2WBFX 3KX1A 3IHPA 3H6SA 1WEUA 4BPVA 1MEMA 2CSYA 1EWOA 1AECA 2DCCA 2VJEB 1DF0A 3PDFA 4YV8A 3IOQA 1BY8A 5TBNA 4AXMA 4CDCB 4R7EA 4B7YC 2D8SA 2LQ6A 4OELA 2DX8A 3K8UA 4QH6A 5PADA 2VJFA 1PPPA 3OF9A 2NQIA 3V6CA 2PREA 5B78A 3CBKA 4UI9B 3PW3A 1JM7A 1JOCA 4YADA 4B55A 4CA1A 2E00A 5KH3A 2IPPB 2F6JA 2O6XA 3IEJA 2DCBA 3ZTGA 3RVXA 1VD4A 2JMIA 2YYRA 4HWYA 3DPLR 1CHCA 3MORA 3OVZA 1U9WA 4WZ0A 1ZBDB 2P86A 1N87A 4LLBA 2HH5A 4G54A 1F29A 2FUDA 5K16A 1WEMA 5LCWB 2YJCA 3L11A 4CDFB 5CHVA 3CH3X 4B86C 5J94A 3C5KA 1F2AA 2PNXA 2B1MA 2ATOA 1NQCA 3S3QA 5A24A 4FK5A 4C9ZA 4GNFA 1U5IA 1CV8A 4L58A 1AU2A 3K9MA 6PADA 1WEVA 5G05B 1AU3A 1LDKC 4AUQB 2NAAA 4P6EA 3P5UA 3N3KA 2DZZA 2FRAA 1ICFA 3ZVYA 4CCGX 1PE6A 1YK7A 3PURA 2FUUA 4ZQLA 1WGMA 3B79A 1CS8A 2JRJA 1WEEA 2LXPC 2QICA 1CVZA 4W5BA 4YYVA 4YYSA 2ZETC 5H1UA 3KQIA 2MA5A 3RVVA 1PADA 2ARYA 1LDJB 3DF0A 4BBQA 3GCBA 4DMXA 3O70A 4K7CA 2YW8A 2PBHA 4KLBA 2YREA 2C2VS 1THEA 1X4JA 2ECVA 1PXVA 3I3TA 2FRQA 2EA6A 1CSBB 3AI8A 2R9OA 3QZVA 1MDWA 2BDZA 3BPMA 4P5OB 4PADA 2L75A 4QRXA 1F2CA 4YYQA 1WEQA 3U5OA 3HCSA 1NL6A 2M3HA 5JH3A 5B75A 1IYMA 1WIMA 1PBHA 4BHWA 3U8EA 2KREA 4W4UA 3MTNA 2JQFR 2VJEA 2KU3A 4CDDB 5I3LA 1W5RA 4YYRA 4YATA 1HYJA 1QMYA 3I06A 4I07A 3U5NA 1GECE 1KHQA 2KR4A 1KFUL 3KFQA 3HCUA 3C9EA 1PIPA 2MIQA 3D6SA 3V6EA 4GB0A 2VP7A 1NPZA 4PP1A 4V3KC 2YT5A 2KYUA 4PPEA 4R2YA 3U5MA 3H7DA 2KWNA 2M1RA 4X6JA 1X4UA 3T7LA 3C6WA 2AVWA 3USVA 2Y5BA 2RI7A 4WZ2A 5LKUA 1WESA 2NQGA 4MZSA 2HDPA 2EODA 3O36A 4V3LC 4QRGA 4MZOA 2L43A 2JMJA 2CKLB 2G6QA 3KKUA 1WEPA 2R9MA 2L0BA 4XR7A 3O35A 1GCBA 3EB5A 4PI3A 3DQVR 3KNVA 1MM2A 2KWOA 1AIMA 1YT7A 2YQMA 3L1XA 4F52B 1K3BB 1ZIVA 2XU1A 4YC9A 5EYAF 2PNSA 1W4TA 2R9NA 1Z60A 7PCKA 4FO9A 2P7UA 3T6RA 3O7AA 3VK6A 1AYUA 1E4UA 2AYNA 1MM3A 3HHAA 2E6SA 2ECWA 2G43A 2OP3A 2LGGA 4TKPB 3M62A 1Q6KA 4W5CA 1SP4B 1F2BA 3E1ZB 3N9LA 5C11A 3TNXA 3HD3A 3PUQA 4BGFA 5H9MA 2YUCA 1BGOA 2HD5A 5D1KB 3PBHA 5H1TA 4I7CA 1WEOA 4UP5A 4XUIA 4YYUA 4ZUXU 4YAXA 1DEUA 2MT5A 2KFTA 2KGGA 3HCTA 2GHUA 4MVTA 1NLJA 3PNRA 1SNKA 2YU4A 2FO5A 2K17A 2XU4A 2UZGA 5TDRA 3PHDA 1JQPA 4Q8GA 4BS6A 5JA7A 1T1HA 4WZ3B 2KWJA 2Y1MA 5LKXA 3N3GA 4LJNA 3WXEA 4UP0A 2ECJA 1Z6UA 4FJCA 4X6IA 1EWMA 3SOXA 3CH2X 5G04B 4LKAA 2E03A 5C13A 2NQAA 3HWNA 1ATKA 4GNEA 2MNYA 5LKTA 1QXPA 1CJLA 1CB5A 4RY2A 4YBTA 2AUXA 2G7YA 1MS6A 2RSDA 4GNGA 3ZPV1 2IBIA 2KWKA 2C0YA 2AN6A 5FEYA 3ERVA 5CVOB 1O0EA 1E2TA 1PPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S4V A;  1F62 A;  3LQJ A;  2F42 A;  2ECT A;  4QBB A;  3BWK A;  2CT2 A;  3SHB A;  2GFO A;  2MNZ A;  5B77 A;  2KGI A;  2XU5 A;  3ZYQ A;  1MIR A;  2MA6 A;  1KXR A;  2YHN A;  1ZCM A;  4QRV A;  3O37 A;  1MHW A;  1TLO A;  2HHN A;  1M6D A;  2CKL A;  3O1G A;  1VFY A;  3WXF A;  1A6R A;  3LXS A;  5F02 A;  1EWL A;  1K2F A;  2VHS A;  4LAD B;  4ZDT A;  2YJ2 A;  1WFK A;  3KWB X;  3NHE A;  1CTE A;  2YHO A;  2L80 A;  3H8B A;  5DKA A;  2JQG R;  2E02 A;  4CDE B;  2VPG A;  3KV6 A;  1YK8 A;  2IDA A;  4QF3 A;  2VHF A;  2YSM A;  3BCN A;  2KE1 A;  2K4D A;  3BC3 A;  5CVM A;  2LGK A;  2ECN A;  2F6N A;  1GMY A;  2FYE A;  3EB6 A;  2LDR A;  4NN2 A;  1HUC B;  4YVA A;  2OZ2 A;  3MHS A;  3N9N A;  3RPG C;  1RMD A;  4Q6F A;  2VPD A;  4BSQ A;  5CVN B;  2VPE A;  9PAP A;  3F75 A;  3H89 A;  4Q8H A;  2DC6 A;  2DC9 A;  5KH7 A;  2G8E A;  3WXG A;  2OUL A;  3H8C A;  2P0R A;  3GV4 A;  3V43 A;  3QT4 A;  4O64 A;  1ME3 A;  4AP4 A;  2C2L A;  3RTR B;  1KHP A;  2YJ8 A;  5TRB A;  2YQL A;  3O0U A;  5FPW A;  1AU4 A;  4WA6 A;  4AYC B;  2PAD A;  2DC8 A;  2PUY A;  2K1J A;  4YBM A;  3OF8 A;  5KH9 A;  1Z2Q A;  2FSA A;  3P5X A;  5D1L B;  3KSE A;  2LRI C;  4PP2 E;  2I50 A;  1AU0 A;  1QOL A;  3M63 A;  1HYI A;  2VPB A;  2HXZ A;  3P5W A;  4CZW A;  2HYE D;  2MD8 C;  2B1N A;  3NG2 A;  4P6G A;  3KW9 A;  3P5V A;  3ASL A;  2DJF B;  2F1G A;  2JMD A;  1IWD A;  3MHH A;  1EWP A;  2F7D A;  2R9C A;  4I05 A;  3O34 A;  1X9Y A;  4BQV A;  4S3O C;  3BPF A;  4A4B A;  2G8J A;  2H0D B;  3N9P A;  2XB1 A;  3GL6 A;  4BS5 A;  1U9Q X;  1G25 A;  4N3W A;  2G6D A;  1BP4 A;  2YUR A;  3QSD A;  3ZNI A;  5AIU A;  3HTK C;  1NB5 A;  2E01 A;  4OEM A;  3SOW A;  3LRQ A;  5DIN A;  5CHT A;  3N9M A;  5EGW A;  2BDL A;  1U6G B;  1ME4 A;  3K24 A;  1WEW A;  4N4Z A;  2QIZ A;  3LFY A;  1MEG A;  4A0C D;  5G0F A;  2Y43 A;  2LGV A;  2FT2 A;  1U9X A;  3N9Q A;  4L7X A;  2E6R A;  2Y1N A;  4AVX A;  4X3G A;  1FBV A;  5FER A;  2FTD A;  3IUT A;  3SOU A;  3KV5 A;  3RPG B;  1CPJ A;  1PCI A;  1GLO A;  4YBS A;  2M6M A;  2MD7 B;  4IC3 A;  2VJF B;  2YJB A;  4I7B A;  5FB1 A;  3KWZ A;  1STF E;  4YYW A;  1VJV A;  1X4I A;  4X6H A;  2G45 A;  3ZVZ B;  5LKZ A;  5H1V A;  1JM7 B;  2XEU A;  5B76 A;  1WE9 A;  3FL2 A;  2FQ9 A;  3OIS A;  4N79 A;  3F5V A;  1NB3 A;  1YVB A;  2AS8 A;  1ITO A;  2LN0 A;  3L1Z B;  1TL9 A;  3HHI A;  1V87 A;  1WIL A;  4QF2 A;  2YSJ A;  2LXH C;  1WEN A;  1FP0 A;  3O33 A;  1AYV A;  5TDW A;  2DZY A;  2CSZ A;  2H7J A;  2MUM A;  1EF7 A;  3BOW A;  2ECI A;  8PCH A;  2ACT A;  5B8D A;  3N9O A;  2R6N A;  2ECG A;  2XU3 A;  1XWH A;  1VSN A;  4A49 A;  2OXQ C;  4GND A;  2FUI A;  2AUZ A;  2Y6E A;  1XKG A;  3U5P A;  3N4C A;  4DMY A;  2AU1 A;  1POP A;  2LGL A;  2YJ9 A;  3I2D A;  4S3O B;  5TAB A;  2NQD B;  4I7D A;  5B79 A;  1DVP A;  2EGP A;  4AYC A;  3CBJ A;  2R9F A;  3IV2 A;  2VNF A;  3LQH A;  1PPO A;  1BQI A;  1KFX L;  2AIM A;  2BAY A;  1Y08 A;  3RVW A;  5J3X A;  2DC7 A;  3QJ3 A;  4R8P K;  4AXL A;  3OVX A;  1FH0 A;  3LQI A;  1PPD A;  5AIT A;  5JG6 A;  2CIO A;  2K16 A;  2DCD A;  3IMA A;  5EF4 A;  2L5U A;  4FIP A;  4XI1 A;  1YAL A;  4MSX A;  1Y4H A;  2DCA A;  3ZPV E;  4N8W A;  3M99 A;  1AYW A;  2AYO A;  2LV9 A;  3S3R A;  5D1M B;  1QDQ A;  4N4F A;  4A4C A;  4I04 A;  2QJ0 A;  1TU6 A;  4IC2 A;  2CB5 A;  2H0D A;  1U9V A;  4PTB A;  3ZUA A;  1VYX A;  4YAB A;  5FB0 A;  1BOR A;  2DJG B;  2KIZ A;  4LK9 A;  2M85 A;  1CQD A;  2WBF X;  3KX1 A;  3IHP A;  3H6S A;  1WEU A;  4BPV A;  1MEM A;  2CSY A;  1EWO A;  1AEC A;  2DCC A;  2VJE B;  1DF0 A;  3PDF A;  4YV8 A;  3IOQ A;  1BY8 A;  5TBN A;  4AXM A;  4CDC B;  4R7E A;  4B7Y C;  2D8S A;  2LQ6 A;  4OEL A;  2DX8 A;  3K8U A;  4QH6 A;  5PAD A;  2VJF A;  1PPP A;  3OF9 A;  2NQI A;  3V6C A;  2PRE A;  5B78 A;  3CBK A;  4UI9 B;  3PW3 A;  1JM7 A;  1JOC A;  4YAD A;  4CA1 A;  2E00 A;  5KH3 A;  2IPP B;  2F6J A;  2O6X A;  3IEJ A;  2DCB A;  3ZTG A;  3RVX A;  1VD4 A;  2JMI A;  2YYR A;  4HWY A;  3DPL R;  1CHC A;  3MOR A;  3OVZ A;  1U9W A;  4WZ0 A;  1ZBD B;  2P86 A;  1N87 A;  4LLB A;  2HH5 A;  4G54 A;  1F29 A;  2FUD A;  5K16 A;  1WEM A;  5LCW B;  2YJC A;  3L11 A;  4CDF B;  5CHV A;  3CH3 X;  4B86 C;  5J94 A;  3C5K A;  1F2A A;  2PNX A;  2B1M A;  2ATO A;  1NQC A;  3S3Q A;  5A24 A;  4FK5 A;  4C9Z A;  4GNF A;  1U5I A;  1CV8 A;  4L58 A;  1AU2 A;  3K9M A;  6PAD A;  1WEV A;  5G05 B;  1AU3 A;  1LDK C;  4AUQ B;  2NAA A;  4P6E A;  3P5U A;  3N3K A;  2DZZ A;  2FRA A;  1ICF A;  3ZVY A;  4CCG X;  1PE6 A;  1YK7 A;  3PUR A;  2FUU A;  4ZQL A;  1WGM A;  3B79 A;  1CS8 A;  2JRJ A;  1WEE A;  2LXP C;  2QIC A;  1CVZ A;  4W5B A;  4YYV A;  4YYS A;  2ZET C;  5H1U A;  3KQI A;  2MA5 A;  3RVV A;  1PAD A;  2ARY A;  1LDJ B;  3DF0 A;  4BBQ A;  3GCB A;  4DMX A;  3O70 A;  4K7C A;  2YW8 A;  2PBH A;  4KLB A;  2YRE A;  2C2V S;  1THE A;  1X4J A;  2ECV A;  1PXV A;  3I3T A;  2FRQ A;  2EA6 A;  1CSB B;  3AI8 A;  2R9O A;  3QZV A;  1MDW A;  2BDZ A;  3BPM A;  4P5O B;  4PAD A;  2L75 A;  4QRX A;  1F2C A;  4YYQ A;  1WEQ A;  3U5O A;  3HCS A;  1NL6 A;  2M3H A;  5JH3 A;  5B75 A;  1IYM A;  1WIM A;  1PBH A;  4BHW A;  3U8E A;  2KRE A;  4W4U A;  3MTN A;  2JQF R;  2VJE A;  2KU3 A;  4CDD B;  5I3L A;  4YYR A;  4YAT A;  1HYJ A;  1QMY A;  3I06 A;  4I07 A;  3U5N A;  1GEC E;  1KHQ A;  2KR4 A;  1KFU L;  3KFQ A;  3HCU A;  3C9E A;  1PIP A;  2MIQ A;  3D6S A;  3V6E A;  4GB0 A;  2VP7 A;  1NPZ A;  4PP1 A;  4V3K C;  2YT5 A;  2KYU A;  4PPE A;  4R2Y A;  3U5M A;  3H7D A;  2KWN A;  2M1R A;  4X6J A;  1X4U A;  3T7L A;  3C6W A;  2AVW A;  3USV A;  2Y5B A;  2RI7 A;  4WZ2 A;  5LKU A;  1WES A;  2NQG A;  4MZS A;  2HDP A;  2EOD A;  3O36 A;  4V3L C;  4QRG A;  4MZO A;  2L43 A;  2JMJ A;  2CKL B;  2G6Q A;  3KKU A;  1WEP A;  2R9M A;  2L0B A;  4XR7 A;  3O35 A;  1GCB A;  3EB5 A;  4PI3 A;  3DQV R;  3KNV A;  1MM2 A;  2KWO A;  1AIM A;  1YT7 A;  2YQM A;  3L1X A;  4F52 B;  1K3B B;  1ZIV A;  2XU1 A;  4YC9 A;  5EYA F;  2PNS A;  2R9N A;  1Z60 A;  7PCK A;  4FO9 A;  2P7U A;  3T6R A;  3O7A A;  3VK6 A;  1AYU A;  1E4U A;  2AYN A;  1MM3 A;  3HHA A;  2E6S A;  2ECW A;  2G43 A;  2OP3 A;  2LGG A;  4TKP B;  3M62 A;  1Q6K A;  4W5C A;  1SP4 B;  1F2B A;  3E1Z B;  3N9L A;  5C11 A;  3TNX A;  3HD3 A;  3PUQ A;  5H9M A;  2YUC A;  1BGO A;  2HD5 A;  5D1K B;  3PBH A;  5H1T A;  4I7C A;  1WEO A;  4UP5 A;  4XUI A;  4YYU A;  4ZUX U;  4YAX A;  1DEU A;  2MT5 A;  2KFT A;  2KGG A;  3HCT A;  2GHU A;  4MVT A;  1NLJ A;  3PNR A;  1SNK A;  2YU4 A;  2FO5 A;  2K17 A;  2XU4 A;  2UZG A;  5TDR A;  3PHD A;  1JQP A;  4Q8G A;  4BS6 A;  5JA7 A;  1T1H A;  4WZ3 B;  2KWJ A;  2Y1M A;  5LKX A;  3N3G A;  4LJN A;  3WXE A;  4UP0 A;  2ECJ A;  1Z6U A;  4FJC A;  4X6I A;  1EWM A;  3SOX A;  3CH2 X;  5G04 B;  4LKA A;  2E03 A;  5C13 A;  2NQA A;  3HWN A;  1ATK A;  4GNE A;  2MNY A;  5LKT A;  1QXP A;  1CJL A;  1CB5 A;  4RY2 A;  4YBT A;  2AUX A;  2G7Y A;  1MS6 A;  2RSD A;  4GNG A;  3ZPV 1;  2IBI A;  2KWK A;  2C0Y A;  2AN6 A;  5FEY A;  3ERV A;  5CVO B;  1O0E A;  1PPN A; 
#chains in the Genus database with same CATH topology
 1S4V A;  1F62 A;  3LQJ A;  3W30 A;  2F42 A;  2ECT A;  4QBB A;  3BWK A;  2CT2 A;  3SHB A;  2GFO A;  1DCQ A;  2MNZ A;  5B77 A;  2KGI A;  2XOC A;  4F1P A;  2XU5 A;  3ZYQ A;  1MIR A;  2MA6 A;  1KXR A;  2YHN A;  1ZCM A;  4QRV A;  2JTC A;  3O37 A;  1MHW A;  1TLO A;  2HHN A;  1M6D A;  2CKL A;  3O1G A;  1VFY A;  3H7H A;  1A6R A;  3WXF A;  3LXS A;  5F02 A;  1EWL A;  1K2F A;  2VHS A;  4LAD B;  4ZDT A;  2YJ2 A;  3O65 A;  1WFK A;  3KWB X;  3NHE A;  1CTE A;  2YHO A;  2L80 A;  3H8B A;  3PRP A;  5DKA A;  2JQG R;  2E02 A;  4CDE B;  2VPG A;  3KV6 A;  1YK8 A;  2IDA A;  3TMP A;  4QF3 A;  5SVI A;  2P57 A;  2YSM A;  2VHF A;  3BCN A;  2KE1 A;  2K4D A;  3BC3 A;  2D8U A;  5CVM A;  2LGK A;  2ECN A;  2F6N A;  2XOY A;  3FAN A;  1GMY A;  2FYE A;  3EB6 A;  2LDR A;  2XOZ A;  4NN2 A;  1HUC B;  4YVA A;  2OZ2 A;  3MHS A;  3N9N A;  4REZ A;  3RPG C;  1RMD A;  4Q6F A;  2VPD A;  4BSQ A;  4GUA A;  5CVN B;  2VPE A;  2FE8 A;  9PAP A;  3F75 A;  3H89 A;  4Q8H A;  2DC6 A;  2J7Q C;  2DC9 A;  5KH7 A;  2G8E A;  3WXG A;  3FM8 C;  2OUL A;  3H8C A;  2P0R A;  3GV4 A;  3V43 A;  3QT4 A;  4O64 A;  1ME3 A;  4AP4 A;  2C2L A;  3RTR B;  1KHP A;  2YJ8 A;  5TRB A;  2YQL A;  3O0U A;  5FPW A;  1AU4 A;  4WA6 A;  4AYC B;  2PAD A;  4HXD B;  2DC8 A;  4Z0O A;  2PUY A;  2K1J A;  4YBM A;  5EZQ A;  4D8E A;  3OF8 A;  3Q1D A;  1Z2Q A;  2FSA A;  5KH9 A;  3P5X A;  5D1L B;  3KSE A;  2LRI C;  3PHU A;  4PP2 E;  3W31 A;  2I50 A;  1AU0 A;  1QOL A;  3M63 A;  1HYI A;  3TRK A;  2VPB A;  2HXZ A;  3P5W A;  4CZW A;  3BY4 A;  2HYE D;  2MD8 C;  2B1N A;  3NG2 A;  4P6G A;  3KW9 A;  3P5V A;  3ASL A;  2DJF B;  2F1G A;  2JMD A;  1IWD A;  3MHH A;  1EWP A;  2F7D A;  2R9C A;  4I05 A;  3O34 A;  1X9Y A;  4BQV A;  4S3O C;  5SVX A;  3BPF A;  2CRW A;  4A4B A;  2G8J A;  2H0D B;  3N9P A;  2XB1 A;  3GL6 A;  1YZB A;  1U9Q X;  4BOU A;  1G25 A;  4BS5 A;  4N3W A;  2G6D A;  1BP4 A;  3E9S A;  2YUR A;  3QSD A;  3ZNI A;  2CRR A;  3HTK C;  5AIU A;  2E01 A;  1NB5 A;  4OEM A;  3SOW A;  3LRQ A;  4OGC A;  5DIN A;  5CHT A;  2HWK A;  3N9M A;  5EGW A;  2BDL A;  1U6G B;  1ME4 A;  3K24 A;  1WEW A;  4N4Z A;  2QIZ A;  3LFY A;  1MEG A;  4A0C D;  5G0F A;  2Y43 A;  2LGV A;  2FT2 A;  1U9X A;  3MP2 A;  3N9Q A;  4L7X A;  2E6R A;  2Y1N A;  4AVX A;  4X3G A;  1FBV A;  4OGE A;  5FER A;  2FTD A;  3IUT A;  2RR4 A;  3SOU A;  3KV5 A;  3RPG B;  1CPJ A;  1PCI A;  1GLO A;  4YBS A;  2M6M A;  2MD7 B;  4IC3 A;  2VJF B;  2YJB A;  4I7B A;  3IFU A;  5FB1 A;  3KWZ A;  1STF E;  4YYW A;  3PHX A;  1VJV A;  1X4I A;  4X6H A;  5JZE A;  2G45 A;  3ZVZ B;  5LKZ A;  5H1V A;  5K3Q A;  1JM7 B;  2XEU A;  5B76 A;  1WE9 A;  3FL2 A;  2FQ9 A;  3OIS A;  4N79 A;  1MBM A;  3F5V A;  1NB3 A;  1YVB A;  2AS8 A;  1ITO A;  2LN0 A;  3L1Z B;  1TL9 A;  3HHI A;  3MJ5 A;  1V87 A;  1WIL A;  4QF2 A;  2YSJ A;  2LXH C;  1WEN A;  1FP0 A;  3O33 A;  1AYV A;  5TDW A;  2DZY A;  2CSZ A;  2H7J A;  2MUM A;  1EF7 A;  3BOW A;  2ECI A;  4MM3 B;  5EZS A;  8PCH A;  2ACT A;  4ZTB A;  3LJU X;  5B8D A;  2UZJ A;  3BBA A;  3N9O A;  2R6N A;  2ECG A;  4OW0 A;  2XU3 A;  1XWH A;  5KO3 A;  1VSN A;  4A49 A;  2OXQ C;  4GND A;  2FUI A;  2AUZ A;  2Y6E A;  1XKG A;  3U5P A;  3N4C A;  4PT5 A;  4DMY A;  2AU1 A;  1POP A;  2LGL A;  3E2D A;  3I2D A;  4S3O B;  5TAB A;  2YJ9 A;  2NQD B;  4I7D A;  5B79 A;  2JRI A;  1DVP A;  2EGP A;  4AYC A;  3CBJ A;  2R9F A;  3IV2 A;  2VNF A;  3LQH A;  1PPO A;  1BQI A;  1KFX L;  2AIM A;  2BAY A;  4QQ4 A;  1Y08 A;  3RVW A;  5J3X A;  2DC7 A;  3QJ3 A;  4R8P K;  4AXL A;  3OVX A;  1FH0 A;  3LQI A;  1PPD A;  5AIT A;  5JG6 A;  2CIO A;  2K16 A;  2DCD A;  3IMA A;  5EF4 A;  2L5U A;  4FIP A;  4XI1 A;  2EXU A;  1YAL A;  2OWA A;  4MSX A;  1Y4H A;  2DCA A;  3ZPV E;  1DKI A;  4N8W A;  3M99 A;  1AYW A;  2AYO A;  2BTW B;  3LDY A;  2LV9 A;  3S3R A;  5D1M B;  1QDQ A;  4N4F A;  4A4C A;  4I04 A;  2QJ0 A;  3FEH A;  1TU6 A;  4IC2 A;  2CB5 A;  2H0D A;  1U9V A;  4PTB A;  3LVR E;  3ZUA A;  4D8I A;  4H9D A;  1VYX A;  3PRM A;  3MDB C;  4YAB A;  4P16 A;  5FB0 A;  1BOR A;  4RF1 A;  2DJG B;  2KIZ A;  2KKX A;  4LK9 A;  2M85 A;  1CQD A;  2WBF X;  3KX1 A;  3IHP A;  4BOS A;  3H6S A;  1WEU A;  4BPV A;  3KDE C;  1MEM A;  2CSY A;  1EWO A;  2M13 A;  1AEC A;  2XP0 A;  2DCC A;  4BOP A;  2VJE B;  1DF0 A;  2DJA A;  3PDF A;  4YV8 A;  3IOQ A;  1BY8 A;  5TBN A;  4AXM A;  4CDC B;  4R7E A;  4B7Y C;  4R3D A;  2D8S A;  2LQ6 A;  4OEL A;  2DX8 A;  3K8U A;  4QH6 A;  5PAD A;  2VJF A;  1PPP A;  2BU3 A;  3OF9 A;  2NQI A;  3V6C A;  2J7Q A;  2PRE A;  5B78 A;  3CBK A;  2FD4 A;  4UI9 B;  3PW3 A;  1JM7 A;  1JOC A;  4YAD A;  4CA1 A;  2E00 A;  5KH3 A;  2IPP B;  2F6J A;  2O6X A;  3IEJ A;  2DCB A;  3ZTG A;  3RVX A;  1VD4 A;  3RNV A;  2JMI A;  2YYR A;  4HWY A;  3DPL R;  5SVY A;  1CHC A;  3MOR A;  3OVZ A;  2FFW A;  1U9W A;  4WZ0 A;  1ZBD B;  2P86 A;  1N87 A;  4LLB A;  2HH5 A;  4G54 A;  4XZX A;  3DDT A;  1F29 A;  2FUD A;  5K16 A;  1WEM A;  5LCW B;  2YJC A;  3L11 A;  4CDF B;  5CHV A;  3CH3 X;  4B86 C;  5J94 A;  3C5K A;  1F2A A;  2PNX A;  2E61 A;  2B1M A;  2ATO A;  1NQC A;  3S3Q A;  5A24 A;  4FK5 A;  4C9Z A;  4GNF A;  1U5I A;  1CV8 A;  4L58 A;  1AU2 A;  3K9M A;  2MKE A;  4RNA A;  2L7P A;  6PAD A;  1WEV A;  5G05 B;  2DSM A;  1AU3 A;  1LDK C;  4AUQ B;  2NAA A;  4P6E A;  3P5U A;  3N3K A;  2DZZ A;  2FRA A;  4OVZ B;  1ICF A;  3PHW A;  3ZVY A;  2KKY A;  4CCG X;  1PE6 A;  3PUR A;  2FUU A;  4ZQL A;  1WGM A;  1YK7 A;  1PVJ A;  3B79 A;  2EGM A;  1CS8 A;  4BOQ A;  2JRJ A;  1WEE A;  2LXP C;  2QIC A;  1CVZ A;  4W5B A;  4YYV A;  4YYS A;  2ZET C;  5H1U A;  2YVR A;  3ZNH A;  3KQI A;  2MA5 A;  3RVV A;  1PAD A;  2ARY A;  3JUE A;  1LDJ B;  3DF0 A;  4D8B A;  2BTW A;  4BBQ A;  3GCB A;  4DMX A;  2AGA A;  3O70 A;  4K7C A;  2YW8 A;  2PBH A;  4KLB A;  2YRE A;  2C2V S;  1THE A;  3T9K A;  3OQC A;  1X4J A;  2ECV A;  1PXV A;  3I3T A;  2FRQ A;  2EA6 A;  1CSB B;  3AI8 A;  2R9O A;  3QZV A;  1MDW A;  2BDZ A;  3BPM A;  4P5O B;  4PAD A;  2L75 A;  4QRX A;  1F2C A;  4YYQ A;  1WEQ A;  3U5O A;  3HCS A;  1NL6 A;  2M3H A;  5JH3 A;  5B75 A;  1IYM A;  1WIM A;  1PBH A;  4BHW A;  3U8E A;  4BOZ A;  2KRE A;  4W4U A;  3MTN A;  2JQF R;  2VJE A;  2KU3 A;  3SUB A;  4CDD B;  3C0R A;  5I3L A;  4YYR A;  4YAT A;  1HYJ A;  1QMY A;  3FAO A;  3I06 A;  4I07 A;  3U5N A;  1GEC E;  1KHQ A;  2KR4 A;  1KFU L;  3KFQ A;  3HCU A;  2LAU A;  3C9E A;  1PIP A;  2MIQ A;  3D6S A;  2CON A;  3V6E A;  4GB0 A;  2VP7 A;  1NPZ A;  4PP1 A;  3FJU B;  4V3K C;  2YT5 A;  2KYU A;  4PPE A;  4R2Y A;  3U5M A;  3H7D A;  2KWN A;  2M1R A;  4X6J A;  1X4U A;  3T7L A;  3C6W A;  2AVW A;  3USV A;  2Y5B A;  2RI7 A;  4WZ2 A;  4Z0R A;  5LKU A;  1UKF A;  1WES A;  2NQG A;  4MZS A;  2B0O E;  2HDP A;  2EOD A;  3O36 A;  5E6J A;  4V3L C;  4QRG A;  4MZO A;  2L43 A;  2CSV A;  2JMJ A;  2CKL B;  3O47 A;  2G6Q A;  3KKU A;  3M7K A;  3PT2 A;  1WEP A;  2R9M A;  2L0B A;  4XR7 A;  3O35 A;  3B21 A;  1GCB A;  3EB5 A;  4PI3 A;  3DQV R;  3KNV A;  1MM2 A;  2JM3 A;  2KWO A;  1AIM A;  1YT7 A;  2YQM A;  3L1X A;  4RF0 A;  4F52 B;  1K3B B;  1ZIV A;  2JUN A;  5SVI B;  4M0W A;  2XU1 A;  4YC9 A;  5EYA F;  2PNS A;  2R9N A;  1Z60 A;  7PCK A;  4FO9 A;  2P7U A;  3T6R A;  3O7A A;  3VK6 A;  1AYU A;  4O62 A;  1E4U A;  2AYN A;  1MM3 A;  3HHA A;  2E6S A;  4MI7 A;  2ECW A;  2G43 A;  2OP3 A;  2LGG A;  4IUM A;  4TKP B;  3M62 A;  4OVZ A;  4WUR A;  1Q6K A;  4RKX A;  4W5C A;  3DWD A;  1SP4 B;  1F2B A;  2IQJ A;  3E1Z B;  4A5U A;  3N9L A;  5C11 A;  2DOS A;  3HD3 A;  3PUQ A;  3TNX A;  5H9M A;  2YUC A;  1BGO A;  2HD5 A;  5D1K B;  3PBH A;  5H1T A;  4I7C A;  1WEO A;  4UP5 A;  4XUI A;  4YYU A;  4ZUX U;  4YAX A;  1DEU A;  2MT5 A;  2KFT A;  2KGG A;  3HCT A;  2GHU A;  4MVT A;  1NLJ A;  3PNR A;  1SNK A;  2YU4 A;  2FO5 A;  2K17 A;  3PSE A;  2XU4 A;  2UZG A;  5TDR A;  3PHD A;  1JQP A;  4Q8G A;  4BS6 A;  5JA7 A;  1T1H A;  3PLW A;  2KWJ A;  4WZ3 B;  2Y1M A;  5LKX A;  2Z84 A;  3N3G A;  4LJN A;  3MTV A;  3WXE A;  4UP0 A;  4IP3 A;  2ECJ A;  1Z6U A;  4FJC A;  4X6I A;  1EWM A;  3SOX A;  3CH2 X;  5G04 B;  4LKA A;  2E03 A;  5C13 A;  2NQA A;  3HWN A;  1ATK A;  4GNE A;  2MNY A;  3BB7 A;  5LKT A;  1QXP A;  3LVQ E;  1CJL A;  1CB5 A;  4RY2 A;  4YBT A;  2AUX A;  2G7Y A;  1MS6 A;  2RSD A;  4GNG A;  3ZPV 1;  2IBI A;  2KWK A;  2C0Y A;  2AN6 A;  5FEY A;  3ERV A;  5CVO B;  1O0E A;  1PPN A; 
#chains in the Genus database with same CATH homology
 1S4V A;  1F62 A;  3LQJ A;  2F42 A;  2ECT A;  4QBB A;  3BWK A;  2CT2 A;  3SHB A;  2GFO A;  2MNZ A;  5B77 A;  2KGI A;  2XU5 A;  3ZYQ A;  1MIR A;  2MA6 A;  1KXR A;  2YHN A;  1ZCM A;  4QRV A;  3O37 A;  1MHW A;  1TLO A;  2HHN A;  1M6D A;  2CKL A;  3O1G A;  1VFY A;  3WXF A;  1A6R A;  3LXS A;  5F02 A;  1EWL A;  1K2F A;  2VHS A;  4LAD B;  4ZDT A;  2YJ2 A;  1WFK A;  3KWB X;  3NHE A;  1CTE A;  2YHO A;  2L80 A;  3H8B A;  5DKA A;  2JQG R;  2E02 A;  4CDE B;  2VPG A;  3KV6 A;  1YK8 A;  2IDA A;  4QF3 A;  2VHF A;  2YSM A;  3BCN A;  2KE1 A;  2K4D A;  4GUZ A;  3BC3 A;  5CVM A;  2LGK A;  2ECN A;  2F6N A;  1GMY A;  2FYE A;  3EB6 A;  2LDR A;  4NN2 A;  1HUC B;  4YVA A;  2OZ2 A;  3MHS A;  3N9N A;  3RPG C;  1RMD A;  4Q6F A;  2VPD A;  4BSQ A;  5CVN B;  2VPE A;  9PAP A;  3F75 A;  3H89 A;  4Q8H A;  2DC6 A;  2DC9 A;  5KH7 A;  2G8E A;  2BSZ A;  3WXG A;  2OUL A;  3H8C A;  2P0R A;  3GV4 A;  3V43 A;  3QT4 A;  4O64 A;  1ME3 A;  4AP4 A;  2C2L A;  3RTR B;  1KHP A;  2YJ8 A;  5TRB A;  2YQL A;  3O0U A;  5FPW A;  1AU4 A;  4WA6 A;  4AYC B;  2PAD A;  2DC8 A;  2PUY A;  2K1J A;  4YBM A;  3OF8 A;  5KH9 A;  1Z2Q A;  2FSA A;  3P5X A;  5D1L B;  3KSE A;  2LRI C;  4PP2 E;  2I50 A;  1AU0 A;  1QOL A;  1W6F A;  3M63 A;  1HYI A;  4C5P A;  2VPB A;  2VFB A;  2HXZ A;  3P5W A;  4CZW A;  2HYE D;  2MD8 C;  2B1N A;  3NG2 A;  4P6G A;  3KW9 A;  3P5V A;  3ASL A;  2DJF B;  2F1G A;  2JMD A;  1IWD A;  3MHH A;  1EWP A;  2F7D A;  2R9C A;  4I05 A;  3O34 A;  1X9Y A;  4BQV A;  4S3O C;  3BPF A;  4A4B A;  2G8J A;  2VFC A;  2H0D B;  3N9P A;  2XB1 A;  3GL6 A;  4BS5 A;  1U9Q X;  1G25 A;  4N3W A;  2G6D A;  1BP4 A;  2YUR A;  3QSD A;  3ZNI A;  5AIU A;  3HTK C;  1NB5 A;  2E01 A;  4OEM A;  3SOW A;  3LRQ A;  5DIN A;  5CHT A;  3N9M A;  5EGW A;  2BDL A;  1U6G B;  1ME4 A;  3K24 A;  1WEW A;  4N4Z A;  2QIZ A;  3LFY A;  1MEG A;  4A0C D;  5G0F A;  2Y43 A;  2LGV A;  2FT2 A;  1U9X A;  3N9Q A;  4L7X A;  2E6R A;  2Y1N A;  4AVX A;  4X3G A;  1FBV A;  5FER A;  2FTD A;  3IUT A;  3SOU A;  3KV5 A;  3RPG B;  1CPJ A;  1PCI A;  1GLO A;  4YBS A;  2M6M A;  2MD7 B;  4IC3 A;  2VJF B;  2YJB A;  4I7B A;  3LTW A;  5FB1 A;  3KWZ A;  1STF E;  4YYW A;  1VJV A;  1X4I A;  4X6H A;  2G45 A;  3ZVZ B;  5LKZ A;  5H1V A;  1JM7 B;  2XEU A;  5B76 A;  1WE9 A;  3FL2 A;  2FQ9 A;  3OIS A;  4N79 A;  3F5V A;  1NB3 A;  1YVB A;  2AS8 A;  1ITO A;  2LN0 A;  3L1Z B;  1TL9 A;  3HHI A;  1V87 A;  1WIL A;  4QF2 A;  1GX3 A;  2YSJ A;  2LXH C;  1WEN A;  1FP0 A;  3O33 A;  1AYV A;  5TDW A;  2DZY A;  2CSZ A;  2H7J A;  2MUM A;  1EF7 A;  3BOW A;  2ECI A;  8PCH A;  2ACT A;  5B8D A;  3N9O A;  2R6N A;  2ECG A;  2XU3 A;  1XWH A;  1VSN A;  4A49 A;  2OXQ C;  4GND A;  2FUI A;  2AUZ A;  2Y6E A;  1XKG A;  3U5P A;  3N4C A;  4DMY A;  2AU1 A;  1POP A;  2LGL A;  2YJ9 A;  3I2D A;  4S3O B;  5TAB A;  2NQD B;  4I7D A;  5B79 A;  1DVP A;  2EGP A;  4AYC A;  3CBJ A;  2R9F A;  3IV2 A;  2VNF A;  3LQH A;  1PPO A;  1BQI A;  1KFX L;  2AIM A;  2BAY A;  1Y08 A;  3RVW A;  5J3X A;  2DC7 A;  3QJ3 A;  4R8P K;  4AXL A;  3OVX A;  1FH0 A;  3LQI A;  1PPD A;  5AIT A;  5JG6 A;  2CIO A;  2K16 A;  2DCD A;  3IMA A;  5EF4 A;  2L5U A;  4FIP A;  4XI1 A;  1YAL A;  4MSX A;  1Y4H A;  2DCA A;  3ZPV E;  4N8W A;  3D9W A;  3M99 A;  1AYW A;  4NV8 A;  2AYO A;  4NV7 A;  2LV9 A;  3S3R A;  5D1M B;  1QDQ A;  4N4F A;  4A4C A;  4I04 A;  2QJ0 A;  1TU6 A;  4IC2 A;  2CB5 A;  2H0D A;  1U9V A;  4PTB A;  3ZUA A;  1VYX A;  4YAB A;  5FB0 A;  1BOR A;  2DJG B;  2KIZ A;  4LK9 A;  2M85 A;  1CQD A;  2WBF X;  3KX1 A;  3IHP A;  3H6S A;  1WEU A;  4BPV A;  1MEM A;  2CSY A;  1EWO A;  1AEC A;  2DCC A;  2VJE B;  1DF0 A;  3PDF A;  4YV8 A;  3IOQ A;  1BY8 A;  5TBN A;  4AXM A;  4CDC B;  4R7E A;  4B7Y C;  2D8S A;  2LQ6 A;  4OEL A;  2DX8 A;  3K8U A;  4QH6 A;  5PAD A;  2VJF A;  1PPP A;  3OF9 A;  2NQI A;  3V6C A;  2PRE A;  5B78 A;  3CBK A;  4UI9 B;  3PW3 A;  1JM7 A;  1JOC A;  4YAD A;  4B55 A;  4CA1 A;  2E00 A;  5KH3 A;  2IPP B;  2F6J A;  2O6X A;  3IEJ A;  2DCB A;  3ZTG A;  3RVX A;  1VD4 A;  2JMI A;  2YYR A;  4HWY A;  3DPL R;  1CHC A;  3MOR A;  3OVZ A;  1U9W A;  4WZ0 A;  1ZBD B;  2P86 A;  1N87 A;  4LLB A;  2HH5 A;  4G54 A;  1F29 A;  2FUD A;  5K16 A;  1WEM A;  5LCW B;  2YJC A;  3L11 A;  4CDF B;  5CHV A;  3CH3 X;  4B86 C;  5J94 A;  3C5K A;  1F2A A;  2PNX A;  2B1M A;  2ATO A;  1NQC A;  3S3Q A;  5A24 A;  4FK5 A;  4C9Z A;  4GNF A;  1U5I A;  1CV8 A;  4L58 A;  1AU2 A;  3K9M A;  6PAD A;  1WEV A;  5G05 B;  1AU3 A;  1LDK C;  4AUQ B;  2NAA A;  4P6E A;  3P5U A;  3N3K A;  2DZZ A;  2FRA A;  1ICF A;  3ZVY A;  4CCG X;  1PE6 A;  1YK7 A;  3PUR A;  2FUU A;  4ZQL A;  1WGM A;  3B79 A;  1CS8 A;  2JRJ A;  1WEE A;  2LXP C;  2QIC A;  1CVZ A;  4W5B A;  4YYV A;  4YYS A;  2ZET C;  5H1U A;  3KQI A;  2MA5 A;  3RVV A;  1PAD A;  2ARY A;  1LDJ B;  3DF0 A;  4BBQ A;  3GCB A;  4DMX A;  3O70 A;  4K7C A;  2YW8 A;  2PBH A;  4KLB A;  2YRE A;  2C2V S;  1THE A;  1X4J A;  2ECV A;  1PXV A;  3I3T A;  2FRQ A;  2EA6 A;  1CSB B;  3AI8 A;  2R9O A;  3QZV A;  1MDW A;  2BDZ A;  3BPM A;  4P5O B;  4PAD A;  2L75 A;  4QRX A;  1F2C A;  4YYQ A;  1WEQ A;  3U5O A;  3HCS A;  1NL6 A;  2M3H A;  5JH3 A;  5B75 A;  1IYM A;  1WIM A;  1PBH A;  4BHW A;  3U8E A;  2KRE A;  4W4U A;  3MTN A;  2JQF R;  2VJE A;  2KU3 A;  4CDD B;  5I3L A;  1W5R A;  4YYR A;  4YAT A;  1HYJ A;  1QMY A;  3I06 A;  4I07 A;  3U5N A;  1GEC E;  1KHQ A;  2KR4 A;  1KFU L;  3KFQ A;  3HCU A;  3C9E A;  1PIP A;  2MIQ A;  3D6S A;  3V6E A;  4GB0 A;  2VP7 A;  1NPZ A;  4PP1 A;  4V3K C;  2YT5 A;  2KYU A;  4PPE A;  4R2Y A;  3U5M A;  3H7D A;  2KWN A;  2M1R A;  4X6J A;  1X4U A;  3T7L A;  3C6W A;  2AVW A;  3USV A;  2Y5B A;  2RI7 A;  4WZ2 A;  5LKU A;  1WES A;  2NQG A;  4MZS A;  2HDP A;  2EOD A;  3O36 A;  4V3L C;  4QRG A;  4MZO A;  2L43 A;  2JMJ A;  2CKL B;  2G6Q A;  3KKU A;  1WEP A;  2R9M A;  2L0B A;  4XR7 A;  3O35 A;  1GCB A;  3EB5 A;  4PI3 A;  3DQV R;  3KNV A;  1MM2 A;  2KWO A;  1AIM A;  1YT7 A;  2YQM A;  3L1X A;  4F52 B;  1K3B B;  1ZIV A;  2XU1 A;  4YC9 A;  5EYA F;  2PNS A;  1W4T A;  2R9N A;  1Z60 A;  7PCK A;  4FO9 A;  2P7U A;  3T6R A;  3O7A A;  3VK6 A;  1AYU A;  1E4U A;  2AYN A;  1MM3 A;  3HHA A;  2E6S A;  2ECW A;  2G43 A;  2OP3 A;  2LGG A;  4TKP B;  3M62 A;  1Q6K A;  4W5C A;  1SP4 B;  1F2B A;  3E1Z B;  3N9L A;  5C11 A;  3TNX A;  3HD3 A;  3PUQ A;  4BGF A;  5H9M A;  2YUC A;  1BGO A;  2HD5 A;  5D1K B;  3PBH A;  5H1T A;  4I7C A;  1WEO A;  4UP5 A;  4XUI A;  4YYU A;  4ZUX U;  4YAX A;  1DEU A;  2MT5 A;  2KFT A;  2KGG A;  3HCT A;  2GHU A;  4MVT A;  1NLJ A;  3PNR A;  1SNK A;  2YU4 A;  2FO5 A;  2K17 A;  2XU4 A;  2UZG A;  5TDR A;  3PHD A;  1JQP A;  4Q8G A;  4BS6 A;  5JA7 A;  1T1H A;  4WZ3 B;  2KWJ A;  2Y1M A;  5LKX A;  3N3G A;  4LJN A;  3WXE A;  4UP0 A;  2ECJ A;  1Z6U A;  4FJC A;  4X6I A;  1EWM A;  3SOX A;  3CH2 X;  5G04 B;  4LKA A;  2E03 A;  5C13 A;  2NQA A;  3HWN A;  1ATK A;  4GNE A;  2MNY A;  5LKT A;  1QXP A;  1CJL A;  1CB5 A;  4RY2 A;  4YBT A;  2AUX A;  2G7Y A;  1MS6 A;  2RSD A;  4GNG A;  3ZPV 1;  2IBI A;  2KWK A;  2C0Y A;  2AN6 A;  5FEY A;  3ERV A;  5CVO B;  1O0E A;  1E2T A;  1PPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...