4WA6A

Structure of yeast saga dubm with sgf73 n59d mutant at 2.36 angstroms resolution
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
471
structure length
440
Chain Sequence
b'MSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALNRQTGFIYLLTCAWKIQDAHEFWQFIINQIHQSYVLDLPNAKEVSRANNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNYHCGECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
publication title Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transcription
total genus 141
structure length 440
sequence length 471
chains with identical sequence D
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4wa6A01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4wa6A02
4AXMA 1PPPA 2VJEA 1LDJB 2VNFA 1PPDA 5TABA 3N9QA 3BCNA 3GCBA 2G6QA 3V43A 1MM2A 1GCBA 4QBBA 1MS6A 1STFE 4YYUA 1QDQA 3O7AA 1AYUA 3F75A 5CVOB 3M63A 4GNFA 3RPGB 2OP3A 2VP7A 3O37A 2LDRA 4IC3A 4MSXA 5DINA 2KE1A 5JG6A 2DZZA 2LGKA 1Z6UA 4X3GA 2ECJA 2F6JA 3V6CA 4R8PK 1FP0A 2ZETC 1XKGA 4W4UA 2R9FA 1KFXL 2AYNA 3KFQA 2ECTA 5FB0A 2KIZA 4GNEA 1VYXA 5J3XA 5B79A 2YJ8A 2OXQC 5CHTA 2LGGA 5D1KB 4FO9A 2B1NA 2VHSA 2L43A 5KH3A 3DQVR 2YHNA 1DVPA 4R7EA 4PTBA 4ZQLA 1BGOA 3IUTA 5DKAA 3ZYQA 1ZBDB 4AYCA 2I50A 1AU4A 2DJFB 4BHWA 2C2VS 4S3OC 3RVXA 1BY8A 4IC2A 2VPGA 3RVWA 2O6XA 3P5UA 3CH3X 2XB1A 4CA1A 3V6EA 2YURA 1WESA 2YUCA 4L7XA 2Y43A 3TNXA 5AITA 4G54A 2MA5A 3HCSA 2CSZA 3ZVZB 1F29A 4WZ2A 2KREA 6PADA 2L80A 2RSDA 2YW8A 4WA6A 3QJ3A 2VPEA 4OELA 5TBNA 3S3RA 2YJCA 4PI3A 1HYIA 3GV4A 1JM7B 3PURA 4L58A 1KFUL 2E00A 3C5KA 4XI1A 2CB5A 3KV6A 2OZ2A 3C6WA 4YV8A 4V3KC 3OISA 5I3LA 5JH3A 4C9ZA 4BPVA 2FT2A 5H1VA 4F52B 4I7DA 2FRQA 1LDKC 3PUQA 4UP0A 4QRXA 1GMYA 2AYOA 2QIZA 2HYED 5D1LB 4P6GA 4YABA 5A24A 3LRQA 2XU3A 1PCIA 3RVVA 2PADA 1WEWA 4LJNA 3B79A 2MNZA 1ICFA 4A0CD 2R9NA 1WFKA 2CSYA 3PDFA 1MM3A 2QICA 3ZTGA 5KH9A 1AU3A 1U9WA 2KR4A 1VD4A 2HDPA 4WZ0A 2AUZA 5G05B 3LQJA 2D8SA 2NQGA 1MIRA 2FUIA 4YBSA 1PPNA 3P5XA 3DPLR 4FK5A 3AI8A 2KYUA 1Z2QA 2YJBA 4PP1A 1ITOA 3ERVA 1O0EA 2AN6A 4N4FA 3N9NA 1WE9A 5TRBA 2E02A 2FO5A 3OVXA 4Q8HA 1NB3A 2VJFB 3P5VA 1X4IA 2DJGB 4CDCB 3DF0A 1CJLA 1RMDA 3BPFA 1KHQA 5FEYA 3U5OA 3K24A 1AU2A 2MIQA 2MT5A 2C0YA 4YYQA 7PCKA 5F02A 4PADA 4FIPA 1G25A 1NB5A 2K4DA 4I05A 4DMXA 2NQAA 3N4CA 1MDWA 1Q6KA 3T7LA 4CCGX 2IDAA 4YYWA 4UI9B 1SNKA 4B86C 3OF9A 3PNRA 2YU4A 3BOWA 1PIPA 3KKUA 4YYVA 4AYCB 1YT7A 2DC8A 5EYAF 2FUDA 3I3TA 3ZVYA 4ZUXU 1HYJA 3U8EA 2PUYA 4QF2A 3H8BA 5LKXA 3CBJA 4BQVA 1PE6A 2EA6A 2GHUA 2YT5A 4A4BA 4Q6FA 4DMYA 2KGIA 2ECNA 4GNDA 5LKUA 4YVAA 2MD7B 4I7BA 2FYEA 2LV9A 3KSEA 4AXLA 1Z60A 3RTRB 3PHDA 2FQ9A 3KV5A 5G04B 2YJ2A 1HUCB 1CS8A 2KGGA 2MNYA 2PNXA 3LQIA 2MA6A 4N79A 1CQDA 1THEA 3N9MA 4LKAA 1AECA 2YHOA 3N3GA 2YSJA 4BS5A 3OVZA 1NL6A 2G7YA 2P0RA 5H1TA 3KX1A 2YREA 1YVBA 5CVMA 3LXSA 3NG2A 1JOCA 3O35A 4TKPB 2Y5BA 3U5PA 2HXZA 3KWBX 2E01A 3K8UA 5PADA 3D6SA 1EWMA 4PP2E 1A6RA 4W5CA 2JMDA 2JQGR 2K16A 4YC9A 4R2YA 3IMAA 1MHWA 3IV2A 3ZPVE 1ZIVA 8PCHA 4CDEB 1F2BA 1TLOA 4AP4A 1QXPA 5H1UA 1PADA 3MHHA 4UP5A 1ME3A 3N3KA 4A4CA 1U6GB 2OULA 2KWKA 3ZPV1 1JQPA 4CDDB 2F42A 4MVTA 5KH7A 2DC6A 4MZSA 4Q8GA 5J94A 2DX8A 5AIUA 1BQIA 2EODA 1DF0A 4QRGA 4LK9A 2DZYA 4LADB 3PBHA 5K16A 2E6RA 1WEMA 3F5VA 4XUIA 3O34A 1YALA 2ECWA 2GFOA 2VJEB 4P5OB 3QSDA 4FJCA 1S4VA 5B78A 2FRAA 3RPGC 4QH6A 2G43A 2AIMA 2F7DA 1WGMA 1CHCA 1WIMA 2WBFX 2G6DA 2LQ6A 3O36A 1AIMA 3L11A 2XU4A 4GB0A 4X6IA 5B77A 2M1RA 5LCWB 5FPWA 3SOWA 3EB6A 1E4UA 4YADA 3H6SA 1BP4A 3QT4A 3EB5A 2YYRA 3U5MA 2F6NA 3U5NA 1IWDA 1U9XA 4HWYA 1IYMA 4QF3A 3HD3A 3OF8A 1XWHA 2KFTA 1YK7A 2LXHC 1CTEA 4S3OB 2CIOA 3L1ZB 4W5BA 1K3BB 3ZNIA 3E1ZB 3KQIA 5TDRA 1AYWA 2H7JA 2ATOA 4KLBA 3WXGA 5B76A 1SP4B 2ARYA 4YAXA 5B8DA 2UZGA 2DC7A 3N9OA 5C11A 2LRIC 1F2AA 1GECE 2FUUA 3PW3A 2G8JA 3SHBA 1K2FA 3HWNA 2LN0A 3M62A 2JQFR 1WEVA 3HCTA 3O0UA 3H8CA 2XU5A 3C9EA 4OEMA 5FERA 3IHPA 5CVNB 5B75A 4P6EA 4GNGA 2JMJA 4YATA 3WXEA 4N3WA 3WXFA 4XR7A 2YQLA 4WZ3B 2AU1A 3N9PA 4I04A 1M6DA 2NAAA 1PBHA 4LLBA 3H89A 2HD5A 1WEEA 2NQDB 3O70A 3LFYA 1N87A 5H9MA 1VJVA 2LXPC 4X6HA 1WEQA 3P5WA 2Y1NA 4YBMA 1F62A 2QJ0A 3CBKA 2LGLA 4ZDTA 4AVXA 2PREA 3M99A 2P86A 9PAPA 2YQMA 1NLJA 2M85A 2ECVA 1VFYA 1KXRA 4O64A 2YJ9A 4N8WA 2H0DA 5JA7A 4CZWA 3GL6A 1VSNA 1ZCMA 5D1MB 4CDFB 3ZUAA 5LKZA 3NHEA 4K7CA 1PPOA 4BS6A 5C13A 2VJFA 2L5UA 3MHSA 5G0FA 1WILA 2KU3A 1CVZA 3BC3A 1GLOA 1FH0A 1NPZA 1EWPA 1CPJA 3T6RA 2FSAA 2IPPB 5EF4A 1U5IA 2CKLA 3HCUA 1AYVA 3CH2X 2KWJA 2AUXA 4I7CA 5LKTA 2F1GA 2PBHA 3USVA 2R9CA 5CHVA 1POPA 2RI7A 1ME4A 1EWOA 2VPDA 1V87A 2Y1MA 1FBVA 4YYRA 1TL9A 2YSMA 1ATKA 3KNVA 1BORA 1QMYA 2DCDA 1MEGA 2ECIA 5TDWA 2CT2A 2BDLA 1AU0A 2L75A 3SOUA 2HH5A 1CV8A 2M3HA 3L1XA 4V3LC 4X6JA 4YYSA 2FTDA 4BSQA 2E6SA 3KWZA 4AUQB 3O33A 1KHPA 2P7UA 2Y6EA 2MD8C 3MTNA 1X4JA 1WEPA 2B1MA 3H7DA 2K1JA 1MEMA 2DCBA 3BWKA 2JMIA 4BBQA 2M6MA 2DC9A 5FB1A 3HTKC 2XEUA 4B7YC 3I2DA 4A49A 2JRJA 2NQIA 3QZVA 1CB5A 2HHNA 2BAYA 4RY2A 2LGVA 2G8EA 2E03A 3LQHA 3BPMA 3S3QA 3FL2A 2XU1A 2DCAA 2R9MA 4QRVA 2C2LA 4YBTA 1TU6A 2DCCA 1Y4HA 1YK8A 3IOQA 3I06A 1CSBB 5EGWA 4MZOA 2G45A 3SOXA 2R6NA 3N9LA 2H0DB 1F2CA 2BDZA 3HHAA 1PXVA 1QOLA 1DEUA 1X9YA 1Y08A 3KW9A 3HHIA 2KWNA 3K9MA 4NN2A 1JM7A 2AS8A 2VPBA 2AVWA 2R9OA 2IBIA 2ACTA 4PPEA 1T1HA 2L0BA 1EF7A 3IEJA 4I07A 1EWLA 3O1GA 1U9QX 2PNSA 3ASLA 2ECGA 2EGPA 2K17A 2CKLB 1X4UA 1WEOA 3VK6A 2KWOA 2VHFA 4N4ZA 2MUMA 1U9VA 3MORA 1NQCA 1WEUA 1WENA
chains in the Genus database with same CATH superfamily
4AXMA 1PPPA 2VJEA 1LDJB 2VNFA 1PPDA 5TABA 3N9QA 2J7QC 3BCNA 3GCBA 2G6QA 1DCQA 3V43A 1MM2A 1GCBA 4ZTBA 4HXDB 4QBBA 1MS6A 1STFE 4YYUA 1QDQA 3O7AA 1AYUA 3F75A 5CVOB 3M63A 4GNFA 3RPGB 2OP3A 2OWAA 2VP7A 2L7PA 3O37A 2LDRA 4IC3A 4MSXA 5DINA 3W31A 2KE1A 5JG6A 2DZZA 2LGKA 2HWKA 3FAOA 1Z6UA 4X3GA 2ECJA 4IUMA 2F6JA 3V6CA 4R8PK 5K3QA 1FP0A 2ZETC 1XKGA 4W4UA 2R9FA 2UZJA 4Z0OA 1KFXL 2AYNA 4BOPA 3KFQA 2ECTA 2FD4A 4F1PA 5FB0A 2KIZA 4GNEA 1VYXA 2CRRA 5J3XA 5B79A 2YJ8A 2OXQC 5CHTA 2LGGA 3PLWA 4FO9A 5D1KB 2B1NA 4OGCA 3W30A 2VHSA 2L43A 5KH3A 3DQVR 2YHNA 1DVPA 4R7EA 4PTBA 4ZQLA 1BGOA 3IUTA 5DKAA 3ZYQA 4O62A 1ZBDB 4AYCA 2I50A 1AU4A 2DJFB 4BHWA 4RKXA 2C2VS 4S3OC 3RVXA 3DDTA 1BY8A 3H7HA 3PRPA 4IC2A 2VPGA 3RVWA 2O6XA 3P5UA 4D8EA 3CH3X 2XB1A 4CA1A 3V6EA 4BOUA 2YURA 1WESA 2YUCA 4L7XA 2Y43A 3TNXA 5AITA 3Q1DA 4G54A 2MA5A 3HCSA 2CSZA 3ZVZB 1F29A 4WZ2A 2KREA 6PADA 2L80A 2RSDA 2YW8A 4WA6A 3QJ3A 2VPEA 4OELA 3DWDA 5TBNA 3S3RA 2YJCA 4PI3A 1HYIA 3GV4A 2P57A 1JM7B 3PURA 4L58A 1KFUL 2E00A 2XOZA 3C5KA 4XI1A 2CB5A 3KV6A 2JTCA 3C6WA 2OZ2A 4YV8A 4V3KC 3MDBC 3OISA 3C0RA 3BB7A 5I3LA 5JH3A 3RNVA 4C9ZA 3LVRE 4BPVA 2FT2A 5H1VA 4F52B 4I7DA 2FRQA 1LDKC 3PUQA 4UP0A 4QRXA 1GMYA 2AYOA 2QIZA 5D1LB 4P6GA 4YABA 4H9DA 5A24A 3LRQA 2XU3A 4MI7A 1PCIA 2XOYA 3RVVA 2RR4A 2PADA 1WEWA 4LJNA 3B79A 2MNZA 1ICFA 4A0CD 2R9NA 1WFKA 2CSYA 3PDFA 1MM3A 2QICA 3ZTGA 3MTVA 5KH9A 1AU3A 1U9WA 2KR4A 1VD4A 3LVQE 2HDPA 4WZ0A 2AUZA 5G05B 3LQJA 3MJ5A 2DJAA 2D8SA 2NQGA 1MIRA 2XP0A 2FUIA 4YBSA 1PPNA 3P5XA 3DPLR 4FK5A 3AI8A 2KYUA 1Z2QA 2YJBA 4PP1A 1ITOA 3ERVA 3IFUA 1O0EA 2AN6A 4N4FA 3N9NA 1WE9A 5TRBA 5SVYA 2E02A 2FO5A 3OVXA 4Q8HA 1NB3A 2VJFB 3P5VA 2JUNA 1X4IA 2DJGB 4CDCB 3DF0A 1CJLA 1RMDA 3BPFA 1KHQA 5FEYA 3U5OA 3K24A 1AU2A 2MIQA 2MT5A 2C0YA 4YYQA 7PCKA 5F02A 4PADA 4FIPA 1G25A 1NB5A 2K4DA 4I05A 4DMXA 2NQAA 3N4CA 1MDWA 1Q6KA 3T7LA 4CCGX 2JRIA 2IDAA 4YYWA 4UI9B 1SNKA 2JM3A 4B86C 3OF9A 3PNRA 2YU4A 3BOWA 1PIPA 3KKUA 4YYVA 4AYCB 1YT7A 2DC8A 5EYAF 3BBAA 2FUDA 3I3TA 3T9KA 3ZVYA 1YZBA 2KKXA 4ZUXU 1HYJA 3U8EA 2PUYA 4QF2A 3H8BA 3PRMA 5LKXA 3CBJA 4BQVA 3M7KA 1PE6A 2EA6A 2GHUA 4GUAA 2YT5A 4A4BA 4OGEA 3FJUB 4Q6FA 4DMYA 2KGIA 2ECNA 3FEHA 4GNDA 5LKUA 4OVZA 4YVAA 2MD7B 4I7BA 2FYEA 2LV9A 3KSEA 4AXLA 3FANA 1Z60A 3RTRB 3PHDA 2FQ9A 2LAUA 3KV5A 5G04B 2YJ2A 1HUCB 1CS8A 2KGGA 2MNYA 2PNXA 3LQIA 2MA6A 3LJUX 5EZQA 4N79A 3O47A 4QQ4A 1CQDA 1THEA 3N9MA 4LKAA 2D8UA 2CONA 1AECA 2YHOA 3N3GA 2YSJA 5E6JA 4BS5A 3OVZA 1NL6A 2FFWA 5JZEA 2G7YA 2P0RA 5H1TA 3KX1A 2YREA 1YVBA 3O65A 5CVMA 3LXSA 3NG2A 1JOCA 4IP3A 3O35A 4TKPB 2Y5BA 3U5PA 2HXZA 3KWBX 2E01A 3K8UA 5PADA 3D6SA 1EWMA 4PP2E 5EZSA 1A6RA 2MKEA 4W5CA 2JMDA 2JQGR 2K16A 3PHUA 4YC9A 4R2YA 3IMAA 1MHWA 3IV2A 3ZPVE 1ZIVA 8PCHA 4CDEB 3JUEA 1F2BA 4D8IA 1TLOA 4AP4A 1QXPA 2AGAA 5H1UA 1PADA 3MHHA 4UP5A 1ME3A 3N3KA 4A4CA 1U6GB 2OULA 4D8BA 2KWKA 3ZPV1 1JQPA 4CDDB 5SVIB 2F42A 4MVTA 5KH7A 2DC6A 4MZSA 4Q8GA 5J94A 2DX8A 5AIUA 1BQIA 4M0WA 2DOSA 2EODA 1DF0A 4QRGA 4LK9A 2DZYA 4LADB 3PBHA 5K16A 2E6RA 2IQJA 1WEMA 3F5VA 4XUIA 3O34A 1YALA 2ECWA 2GFOA 2VJEB 4P5OB 3QSDA 4FJCA 1S4VA 5B78A 2FRAA 3RPGC 4QH6A 2G43A 3LDYA 2AIMA 2F7DA 1WGMA 1CHCA 1WIMA 2WBFX 2G6DA 2LQ6A 3O36A 1AIMA 3L11A 2XU4A 4GB0A 4X6IA 5B77A 2M1RA 5LCWB 5FPWA 3SOWA 3EB6A 1E4UA 4YADA 3H6SA 1BP4A 3QT4A 3EB5A 2YYRA 3U5MA 2F6NA 3U5NA 1IWDA 1U9XA 4HWYA 1IYMA 4OVZB 4QF3A 3HD3A 3OF8A 1XWHA 2KFTA 1YK7A 2LXHC 1CTEA 4S3OB 2CIOA 3L1ZB 4W5BA 1K3BB 3ZNIA 3E1ZB 3KQIA 5TDRA 2CRWA 4Z0RA 1AYWA 2H7JA 2BU3A 2ATOA 2DSMA 4KLBA 2FE8A 3WXGA 5B76A 1SP4B 2ARYA 4YAXA 5B8DA 2UZGA 2DC7A 2KKYA 3N9OA 5C11A 2LRIC 1F2AA 2XOCA 2FUUA 1GECE 3PT2A 3PW3A 2G8JA 3SHBA 1K2FA 3HWNA 4RF0A 2LN0A 3M62A 2JQFR 1WEVA 3HCTA 3O0UA 3H8CA 2XU5A 3C9EA 5SVXA 5FERA 4OEMA 3IHPA 5CVNB 5B75A 4P6EA 4GNGA 2JMJA 2BTWA 4YATA 3WXEA 4N3WA 3WXFA 4XR7A 2YQLA 4WZ3B 2AU1A 3N9PA 4I04A 1M6DA 2NAAA 1PBHA 4LLBA 3H89A 2HD5A 1WEEA 2NQDB 3O70A 3LFYA 5KO3A 1N87A 3B21A 5H9MA 3KDEC 2LXPC 1VJVA 1WEQA 3P5WA 2Y1NA 4RNAA 4YBMA 4X6HA 1F62A 2QJ0A 1WEUA 3CBKA 2LGLA 4ZDTA 4AVXA 2PREA 3M99A 3PHWA 2P86A 9PAPA 2YQMA 1NLJA 2M85A 2ECVA 1VFYA 1KXRA 2EXUA 4O64A 2YJ9A 4N8WA 2H0DA 5JA7A 4CZWA 2CSVA 3GL6A 1VSNA 1ZCMA 5D1MB 4CDFB 3ZUAA 5LKZA 3PHXA 3NHEA 4K7CA 1PPOA 4BS6A 5C13A 2VJFA 2L5UA 3MHSA 5G0FA 1DKIA 4BOQA 1WILA 2KU3A 1CVZA 3BC3A 1GLOA 1FH0A 1MBMA 1NPZA 1EWPA 1CPJA 3T6RA 1UKFA 2FSAA 2IPPB 4BOSA 5EF4A 1U5IA 2CKLA 3HCUA 1AYVA 3CH2X 2KWJA 2AUXA 3MP2A 3ZNHA 4I7CA 5LKTA 2F1GA 2PBHA 3USVA 2R9CA 5CHVA 1POPA 2RI7A 1ME4A 1EWOA 2VPDA 1V87A 2Y1MA 1FBVA 4YYRA 3TMPA 1TL9A 2YSMA 1ATKA 3KNVA 1BORA 1QMYA 2DCDA 1MEGA 2ECIA 5TDWA 4BOZA 2CT2A 2BDLA 1AU0A 2Z84A 3PSEA 4RF1A 2L75A 3SOUA 2HH5A 4R3DA 3E2DA 1CV8A 2M3HA 3L1XA 2M13A 4V3LC 4X6JA 3TRKA 4YYSA 2FTDA 4BSQA 4OW0A 1PVJA 2E6SA 3KWZA 4AUQB 3O33A 1KHPA 2P7UA 2Y6EA 2MD8C 3MTNA 1X4JA 1WEPA 2B1MA 3FM8C 2K1JA 1MEMA 3H7DA 2E61A 2DCBA 3BWKA 4P16A 4XZXA 2JMIA 4BBQA 2M6MA 2DC9A 5FB1A 3HTKC 2XEUA 4B7YC 3I2DA 4A49A 2JRJA 2NQIA 3QZVA 1CB5A 2HHNA 2BTWB 2BAYA 3OQCA 4RY2A 2LGVA 2G8EA 2E03A 4PT5A 3LQHA 3BPMA 3S3QA 3FL2A 2XU1A 2DCAA 2R9MA 4QRVA 2C2LA 4YBTA 2YVRA 1TU6A 4WURA 2DCCA 1Y4HA 1YK8A 3IOQA 3I06A 1CSBB 4REZA 5EGWA 4MZOA 2G45A 3SOXA 2R6NA 3N9LA 2H0DB 1F2CA 2BDZA 3E9SA 3HHAA 1PXVA 3SUBA 1DEUA 1QOLA 1X9YA 1Y08A 3KW9A 3HHIA 2KWNA 3K9MA 4NN2A 1JM7A 2EGMA 2AS8A 2VPBA 2AVWA 2R9OA 5SVIA 2J7QA 4A5UA 2IBIA 2ACTA 4PPEA 1T1HA 2L0BA 1EF7A 3IEJA 4I07A 4MM3B 1EWLA 3O1GA 1U9QX 2PNSA 3ASLA 2B0OE 2ECGA 2EGPA 2K17A 3BY4A 2CKLB 1X4UA 1WEOA 3VK6A 2KWOA 2VHFA 4N4ZA 2MUMA 1U9VA 3MORA 1NQCA 2HYED 1WENA
chains in the Genus database with same CATH topology
4AXMA 1PPPA 2VJEA 1LDJB 2VNFA 1PPDA 5TABA 3N9QA 3BCNA 3GCBA 2G6QA 3V43A 1MM2A 1GCBA 4QBBA 1MS6A 1STFE 1W5RA 1QDQA 4YYUA 3O7AA 1AYUA 3F75A 5CVOB 3M63A 4GNFA 3RPGB 2OP3A 2VP7A 3O37A 2LDRA 4IC3A 4MSXA 5DINA 2KE1A 5JG6A 2DZZA 2LGKA 1Z6UA 4X3GA 2ECJA 2F6JA 3V6CA 4R8PK 1FP0A 2ZETC 1XKGA 4W4UA 2R9FA 1KFXL 1W6FA 2AYNA 3KFQA 2ECTA 5FB0A 2KIZA 4GNEA 1VYXA 5J3XA 5B79A 2YJ8A 2OXQC 5CHTA 2LGGA 5D1KB 4FO9A 2B1NA 2VHSA 2L43A 5KH3A 3DQVR 2YHNA 1DVPA 4R7EA 4PTBA 4ZQLA 1BGOA 3IUTA 5DKAA 3ZYQA 1ZBDB 4AYCA 2I50A 1AU4A 2DJFB 4BHWA 2C2VS 4S3OC 3RVXA 1BY8A 4IC2A 2VPGA 3RVWA 2O6XA 3P5UA 3CH3X 2XB1A 4CA1A 3V6EA 2YURA 1WESA 2YUCA 4L7XA 2Y43A 3TNXA 5AITA 4G54A 2MA5A 3HCSA 2CSZA 3ZVZB 1F29A 1GX3A 4WZ2A 2KREA 6PADA 2L80A 2RSDA 2YW8A 4WA6A 3QJ3A 2VPEA 4OELA 5TBNA 3S3RA 2YJCA 4PI3A 1HYIA 3GV4A 1JM7B 3PURA 4L58A 1KFUL 2E00A 3C5KA 4XI1A 2CB5A 3KV6A 2OZ2A 3C6WA 4YV8A 4V3KC 3OISA 5I3LA 5JH3A 4C9ZA 4BPVA 2FT2A 5H1VA 4F52B 4I7DA 2FRQA 1LDKC 3PUQA 4UP0A 4QRXA 1GMYA 2AYOA 2QIZA 2HYED 5D1LB 4P6GA 4YABA 5A24A 3LRQA 2XU3A 1PCIA 3RVVA 2PADA 1WEWA 4BGFA 4LJNA 3B79A 2MNZA 1ICFA 4A0CD 2R9NA 1WFKA 2CSYA 3PDFA 1MM3A 2QICA 3ZTGA 5KH9A 1AU3A 1U9WA 2KR4A 1VD4A 2HDPA 4WZ0A 2AUZA 5G05B 3LQJA 2D8SA 2NQGA 1MIRA 2FUIA 4YBSA 1PPNA 3P5XA 3DPLR 4FK5A 3AI8A 2KYUA 4NV7A 1Z2QA 2YJBA 4PP1A 1ITOA 3LTWA 3ERVA 1O0EA 2AN6A 4N4FA 3N9NA 1WE9A 5TRBA 2E02A 2FO5A 3OVXA 4Q8HA 1NB3A 2VJFB 3P5VA 1X4IA 2DJGB 4CDCB 3DF0A 1CJLA 1RMDA 3BPFA 1KHQA 5FEYA 3U5OA 3D9WA 3K24A 1AU2A 2MIQA 2MT5A 2C0YA 4YYQA 7PCKA 5F02A 4PADA 4FIPA 1G25A 1NB5A 2K4DA 4I05A 4DMXA 2NQAA 3N4CA 1MDWA 1Q6KA 3T7LA 4CCGX 2IDAA 4YYWA 4UI9B 1SNKA 4B86C 3OF9A 1W4TA 3PNRA 2YU4A 3BOWA 1PIPA 3KKUA 4YYVA 4AYCB 1YT7A 2DC8A 5EYAF 2FUDA 3I3TA 3ZVYA 4ZUXU 1HYJA 3U8EA 2PUYA 4QF2A 3H8BA 5LKXA 3CBJA 4BQVA 1PE6A 2EA6A 2GHUA 2YT5A 4A4BA 4Q6FA 4DMYA 2KGIA 2ECNA 4GNDA 5LKUA 4YVAA 2MD7B 4I7BA 2FYEA 2LV9A 3KSEA 4AXLA 1Z60A 3RTRB 3PHDA 2FQ9A 3KV5A 5G04B 2YJ2A 1HUCB 1CS8A 2KGGA 2MNYA 2PNXA 3LQIA 2MA6A 4N79A 1CQDA 1THEA 3N9MA 4LKAA 1AECA 2YHOA 3N3GA 2YSJA 4BS5A 3OVZA 1NL6A 2G7YA 2P0RA 5H1TA 3KX1A 2YREA 1YVBA 5CVMA 3LXSA 3NG2A 1JOCA 3O35A 4TKPB 2Y5BA 3U5PA 2HXZA 3KWBX 2E01A 3K8UA 5PADA 3D6SA 1EWMA 4PP2E 1A6RA 4W5CA 2JMDA 2JQGR 2K16A 4YC9A 4R2YA 3IMAA 1MHWA 3IV2A 3ZPVE 1ZIVA 8PCHA 4CDEB 1F2BA 1TLOA 4AP4A 1QXPA 5H1UA 1PADA 3MHHA 4UP5A 1ME3A 3N3KA 4A4CA 1U6GB 2OULA 2KWKA 3ZPV1 1JQPA 4CDDB 2F42A 4MVTA 5KH7A 2DC6A 4MZSA 4Q8GA 5J94A 2DX8A 5AIUA 1BQIA 2EODA 1DF0A 4QRGA 4LK9A 2DZYA 4LADB 3PBHA 5K16A 2E6RA 1WEMA 3F5VA 4XUIA 3O34A 1YALA 2ECWA 2GFOA 2VJEB 4P5OB 3QSDA 4FJCA 4C5PA 1S4VA 5B78A 2FRAA 3RPGC 4QH6A 2G43A 2AIMA 2F7DA 1WGMA 1CHCA 1WIMA 2WBFX 2G6DA 2LQ6A 3O36A 1AIMA 3L11A 2XU4A 4GB0A 4X6IA 5B77A 2M1RA 5LCWB 5FPWA 3SOWA 3EB6A 1E4UA 4YADA 3H6SA 1BP4A 3QT4A 3EB5A 2YYRA 3U5MA 2F6NA 3U5NA 1IWDA 1U9XA 4HWYA 1IYMA 4QF3A 3HD3A 3OF8A 1XWHA 1E2TA 2KFTA 1YK7A 2LXHC 1CTEA 4S3OB 2CIOA 3L1ZB 4W5BA 1K3BB 3ZNIA 3E1ZB 3KQIA 5TDRA 4B55A 1AYWA 2H7JA 2ATOA 4KLBA 3WXGA 5B76A 1SP4B 2ARYA 4YAXA 5B8DA 2UZGA 2DC7A 3N9OA 5C11A 2LRIC 1F2AA 1GECE 2FUUA 3PW3A 2G8JA 3SHBA 1K2FA 3HWNA 2LN0A 3M62A 2JQFR 1WEVA 3HCTA 3O0UA 3H8CA 2XU5A 3C9EA 4OEMA 5FERA 3IHPA 5CVNB 5B75A 4P6EA 4GNGA 2JMJA 4YATA 3WXEA 4N3WA 3WXFA 4XR7A 2YQLA 4WZ3B 2AU1A 3N9PA 4I04A 1M6DA 2NAAA 1PBHA 4LLBA 3H89A 2HD5A 1WEEA 2NQDB 3O70A 3LFYA 1N87A 5H9MA 1VJVA 2LXPC 4X6HA 1WEQA 3P5WA 2Y1NA 4YBMA 1F62A 2QJ0A 3CBKA 2LGLA 4ZDTA 4AVXA 2PREA 3M99A 2P86A 9PAPA 2YQMA 1NLJA 2M85A 2ECVA 1VFYA 1KXRA 4O64A 2YJ9A 4N8WA 2H0DA 4NV8A 5JA7A 4CZWA 3GL6A 1VSNA 1ZCMA 5D1MB 4CDFB 3ZUAA 5LKZA 3NHEA 4K7CA 1PPOA 4BS6A 5C13A 2VJFA 2L5UA 3MHSA 5G0FA 1WILA 2KU3A 1CVZA 3BC3A 1GLOA 1FH0A 1NPZA 1EWPA 1CPJA 3T6RA 2FSAA 2IPPB 5EF4A 1U5IA 2CKLA 3HCUA 1AYVA 3CH2X 2KWJA 2AUXA 4I7CA 5LKTA 2F1GA 2PBHA 3USVA 2R9CA 5CHVA 1POPA 2RI7A 1ME4A 1EWOA 2VPDA 1V87A 2Y1MA 1FBVA 4YYRA 1TL9A 2YSMA 1ATKA 3KNVA 1BORA 1QMYA 2DCDA 1MEGA 2ECIA 5TDWA 2CT2A 2BDLA 1AU0A 2L75A 3SOUA 2HH5A 1CV8A 2M3HA 3L1XA 4GUZA 4V3LC 4X6JA 4YYSA 2FTDA 4BSQA 2E6SA 3KWZA 4AUQB 3O33A 1KHPA 2P7UA 2Y6EA 2MD8C 3MTNA 1X4JA 1WEPA 2B1MA 3H7DA 2K1JA 1MEMA 2DCBA 3BWKA 2BSZA 2JMIA 4BBQA 2M6MA 2DC9A 5FB1A 3HTKC 2XEUA 4B7YC 3I2DA 4A49A 2JRJA 2NQIA 3QZVA 1CB5A 2HHNA 2BAYA 4RY2A 2LGVA 2G8EA 2E03A 3LQHA 3BPMA 3S3QA 3FL2A 2XU1A 2DCAA 2R9MA 4QRVA 2C2LA 4YBTA 1TU6A 2VFBA 2DCCA 1Y4HA 1YK8A 3IOQA 3I06A 1CSBB 5EGWA 4MZOA 2G45A 3SOXA 2R6NA 3N9LA 2H0DB 1F2CA 2BDZA 3HHAA 1PXVA 1QOLA 1DEUA 1X9YA 1Y08A 3KW9A 3HHIA 2KWNA 3K9MA 4NN2A 1JM7A 2AS8A 2VFCA 2VPBA 2AVWA 2R9OA 2IBIA 2ACTA 4PPEA 1T1HA 2L0BA 1EF7A 3IEJA 4I07A 1EWLA 3O1GA 1U9QX 2PNSA 3ASLA 2ECGA 2EGPA 2K17A 2CKLB 1X4UA 1WEOA 3VK6A 2KWOA 2VHFA 4N4ZA 2MUMA 1U9VA 3MORA 1NQCA 1WEUA 1WENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AXM A;  1PPP A;  2VJE A;  1LDJ B;  2VNF A;  1PPD A;  5TAB A;  3N9Q A;  3BCN A;  3GCB A;  2G6Q A;  3V43 A;  1MM2 A;  1GCB A;  4QBB A;  1MS6 A;  1STF E;  4YYU A;  1QDQ A;  3O7A A;  1AYU A;  3F75 A;  5CVO B;  3M63 A;  4GNF A;  3RPG B;  2OP3 A;  2VP7 A;  3O37 A;  2LDR A;  4IC3 A;  4MSX A;  5DIN A;  2KE1 A;  5JG6 A;  2DZZ A;  2LGK A;  1Z6U A;  4X3G A;  2ECJ A;  2F6J A;  3V6C A;  4R8P K;  1FP0 A;  2ZET C;  1XKG A;  4W4U A;  2R9F A;  1KFX L;  2AYN A;  3KFQ A;  2ECT A;  5FB0 A;  2KIZ A;  4GNE A;  1VYX A;  5J3X A;  5B79 A;  2YJ8 A;  2OXQ C;  5CHT A;  2LGG A;  5D1K B;  4FO9 A;  2B1N A;  2VHS A;  2L43 A;  5KH3 A;  3DQV R;  2YHN A;  1DVP A;  4R7E A;  4PTB A;  4ZQL A;  1BGO A;  3IUT A;  5DKA A;  3ZYQ A;  1ZBD B;  4AYC A;  2I50 A;  1AU4 A;  2DJF B;  4BHW A;  2C2V S;  4S3O C;  3RVX A;  1BY8 A;  4IC2 A;  2VPG A;  3RVW A;  2O6X A;  3P5U A;  3CH3 X;  2XB1 A;  4CA1 A;  3V6E A;  2YUR A;  1WES A;  2YUC A;  4L7X A;  2Y43 A;  3TNX A;  5AIT A;  4G54 A;  2MA5 A;  3HCS A;  2CSZ A;  3ZVZ B;  1F29 A;  4WZ2 A;  2KRE A;  6PAD A;  2L80 A;  2RSD A;  2YW8 A;  4WA6 A;  3QJ3 A;  2VPE A;  4OEL A;  5TBN A;  3S3R A;  2YJC A;  4PI3 A;  1HYI A;  3GV4 A;  1JM7 B;  3PUR A;  4L58 A;  1KFU L;  2E00 A;  3C5K A;  4XI1 A;  2CB5 A;  3KV6 A;  2OZ2 A;  3C6W A;  4YV8 A;  4V3K C;  3OIS A;  5I3L A;  5JH3 A;  4C9Z A;  4BPV A;  2FT2 A;  5H1V A;  4F52 B;  4I7D A;  2FRQ A;  1LDK C;  3PUQ A;  4UP0 A;  4QRX A;  1GMY A;  2AYO A;  2QIZ A;  2HYE D;  5D1L B;  4P6G A;  4YAB A;  5A24 A;  3LRQ A;  2XU3 A;  1PCI A;  3RVV A;  2PAD A;  1WEW A;  4LJN A;  3B79 A;  2MNZ A;  1ICF A;  4A0C D;  2R9N A;  1WFK A;  2CSY A;  3PDF A;  1MM3 A;  2QIC A;  3ZTG A;  5KH9 A;  1AU3 A;  1U9W A;  2KR4 A;  1VD4 A;  2HDP A;  4WZ0 A;  2AUZ A;  5G05 B;  3LQJ A;  2D8S A;  2NQG A;  1MIR A;  2FUI A;  4YBS A;  1PPN A;  3P5X A;  3DPL R;  4FK5 A;  3AI8 A;  2KYU A;  1Z2Q A;  2YJB A;  4PP1 A;  1ITO A;  3ERV A;  1O0E A;  2AN6 A;  4N4F A;  3N9N A;  1WE9 A;  5TRB A;  2E02 A;  2FO5 A;  3OVX A;  4Q8H A;  1NB3 A;  2VJF B;  3P5V A;  1X4I A;  2DJG B;  4CDC B;  3DF0 A;  1CJL A;  1RMD A;  3BPF A;  1KHQ A;  5FEY A;  3U5O A;  3K24 A;  1AU2 A;  2MIQ A;  2MT5 A;  2C0Y A;  4YYQ A;  7PCK A;  5F02 A;  4PAD A;  4FIP A;  1G25 A;  1NB5 A;  2K4D A;  4I05 A;  4DMX A;  2NQA A;  3N4C A;  1MDW A;  1Q6K A;  3T7L A;  4CCG X;  2IDA A;  4YYW A;  4UI9 B;  1SNK A;  4B86 C;  3OF9 A;  3PNR A;  2YU4 A;  3BOW A;  1PIP A;  3KKU A;  4YYV A;  4AYC B;  1YT7 A;  2DC8 A;  5EYA F;  2FUD A;  3I3T A;  3ZVY A;  4ZUX U;  1HYJ A;  3U8E A;  2PUY A;  4QF2 A;  3H8B A;  5LKX A;  3CBJ A;  4BQV A;  1PE6 A;  2EA6 A;  2GHU A;  2YT5 A;  4A4B A;  4Q6F A;  4DMY A;  2KGI A;  2ECN A;  4GND A;  5LKU A;  4YVA A;  2MD7 B;  4I7B A;  2FYE A;  2LV9 A;  3KSE A;  4AXL A;  1Z60 A;  3RTR B;  3PHD A;  2FQ9 A;  3KV5 A;  5G04 B;  2YJ2 A;  1HUC B;  1CS8 A;  2KGG A;  2MNY A;  2PNX A;  3LQI A;  2MA6 A;  4N79 A;  1CQD A;  1THE A;  3N9M A;  4LKA A;  1AEC A;  2YHO A;  3N3G A;  2YSJ A;  4BS5 A;  3OVZ A;  1NL6 A;  2G7Y A;  2P0R A;  5H1T A;  3KX1 A;  2YRE A;  1YVB A;  5CVM A;  3LXS A;  3NG2 A;  1JOC A;  3O35 A;  4TKP B;  2Y5B A;  3U5P A;  2HXZ A;  3KWB X;  2E01 A;  3K8U A;  5PAD A;  3D6S A;  1EWM A;  4PP2 E;  1A6R A;  4W5C A;  2JMD A;  2JQG R;  2K16 A;  4YC9 A;  4R2Y A;  3IMA A;  1MHW A;  3IV2 A;  3ZPV E;  1ZIV A;  8PCH A;  4CDE B;  1F2B A;  1TLO A;  4AP4 A;  1QXP A;  5H1U A;  1PAD A;  3MHH A;  4UP5 A;  1ME3 A;  3N3K A;  4A4C A;  1U6G B;  2OUL A;  2KWK A;  3ZPV 1;  1JQP A;  4CDD B;  2F42 A;  4MVT A;  5KH7 A;  2DC6 A;  4MZS A;  4Q8G A;  5J94 A;  2DX8 A;  5AIU A;  1BQI A;  2EOD A;  1DF0 A;  4QRG A;  4LK9 A;  2DZY A;  4LAD B;  3PBH A;  5K16 A;  2E6R A;  1WEM A;  3F5V A;  4XUI A;  3O34 A;  1YAL A;  2ECW A;  2GFO A;  2VJE B;  4P5O B;  3QSD A;  4FJC A;  1S4V A;  5B78 A;  2FRA A;  3RPG C;  4QH6 A;  2G43 A;  2AIM A;  2F7D A;  1WGM A;  1CHC A;  1WIM A;  2WBF X;  2G6D A;  2LQ6 A;  3O36 A;  1AIM A;  3L11 A;  2XU4 A;  4GB0 A;  4X6I A;  5B77 A;  2M1R A;  5LCW B;  5FPW A;  3SOW A;  3EB6 A;  1E4U A;  4YAD A;  3H6S A;  1BP4 A;  3QT4 A;  3EB5 A;  2YYR A;  3U5M A;  2F6N A;  3U5N A;  1IWD A;  1U9X A;  4HWY A;  1IYM A;  4QF3 A;  3HD3 A;  3OF8 A;  1XWH A;  2KFT A;  1YK7 A;  2LXH C;  1CTE A;  4S3O B;  2CIO A;  3L1Z B;  4W5B A;  1K3B B;  3ZNI A;  3E1Z B;  3KQI A;  5TDR A;  1AYW A;  2H7J A;  2ATO A;  4KLB A;  3WXG A;  5B76 A;  1SP4 B;  2ARY A;  4YAX A;  5B8D A;  2UZG A;  2DC7 A;  3N9O A;  5C11 A;  2LRI C;  1F2A A;  1GEC E;  2FUU A;  3PW3 A;  2G8J A;  3SHB A;  1K2F A;  3HWN A;  2LN0 A;  3M62 A;  2JQF R;  1WEV A;  3HCT A;  3O0U A;  3H8C A;  2XU5 A;  3C9E A;  4OEM A;  5FER A;  3IHP A;  5CVN B;  5B75 A;  4P6E A;  4GNG A;  2JMJ A;  4YAT A;  3WXE A;  4N3W A;  3WXF A;  4XR7 A;  2YQL A;  4WZ3 B;  2AU1 A;  3N9P A;  4I04 A;  1M6D A;  2NAA A;  1PBH A;  4LLB A;  3H89 A;  2HD5 A;  1WEE A;  2NQD B;  3O70 A;  3LFY A;  1N87 A;  5H9M A;  1VJV A;  2LXP C;  4X6H A;  1WEQ A;  3P5W A;  2Y1N A;  4YBM A;  1F62 A;  2QJ0 A;  3CBK A;  2LGL A;  4ZDT A;  4AVX A;  2PRE A;  3M99 A;  2P86 A;  9PAP A;  2YQM A;  1NLJ A;  2M85 A;  2ECV A;  1VFY A;  1KXR A;  4O64 A;  2YJ9 A;  4N8W A;  2H0D A;  5JA7 A;  4CZW A;  3GL6 A;  1VSN A;  1ZCM A;  5D1M B;  4CDF B;  3ZUA A;  5LKZ A;  3NHE A;  4K7C A;  1PPO A;  4BS6 A;  5C13 A;  2VJF A;  2L5U A;  3MHS A;  5G0F A;  1WIL A;  2KU3 A;  1CVZ A;  3BC3 A;  1GLO A;  1FH0 A;  1NPZ A;  1EWP A;  1CPJ A;  3T6R A;  2FSA A;  2IPP B;  5EF4 A;  1U5I A;  2CKL A;  3HCU A;  1AYV A;  3CH2 X;  2KWJ A;  2AUX A;  4I7C A;  5LKT A;  2F1G A;  2PBH A;  3USV A;  2R9C A;  5CHV A;  1POP A;  2RI7 A;  1ME4 A;  1EWO A;  2VPD A;  1V87 A;  2Y1M A;  1FBV A;  4YYR A;  1TL9 A;  2YSM A;  1ATK A;  3KNV A;  1BOR A;  1QMY A;  2DCD A;  1MEG A;  2ECI A;  5TDW A;  2CT2 A;  2BDL A;  1AU0 A;  2L75 A;  3SOU A;  2HH5 A;  1CV8 A;  2M3H A;  3L1X A;  4V3L C;  4X6J A;  4YYS A;  2FTD A;  4BSQ A;  2E6S A;  3KWZ A;  4AUQ B;  3O33 A;  1KHP A;  2P7U A;  2Y6E A;  2MD8 C;  3MTN A;  1X4J A;  1WEP A;  2B1M A;  3H7D A;  2K1J A;  1MEM A;  2DCB A;  3BWK A;  2JMI A;  4BBQ A;  2M6M A;  2DC9 A;  5FB1 A;  3HTK C;  2XEU A;  4B7Y C;  3I2D A;  4A49 A;  2JRJ A;  2NQI A;  3QZV A;  1CB5 A;  2HHN A;  2BAY A;  4RY2 A;  2LGV A;  2G8E A;  2E03 A;  3LQH A;  3BPM A;  3S3Q A;  3FL2 A;  2XU1 A;  2DCA A;  2R9M A;  4QRV A;  2C2L A;  4YBT A;  1TU6 A;  2DCC A;  1Y4H A;  1YK8 A;  3IOQ A;  3I06 A;  1CSB B;  5EGW A;  4MZO A;  2G45 A;  3SOX A;  2R6N A;  3N9L A;  2H0D B;  1F2C A;  2BDZ A;  3HHA A;  1PXV A;  1QOL A;  1DEU A;  1X9Y A;  1Y08 A;  3KW9 A;  3HHI A;  2KWN A;  3K9M A;  4NN2 A;  1JM7 A;  2AS8 A;  2VPB A;  2AVW A;  2R9O A;  2IBI A;  2ACT A;  4PPE A;  1T1H A;  2L0B A;  1EF7 A;  3IEJ A;  4I07 A;  1EWL A;  3O1G A;  1U9Q X;  2PNS A;  3ASL A;  2ECG A;  2EGP A;  2K17 A;  2CKL B;  1X4U A;  1WEO A;  3VK6 A;  2KWO A;  2VHF A;  4N4Z A;  2MUM A;  1U9V A;  3MOR A;  1NQC A;  1WEU A;  1WEN A; 
#chains in the Genus database with same CATH topology
 4AXM A;  1PPP A;  2VJE A;  1LDJ B;  2VNF A;  1PPD A;  5TAB A;  3N9Q A;  2J7Q C;  3BCN A;  3GCB A;  2G6Q A;  1DCQ A;  3V43 A;  1MM2 A;  1GCB A;  4ZTB A;  4HXD B;  4QBB A;  1MS6 A;  1STF E;  4YYU A;  1QDQ A;  3O7A A;  1AYU A;  3F75 A;  5CVO B;  3M63 A;  4GNF A;  3RPG B;  2OP3 A;  2OWA A;  2VP7 A;  2L7P A;  3O37 A;  2LDR A;  4IC3 A;  4MSX A;  5DIN A;  3W31 A;  2KE1 A;  5JG6 A;  2DZZ A;  2LGK A;  2HWK A;  3FAO A;  1Z6U A;  4X3G A;  2ECJ A;  4IUM A;  2F6J A;  3V6C A;  4R8P K;  5K3Q A;  1FP0 A;  2ZET C;  1XKG A;  4W4U A;  2R9F A;  2UZJ A;  4Z0O A;  1KFX L;  2AYN A;  4BOP A;  3KFQ A;  2ECT A;  2FD4 A;  4F1P A;  5FB0 A;  2KIZ A;  4GNE A;  1VYX A;  2CRR A;  5J3X A;  5B79 A;  2YJ8 A;  2OXQ C;  5CHT A;  2LGG A;  3PLW A;  4FO9 A;  5D1K B;  2B1N A;  4OGC A;  3W30 A;  2VHS A;  2L43 A;  5KH3 A;  3DQV R;  2YHN A;  1DVP A;  4R7E A;  4PTB A;  4ZQL A;  1BGO A;  3IUT A;  5DKA A;  3ZYQ A;  4O62 A;  1ZBD B;  4AYC A;  2I50 A;  1AU4 A;  2DJF B;  4BHW A;  4RKX A;  2C2V S;  4S3O C;  3RVX A;  3DDT A;  1BY8 A;  3H7H A;  3PRP A;  4IC2 A;  2VPG A;  3RVW A;  2O6X A;  3P5U A;  4D8E A;  3CH3 X;  2XB1 A;  4CA1 A;  3V6E A;  4BOU A;  2YUR A;  1WES A;  2YUC A;  4L7X A;  2Y43 A;  3TNX A;  5AIT A;  3Q1D A;  4G54 A;  2MA5 A;  3HCS A;  2CSZ A;  3ZVZ B;  1F29 A;  4WZ2 A;  2KRE A;  6PAD A;  2L80 A;  2RSD A;  2YW8 A;  4WA6 A;  3QJ3 A;  2VPE A;  4OEL A;  3DWD A;  5TBN A;  3S3R A;  2YJC A;  4PI3 A;  1HYI A;  3GV4 A;  2P57 A;  1JM7 B;  3PUR A;  4L58 A;  1KFU L;  2E00 A;  2XOZ A;  3C5K A;  4XI1 A;  2CB5 A;  3KV6 A;  2JTC A;  3C6W A;  2OZ2 A;  4YV8 A;  4V3K C;  3MDB C;  3OIS A;  3C0R A;  3BB7 A;  5I3L A;  5JH3 A;  3RNV A;  4C9Z A;  3LVR E;  4BPV A;  2FT2 A;  5H1V A;  4F52 B;  4I7D A;  2FRQ A;  1LDK C;  3PUQ A;  4UP0 A;  4QRX A;  1GMY A;  2AYO A;  2QIZ A;  5D1L B;  4P6G A;  4YAB A;  4H9D A;  5A24 A;  3LRQ A;  2XU3 A;  4MI7 A;  1PCI A;  2XOY A;  3RVV A;  2RR4 A;  2PAD A;  1WEW A;  4LJN A;  3B79 A;  2MNZ A;  1ICF A;  4A0C D;  2R9N A;  1WFK A;  2CSY A;  3PDF A;  1MM3 A;  2QIC A;  3ZTG A;  3MTV A;  5KH9 A;  1AU3 A;  1U9W A;  2KR4 A;  1VD4 A;  3LVQ E;  2HDP A;  4WZ0 A;  2AUZ A;  5G05 B;  3LQJ A;  3MJ5 A;  2DJA A;  2D8S A;  2NQG A;  1MIR A;  2XP0 A;  2FUI A;  4YBS A;  1PPN A;  3P5X A;  3DPL R;  4FK5 A;  3AI8 A;  2KYU A;  1Z2Q A;  2YJB A;  4PP1 A;  1ITO A;  3ERV A;  3IFU A;  1O0E A;  2AN6 A;  4N4F A;  3N9N A;  1WE9 A;  5TRB A;  5SVY A;  2E02 A;  2FO5 A;  3OVX A;  4Q8H A;  1NB3 A;  2VJF B;  3P5V A;  2JUN A;  1X4I A;  2DJG B;  4CDC B;  3DF0 A;  1CJL A;  1RMD A;  3BPF A;  1KHQ A;  5FEY A;  3U5O A;  3K24 A;  1AU2 A;  2MIQ A;  2MT5 A;  2C0Y A;  4YYQ A;  7PCK A;  5F02 A;  4PAD A;  4FIP A;  1G25 A;  1NB5 A;  2K4D A;  4I05 A;  4DMX A;  2NQA A;  3N4C A;  1MDW A;  1Q6K A;  3T7L A;  4CCG X;  2JRI A;  2IDA A;  4YYW A;  4UI9 B;  1SNK A;  2JM3 A;  4B86 C;  3OF9 A;  3PNR A;  2YU4 A;  3BOW A;  1PIP A;  3KKU A;  4YYV A;  4AYC B;  1YT7 A;  2DC8 A;  5EYA F;  3BBA A;  2FUD A;  3I3T A;  3T9K A;  3ZVY A;  1YZB A;  2KKX A;  4ZUX U;  1HYJ A;  3U8E A;  2PUY A;  4QF2 A;  3H8B A;  3PRM A;  5LKX A;  3CBJ A;  4BQV A;  3M7K A;  1PE6 A;  2EA6 A;  2GHU A;  4GUA A;  2YT5 A;  4A4B A;  4OGE A;  3FJU B;  4Q6F A;  4DMY A;  2KGI A;  2ECN A;  3FEH A;  4GND A;  5LKU A;  4OVZ A;  4YVA A;  2MD7 B;  4I7B A;  2FYE A;  2LV9 A;  3KSE A;  4AXL A;  3FAN A;  1Z60 A;  3RTR B;  3PHD A;  2FQ9 A;  2LAU A;  3KV5 A;  5G04 B;  2YJ2 A;  1HUC B;  1CS8 A;  2KGG A;  2MNY A;  2PNX A;  3LQI A;  2MA6 A;  3LJU X;  5EZQ A;  4N79 A;  3O47 A;  4QQ4 A;  1CQD A;  1THE A;  3N9M A;  4LKA A;  2D8U A;  2CON A;  1AEC A;  2YHO A;  3N3G A;  2YSJ A;  5E6J A;  4BS5 A;  3OVZ A;  1NL6 A;  2FFW A;  5JZE A;  2G7Y A;  2P0R A;  5H1T A;  3KX1 A;  2YRE A;  1YVB A;  3O65 A;  5CVM A;  3LXS A;  3NG2 A;  1JOC A;  4IP3 A;  3O35 A;  4TKP B;  2Y5B A;  3U5P A;  2HXZ A;  3KWB X;  2E01 A;  3K8U A;  5PAD A;  3D6S A;  1EWM A;  4PP2 E;  5EZS A;  1A6R A;  2MKE A;  4W5C A;  2JMD A;  2JQG R;  2K16 A;  3PHU A;  4YC9 A;  4R2Y A;  3IMA A;  1MHW A;  3IV2 A;  3ZPV E;  1ZIV A;  8PCH A;  4CDE B;  3JUE A;  1F2B A;  4D8I A;  1TLO A;  4AP4 A;  1QXP A;  2AGA A;  5H1U A;  1PAD A;  3MHH A;  4UP5 A;  1ME3 A;  3N3K A;  4A4C A;  1U6G B;  2OUL A;  4D8B A;  2KWK A;  3ZPV 1;  1JQP A;  4CDD B;  5SVI B;  2F42 A;  4MVT A;  5KH7 A;  2DC6 A;  4MZS A;  4Q8G A;  5J94 A;  2DX8 A;  5AIU A;  1BQI A;  4M0W A;  2DOS A;  2EOD A;  1DF0 A;  4QRG A;  4LK9 A;  2DZY A;  4LAD B;  3PBH A;  5K16 A;  2E6R A;  2IQJ A;  1WEM A;  3F5V A;  4XUI A;  3O34 A;  1YAL A;  2ECW A;  2GFO A;  2VJE B;  4P5O B;  3QSD A;  4FJC A;  1S4V A;  5B78 A;  2FRA A;  3RPG C;  4QH6 A;  2G43 A;  3LDY A;  2AIM A;  2F7D A;  1WGM A;  1CHC A;  1WIM A;  2WBF X;  2G6D A;  2LQ6 A;  3O36 A;  1AIM A;  3L11 A;  2XU4 A;  4GB0 A;  4X6I A;  5B77 A;  2M1R A;  5LCW B;  5FPW A;  3SOW A;  3EB6 A;  1E4U A;  4YAD A;  3H6S A;  1BP4 A;  3QT4 A;  3EB5 A;  2YYR A;  3U5M A;  2F6N A;  3U5N A;  1IWD A;  1U9X A;  4HWY A;  1IYM A;  4OVZ B;  4QF3 A;  3HD3 A;  3OF8 A;  1XWH A;  2KFT A;  1YK7 A;  2LXH C;  1CTE A;  4S3O B;  2CIO A;  3L1Z B;  4W5B A;  1K3B B;  3ZNI A;  3E1Z B;  3KQI A;  5TDR A;  2CRW A;  4Z0R A;  1AYW A;  2H7J A;  2BU3 A;  2ATO A;  2DSM A;  4KLB A;  2FE8 A;  3WXG A;  5B76 A;  1SP4 B;  2ARY A;  4YAX A;  5B8D A;  2UZG A;  2DC7 A;  2KKY A;  3N9O A;  5C11 A;  2LRI C;  1F2A A;  2XOC A;  2FUU A;  1GEC E;  3PT2 A;  3PW3 A;  2G8J A;  3SHB A;  1K2F A;  3HWN A;  4RF0 A;  2LN0 A;  3M62 A;  2JQF R;  1WEV A;  3HCT A;  3O0U A;  3H8C A;  2XU5 A;  3C9E A;  5SVX A;  5FER A;  4OEM A;  3IHP A;  5CVN B;  5B75 A;  4P6E A;  4GNG A;  2JMJ A;  2BTW A;  4YAT A;  3WXE A;  4N3W A;  3WXF A;  4XR7 A;  2YQL A;  4WZ3 B;  2AU1 A;  3N9P A;  4I04 A;  1M6D A;  2NAA A;  1PBH A;  4LLB A;  3H89 A;  2HD5 A;  1WEE A;  2NQD B;  3O70 A;  3LFY A;  5KO3 A;  1N87 A;  3B21 A;  5H9M A;  3KDE C;  2LXP C;  1VJV A;  1WEQ A;  3P5W A;  2Y1N A;  4RNA A;  4YBM A;  4X6H A;  1F62 A;  2QJ0 A;  1WEU A;  3CBK A;  2LGL A;  4ZDT A;  4AVX A;  2PRE A;  3M99 A;  3PHW A;  2P86 A;  9PAP A;  2YQM A;  1NLJ A;  2M85 A;  2ECV A;  1VFY A;  1KXR A;  2EXU A;  4O64 A;  2YJ9 A;  4N8W A;  2H0D A;  5JA7 A;  4CZW A;  2CSV A;  3GL6 A;  1VSN A;  1ZCM A;  5D1M B;  4CDF B;  3ZUA A;  5LKZ A;  3PHX A;  3NHE A;  4K7C A;  1PPO A;  4BS6 A;  5C13 A;  2VJF A;  2L5U A;  3MHS A;  5G0F A;  1DKI A;  4BOQ A;  1WIL A;  2KU3 A;  1CVZ A;  3BC3 A;  1GLO A;  1FH0 A;  1MBM A;  1NPZ A;  1EWP A;  1CPJ A;  3T6R A;  1UKF A;  2FSA A;  2IPP B;  4BOS A;  5EF4 A;  1U5I A;  2CKL A;  3HCU A;  1AYV A;  3CH2 X;  2KWJ A;  2AUX A;  3MP2 A;  3ZNH A;  4I7C A;  5LKT A;  2F1G A;  2PBH A;  3USV A;  2R9C A;  5CHV A;  1POP A;  2RI7 A;  1ME4 A;  1EWO A;  2VPD A;  1V87 A;  2Y1M A;  1FBV A;  4YYR A;  3TMP A;  1TL9 A;  2YSM A;  1ATK A;  3KNV A;  1BOR A;  1QMY A;  2DCD A;  1MEG A;  2ECI A;  5TDW A;  4BOZ A;  2CT2 A;  2BDL A;  1AU0 A;  2Z84 A;  3PSE A;  4RF1 A;  2L75 A;  3SOU A;  2HH5 A;  4R3D A;  3E2D A;  1CV8 A;  2M3H A;  3L1X A;  2M13 A;  4V3L C;  4X6J A;  3TRK A;  4YYS A;  2FTD A;  4BSQ A;  4OW0 A;  1PVJ A;  2E6S A;  3KWZ A;  4AUQ B;  3O33 A;  1KHP A;  2P7U A;  2Y6E A;  2MD8 C;  3MTN A;  1X4J A;  1WEP A;  2B1M A;  3FM8 C;  2K1J A;  1MEM A;  3H7D A;  2E61 A;  2DCB A;  3BWK A;  4P16 A;  4XZX A;  2JMI A;  4BBQ A;  2M6M A;  2DC9 A;  5FB1 A;  3HTK C;  2XEU A;  4B7Y C;  3I2D A;  4A49 A;  2JRJ A;  2NQI A;  3QZV A;  1CB5 A;  2HHN A;  2BTW B;  2BAY A;  3OQC A;  4RY2 A;  2LGV A;  2G8E A;  2E03 A;  4PT5 A;  3LQH A;  3BPM A;  3S3Q A;  3FL2 A;  2XU1 A;  2DCA A;  2R9M A;  4QRV A;  2C2L A;  4YBT A;  2YVR A;  1TU6 A;  4WUR A;  2DCC A;  1Y4H A;  1YK8 A;  3IOQ A;  3I06 A;  1CSB B;  4REZ A;  5EGW A;  4MZO A;  2G45 A;  3SOX A;  2R6N A;  3N9L A;  2H0D B;  1F2C A;  2BDZ A;  3E9S A;  3HHA A;  1PXV A;  3SUB A;  1DEU A;  1QOL A;  1X9Y A;  1Y08 A;  3KW9 A;  3HHI A;  2KWN A;  3K9M A;  4NN2 A;  1JM7 A;  2EGM A;  2AS8 A;  2VPB A;  2AVW A;  2R9O A;  5SVI A;  2J7Q A;  4A5U A;  2IBI A;  2ACT A;  4PPE A;  1T1H A;  2L0B A;  1EF7 A;  3IEJ A;  4I07 A;  4MM3 B;  1EWL A;  3O1G A;  1U9Q X;  2PNS A;  3ASL A;  2B0O E;  2ECG A;  2EGP A;  2K17 A;  3BY4 A;  2CKL B;  1X4U A;  1WEO A;  3VK6 A;  2KWO A;  2VHF A;  4N4Z A;  2MUM A;  1U9V A;  3MOR A;  1NQC A;  2HYE D;  1WEN A; 
#chains in the Genus database with same CATH homology
 4AXM A;  1PPP A;  2VJE A;  1LDJ B;  2VNF A;  1PPD A;  5TAB A;  3N9Q A;  3BCN A;  3GCB A;  2G6Q A;  3V43 A;  1MM2 A;  1GCB A;  4QBB A;  1MS6 A;  1STF E;  1W5R A;  1QDQ A;  4YYU A;  3O7A A;  1AYU A;  3F75 A;  5CVO B;  3M63 A;  4GNF A;  3RPG B;  2OP3 A;  2VP7 A;  3O37 A;  2LDR A;  4IC3 A;  4MSX A;  5DIN A;  2KE1 A;  5JG6 A;  2DZZ A;  2LGK A;  1Z6U A;  4X3G A;  2ECJ A;  2F6J A;  3V6C A;  4R8P K;  1FP0 A;  2ZET C;  1XKG A;  4W4U A;  2R9F A;  1KFX L;  1W6F A;  2AYN A;  3KFQ A;  2ECT A;  5FB0 A;  2KIZ A;  4GNE A;  1VYX A;  5J3X A;  5B79 A;  2YJ8 A;  2OXQ C;  5CHT A;  2LGG A;  5D1K B;  4FO9 A;  2B1N A;  2VHS A;  2L43 A;  5KH3 A;  3DQV R;  2YHN A;  1DVP A;  4R7E A;  4PTB A;  4ZQL A;  1BGO A;  3IUT A;  5DKA A;  3ZYQ A;  1ZBD B;  4AYC A;  2I50 A;  1AU4 A;  2DJF B;  4BHW A;  2C2V S;  4S3O C;  3RVX A;  1BY8 A;  4IC2 A;  2VPG A;  3RVW A;  2O6X A;  3P5U A;  3CH3 X;  2XB1 A;  4CA1 A;  3V6E A;  2YUR A;  1WES A;  2YUC A;  4L7X A;  2Y43 A;  3TNX A;  5AIT A;  4G54 A;  2MA5 A;  3HCS A;  2CSZ A;  3ZVZ B;  1F29 A;  1GX3 A;  4WZ2 A;  2KRE A;  6PAD A;  2L80 A;  2RSD A;  2YW8 A;  4WA6 A;  3QJ3 A;  2VPE A;  4OEL A;  5TBN A;  3S3R A;  2YJC A;  4PI3 A;  1HYI A;  3GV4 A;  1JM7 B;  3PUR A;  4L58 A;  1KFU L;  2E00 A;  3C5K A;  4XI1 A;  2CB5 A;  3KV6 A;  2OZ2 A;  3C6W A;  4YV8 A;  4V3K C;  3OIS A;  5I3L A;  5JH3 A;  4C9Z A;  4BPV A;  2FT2 A;  5H1V A;  4F52 B;  4I7D A;  2FRQ A;  1LDK C;  3PUQ A;  4UP0 A;  4QRX A;  1GMY A;  2AYO A;  2QIZ A;  2HYE D;  5D1L B;  4P6G A;  4YAB A;  5A24 A;  3LRQ A;  2XU3 A;  1PCI A;  3RVV A;  2PAD A;  1WEW A;  4BGF A;  4LJN A;  3B79 A;  2MNZ A;  1ICF A;  4A0C D;  2R9N A;  1WFK A;  2CSY A;  3PDF A;  1MM3 A;  2QIC A;  3ZTG A;  5KH9 A;  1AU3 A;  1U9W A;  2KR4 A;  1VD4 A;  2HDP A;  4WZ0 A;  2AUZ A;  5G05 B;  3LQJ A;  2D8S A;  2NQG A;  1MIR A;  2FUI A;  4YBS A;  1PPN A;  3P5X A;  3DPL R;  4FK5 A;  3AI8 A;  2KYU A;  4NV7 A;  1Z2Q A;  2YJB A;  4PP1 A;  1ITO A;  3LTW A;  3ERV A;  1O0E A;  2AN6 A;  4N4F A;  3N9N A;  1WE9 A;  5TRB A;  2E02 A;  2FO5 A;  3OVX A;  4Q8H A;  1NB3 A;  2VJF B;  3P5V A;  1X4I A;  2DJG B;  4CDC B;  3DF0 A;  1CJL A;  1RMD A;  3BPF A;  1KHQ A;  5FEY A;  3U5O A;  3D9W A;  3K24 A;  1AU2 A;  2MIQ A;  2MT5 A;  2C0Y A;  4YYQ A;  7PCK A;  5F02 A;  4PAD A;  4FIP A;  1G25 A;  1NB5 A;  2K4D A;  4I05 A;  4DMX A;  2NQA A;  3N4C A;  1MDW A;  1Q6K A;  3T7L A;  4CCG X;  2IDA A;  4YYW A;  4UI9 B;  1SNK A;  4B86 C;  3OF9 A;  1W4T A;  3PNR A;  2YU4 A;  3BOW A;  1PIP A;  3KKU A;  4YYV A;  4AYC B;  1YT7 A;  2DC8 A;  5EYA F;  2FUD A;  3I3T A;  3ZVY A;  4ZUX U;  1HYJ A;  3U8E A;  2PUY A;  4QF2 A;  3H8B A;  5LKX A;  3CBJ A;  4BQV A;  1PE6 A;  2EA6 A;  2GHU A;  2YT5 A;  4A4B A;  4Q6F A;  4DMY A;  2KGI A;  2ECN A;  4GND A;  5LKU A;  4YVA A;  2MD7 B;  4I7B A;  2FYE A;  2LV9 A;  3KSE A;  4AXL A;  1Z60 A;  3RTR B;  3PHD A;  2FQ9 A;  3KV5 A;  5G04 B;  2YJ2 A;  1HUC B;  1CS8 A;  2KGG A;  2MNY A;  2PNX A;  3LQI A;  2MA6 A;  4N79 A;  1CQD A;  1THE A;  3N9M A;  4LKA A;  1AEC A;  2YHO A;  3N3G A;  2YSJ A;  4BS5 A;  3OVZ A;  1NL6 A;  2G7Y A;  2P0R A;  5H1T A;  3KX1 A;  2YRE A;  1YVB A;  5CVM A;  3LXS A;  3NG2 A;  1JOC A;  3O35 A;  4TKP B;  2Y5B A;  3U5P A;  2HXZ A;  3KWB X;  2E01 A;  3K8U A;  5PAD A;  3D6S A;  1EWM A;  4PP2 E;  1A6R A;  4W5C A;  2JMD A;  2JQG R;  2K16 A;  4YC9 A;  4R2Y A;  3IMA A;  1MHW A;  3IV2 A;  3ZPV E;  1ZIV A;  8PCH A;  4CDE B;  1F2B A;  1TLO A;  4AP4 A;  1QXP A;  5H1U A;  1PAD A;  3MHH A;  4UP5 A;  1ME3 A;  3N3K A;  4A4C A;  1U6G B;  2OUL A;  2KWK A;  3ZPV 1;  1JQP A;  4CDD B;  2F42 A;  4MVT A;  5KH7 A;  2DC6 A;  4MZS A;  4Q8G A;  5J94 A;  2DX8 A;  5AIU A;  1BQI A;  2EOD A;  1DF0 A;  4QRG A;  4LK9 A;  2DZY A;  4LAD B;  3PBH A;  5K16 A;  2E6R A;  1WEM A;  3F5V A;  4XUI A;  3O34 A;  1YAL A;  2ECW A;  2GFO A;  2VJE B;  4P5O B;  3QSD A;  4FJC A;  4C5P A;  1S4V A;  5B78 A;  2FRA A;  3RPG C;  4QH6 A;  2G43 A;  2AIM A;  2F7D A;  1WGM A;  1CHC A;  1WIM A;  2WBF X;  2G6D A;  2LQ6 A;  3O36 A;  1AIM A;  3L11 A;  2XU4 A;  4GB0 A;  4X6I A;  5B77 A;  2M1R A;  5LCW B;  5FPW A;  3SOW A;  3EB6 A;  1E4U A;  4YAD A;  3H6S A;  1BP4 A;  3QT4 A;  3EB5 A;  2YYR A;  3U5M A;  2F6N A;  3U5N A;  1IWD A;  1U9X A;  4HWY A;  1IYM A;  4QF3 A;  3HD3 A;  3OF8 A;  1XWH A;  1E2T A;  2KFT A;  1YK7 A;  2LXH C;  1CTE A;  4S3O B;  2CIO A;  3L1Z B;  4W5B A;  1K3B B;  3ZNI A;  3E1Z B;  3KQI A;  5TDR A;  4B55 A;  1AYW A;  2H7J A;  2ATO A;  4KLB A;  3WXG A;  5B76 A;  1SP4 B;  2ARY A;  4YAX A;  5B8D A;  2UZG A;  2DC7 A;  3N9O A;  5C11 A;  2LRI C;  1F2A A;  1GEC E;  2FUU A;  3PW3 A;  2G8J A;  3SHB A;  1K2F A;  3HWN A;  2LN0 A;  3M62 A;  2JQF R;  1WEV A;  3HCT A;  3O0U A;  3H8C A;  2XU5 A;  3C9E A;  4OEM A;  5FER A;  3IHP A;  5CVN B;  5B75 A;  4P6E A;  4GNG A;  2JMJ A;  4YAT A;  3WXE A;  4N3W A;  3WXF A;  4XR7 A;  2YQL A;  4WZ3 B;  2AU1 A;  3N9P A;  4I04 A;  1M6D A;  2NAA A;  1PBH A;  4LLB A;  3H89 A;  2HD5 A;  1WEE A;  2NQD B;  3O70 A;  3LFY A;  1N87 A;  5H9M A;  1VJV A;  2LXP C;  4X6H A;  1WEQ A;  3P5W A;  2Y1N A;  4YBM A;  1F62 A;  2QJ0 A;  3CBK A;  2LGL A;  4ZDT A;  4AVX A;  2PRE A;  3M99 A;  2P86 A;  9PAP A;  2YQM A;  1NLJ A;  2M85 A;  2ECV A;  1VFY A;  1KXR A;  4O64 A;  2YJ9 A;  4N8W A;  2H0D A;  4NV8 A;  5JA7 A;  4CZW A;  3GL6 A;  1VSN A;  1ZCM A;  5D1M B;  4CDF B;  3ZUA A;  5LKZ A;  3NHE A;  4K7C A;  1PPO A;  4BS6 A;  5C13 A;  2VJF A;  2L5U A;  3MHS A;  5G0F A;  1WIL A;  2KU3 A;  1CVZ A;  3BC3 A;  1GLO A;  1FH0 A;  1NPZ A;  1EWP A;  1CPJ A;  3T6R A;  2FSA A;  2IPP B;  5EF4 A;  1U5I A;  2CKL A;  3HCU A;  1AYV A;  3CH2 X;  2KWJ A;  2AUX A;  4I7C A;  5LKT A;  2F1G A;  2PBH A;  3USV A;  2R9C A;  5CHV A;  1POP A;  2RI7 A;  1ME4 A;  1EWO A;  2VPD A;  1V87 A;  2Y1M A;  1FBV A;  4YYR A;  1TL9 A;  2YSM A;  1ATK A;  3KNV A;  1BOR A;  1QMY A;  2DCD A;  1MEG A;  2ECI A;  5TDW A;  2CT2 A;  2BDL A;  1AU0 A;  2L75 A;  3SOU A;  2HH5 A;  1CV8 A;  2M3H A;  3L1X A;  4GUZ A;  4V3L C;  4X6J A;  4YYS A;  2FTD A;  4BSQ A;  2E6S A;  3KWZ A;  4AUQ B;  3O33 A;  1KHP A;  2P7U A;  2Y6E A;  2MD8 C;  3MTN A;  1X4J A;  1WEP A;  2B1M A;  3H7D A;  2K1J A;  1MEM A;  2DCB A;  3BWK A;  2BSZ A;  2JMI A;  4BBQ A;  2M6M A;  2DC9 A;  5FB1 A;  3HTK C;  2XEU A;  4B7Y C;  3I2D A;  4A49 A;  2JRJ A;  2NQI A;  3QZV A;  1CB5 A;  2HHN A;  2BAY A;  4RY2 A;  2LGV A;  2G8E A;  2E03 A;  3LQH A;  3BPM A;  3S3Q A;  3FL2 A;  2XU1 A;  2DCA A;  2R9M A;  4QRV A;  2C2L A;  4YBT A;  1TU6 A;  2VFB A;  2DCC A;  1Y4H A;  1YK8 A;  3IOQ A;  3I06 A;  1CSB B;  5EGW A;  4MZO A;  2G45 A;  3SOX A;  2R6N A;  3N9L A;  2H0D B;  1F2C A;  2BDZ A;  3HHA A;  1PXV A;  1QOL A;  1DEU A;  1X9Y A;  1Y08 A;  3KW9 A;  3HHI A;  2KWN A;  3K9M A;  4NN2 A;  1JM7 A;  2AS8 A;  2VFC A;  2VPB A;  2AVW A;  2R9O A;  2IBI A;  2ACT A;  4PPE A;  1T1H A;  2L0B A;  1EF7 A;  3IEJ A;  4I07 A;  1EWL A;  3O1G A;  1U9Q X;  2PNS A;  3ASL A;  2ECG A;  2EGP A;  2K17 A;  2CKL B;  1X4U A;  1WEO A;  3VK6 A;  2KWO A;  2VHF A;  4N4Z A;  2MUM A;  1U9V A;  3MOR A;  1NQC A;  1WEU A;  1WEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...