4WA6A

Structure of yeast saga dubm with sgf73 n59d mutant at 2.36 angstroms resolution
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
471
structure length
440
Chain Sequence
MSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALNRQTGFIYLLTCAWKIQDAHEFWQFIINQIHQSYVLDLPNAKEVSRANNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNYHCGECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
publication title Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transcription
total genus 141
structure length 440
sequence length 471
chains with identical sequence D
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4wa6A01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4wa6A02
1HYJA 2IDAA 1U9WA 4I05A 3SHBA 4PTBA 2I50A 1F2AA 2OZ2A 3BCNA 5TDWA 3T6RA 4I07A 1F2CA 4X3GA 5PADA 3H89A 3P5VA 3U5OA 5K16A 2LXHC 3N9OA 4ZQLA 2HXZA 2JMJA 2JMDA 3MORA 3DPLR 1JM7B 2HD5A 2MNYA 4BSQA 4WZ0A 2KWOA 2YQLA 3D6SA 5KH9A 1HYIA 1MDWA 3WXGA 2C2VS 3N4CA 3KKUA 3SOWA 4YBTA 4CA1A 1TLOA 2AVWA 2NAAA 4IC3A 4DMXA 5AITA 3O7AA 2BDZA 2G45A 4RY2A 2ACTA 2CIOA 2HHNA 2DZZA 4A49A 4AVXA 1MS6A 2KWKA 2LGVA 2G8EA 3CH3X 3KNVA 1O0EA 1Z2QA 2P0RA 2XEUA 5LKTA 3P5WA 1WEWA 4ZUXU 2KU3A 1WEOA 2GHUA 3PDFA 2Y43A 2DCDA 2VJEA 1VD4A 3KFQA 2B1NA 2C0YA 1VYXA 1AYWA 1MM3A 4FO9A 3E1ZB 5JH3A 5C11A 2VHFA 3L1XA 4QRGA 2OXQC 5B78A 2L43A 3ZPV1 1Q6KA 9PAPA 3MHSA 1HUCB 3I3TA 2ECWA 1PXVA 4X6HA 1PE6A 2VJEB 2KGGA 2R6NA 1U5IA 4P5OB 3BC3A 3IV2A 5AIUA 1M6DA 2AIMA 3QSDA 5FERA 1K2FA 2G6QA 2K1JA 5F02A 1ZIVA 5KH3A 3USVA 1AU2A 3K8UA 3B79A 4V3KC 5JG6A 2GFOA 1THEA 3OISA 4I04A 2MIQA 4F52B 3BWKA 3IUTA 4WA6A 2E00A 3PNRA 4A0CD 1F29A 3LFYA 5H1VA 2XU5A 3TNXA 3ZPVE 5LKUA 1FH0A 1EF7A 4YV8A 3IOQA 4PADA 4CZWA 2AN6A 2CSYA 3RPGC 1XWHA 2VNFA 2E03A 3M63A 2FT2A 2YYRA 1RMDA 4L58A 2YT5A 5B79A 3FL2A 5G05B 2CKLA 4X6IA 2YREA 3H6SA 2XU1A 2R9OA 5B76A 1BORA 1WESA 5FB1A 1XKGA 2FYEA 1BGOA 4N4ZA 2VPBA 3VK6A 3BOWA 1VSNA 3ASLA 1A6RA 1MIRA 2E02A 1VFYA 1ZCMA 1CQDA 2YJ8A 2FUIA 2VPDA 3PHDA 1YK7A 1EWLA 3U8EA 2JQGR 2DJFB 5TBNA 2CKLB 3HCSA 2YUCA 4TKPB 3KV5A 2KREA 5J3XA 1PBHA 1U9QX 3HCUA 2OULA 2Y6EA 1NL6A 2L80A 1U6GB 1WILA 1TU6A 4YYQA 1KHQA 2NQGA 1QDQA 2L5UA 4KLBA 4HWYA 4YVAA 3RVXA 3ZTGA 4XI1A 4S3OC 5H1UA 2M85A 3OVZA 4LKAA 1CTEA 2YJBA 4YBMA 3IEJA 3O0UA 2QICA 1WGMA 2DCAA 5FPWA 2IPPB 2H7JA 5CVOB 3GV4A 3C9EA 2F42A 1CSBB 1AECA 2PBHA 3WXFA 3QJ3A 2M3HA 4GNGA 1U9XA 1Z60A 3PBHA 2YW8A 4V3LC 5DINA 1ZBDB 2ZETC 2JMIA 3OVXA 4X6JA 2EA6A 2PUYA 1NLJA 8PCHA 2YJ2A 3NG2A 1ME4A 5CVMA 2F7DA 2XU4A 3KSEA 1S4VA 3IMAA 1WEEA 3IHPA 4YYVA 4Q8HA 1CS8A 4QF3A 2PNSA 2LN0A 1WEMA 5TRBA 2PREA 3LRQA 1YVBA 3O35A 3DF0A 1KXRA 5LKZA 3BPFA 1ME3A 3CH2X 3S3QA 2CB5A 1NB3A 4O64A 5I3LA 2MA6A 1DEUA 3V6EA 3QZVA 5FB0A 2JRJA 1WENA 2G7YA 4XR7A 2L0BA 2DC8A 2IBIA 5G04B 3M62A 2LQ6A 2VPEA 2YURA 3LQJA 4OEMA 4P6GA 4FJCA 2YQMA 2MD7B 2FUDA 2AYNA 4BS5A 2NQAA 2G43A 4N3WA 1KHPA 2M1RA 2E6RA 2NQIA 3ZUAA 1X9YA 4AXMA 2ECIA 3WXEA 4QRVA 1POPA 3HTKC 2DZYA 2FQ9A 3QT4A 1CVZA 5CVNB 4YYWA 1BP4A 2Y1MA 1YK8A 3KV6A 4LJNA 2FSAA 1Z6UA 2KWNA 4MSXA 4XUIA 3ZNIA 1JQPA 2AUZA 3DQVR 2LGLA 2P86A 2FRQA 3S3RA 1QMYA 4P6EA 2AS8A 3LXSA 3KWBX 4OELA 4CDFB 2G6DA 2BAYA 2KR4A 2AYOA 2DJGB 2R9CA 2ECGA 2YJCA 1CHCA 1G25A 4WZ3B 2K4DA 4AUQB 3ERVA 2KGIA 2YSMA 3ZVYA 1AIMA 2R9NA 3MTNA 2O6XA 2BDLA 2CT2A 2KFTA 4NN2A 4BBQA 2LXPC 1NPZA 2HDPA 3CBKA 4YADA 2Y1NA 1ICFA 2L75A 1U9VA 2H0DA 5EYAF 3L11A 1BQIA 2XU3A 3OF8A 2YJ9A 2D8SA 1Y4HA 3HD3A 2VPGA 4YABA 1IYMA 1K3BB 1YALA 1IWDA 4YAXA 3EB5A 1PPPA 1WFKA 3LQHA 4GNDA 2DCBA 4B7YC 3T7LA 5JA7A 1SNKA 3GL6A 4C9ZA 3KX1A 2MA5A 1GCBA 2M6MA 1PPOA 3O33A 2H0DB 2VJFA 2LGKA 3PURA 3RTRB 1X4UA 5KH7A 5G0FA 3N9QA 3I2DA 2YHNA 3MHHA 5TDRA 3KWZA 2ECNA 3O1GA 4QRXA 4FIPA 5TABA 2K17A 1N87A 4W5BA 4YATA 5EF4A 2HH5A 2CSZA 4I7CA 1WEUA 2XB1A 4LK9A 3NHEA 4K7CA 4MZOA 3L1ZB 2VJFB 1NB5A 2EODA 5LCWB 2VP7A 2HYED 1ITOA 2C2LA 5A24A 1NQCA 1PADA 3RVWA 3HHIA 3N9LA 1F62A 2F6JA 3HHAA 3V6CA 1DF0A 3N9NA 2LV9A 4IC2A 5EGWA 2RSDA 4CCGX 2LDRA 4Q8GA 5B8DA 1GLOA 4BHWA 3I06A 4Q6FA 1LDKC 4UI9B 1WE9A 3C6WA 1AU3A 3F5VA 6PADA 3HCTA 5C13A 3N3GA 4I7DA 4I7BA 4AYCA 5CHTA 5B77A 1EWOA 2K16A 1YT7A 2ATOA 3U5NA 2R9MA 4PP2E 4B86C 3V43A 4AXLA 4CDEB 2ECJA 1AU4A 2F6NA 1WEVA 1AYUA 2NQDB 2FTDA 2DCCA 3KW9A 4MVTA 2YU4A 4GNFA 1MM2A 2DX8A 4YC9A 4AYCB 1STFE 1DVPA 2PNXA 2DC7A 4PP1A 3BPMA 1PPNA 4BPVA 1BY8A 4UP5A 3GCBA 2QJ0A 5LKXA 2MUMA 3OF9A 4WZ2A 1WEPA 5D1LB 3RPGB 2DC9A 4MZSA 1AU0A 1CPJA 2E01A 4YYRA 4AP4A 1LDJB 4R7EA 1E4UA 5D1KB 3H7DA 5H1TA 2KIZA 2DC6A 1QOLA 1Y08A 3O37A 2E6SA 1PPDA 3P5XA 1FBVA 4QBBA 4QH6A 1GECE 1SP4B 4BQVA 5H9MA 1KFUL 1AYVA 2UZGA 2KE1A 2FUUA 5J94A 3U5MA 4A4CA 4GNEA 3M99A 2QIZA 4N4FA 4QF2A 2B1MA 1MEGA 4UP0A 5D1MB 4LLBA 4N79A 4R8PK 1WEQA 2FRAA 2KYUA 3H8CA 3F75A 2OP3A 3HWNA 3ZVZB 2JQFR 4GB0A 4PPEA 2RI7A 2VHSA 3O36A 4YYUA 3KQIA 3EB6A 3PW3A 4YYSA 4YBSA 2EGPA 1MHWA 5B75A 2MNZA 4R2YA 1CB5A 1GMYA 1CV8A 2AU1A 2LRIC 3N9PA 1WIMA 4S3OB 2MD8C 4A4BA 2FO5A 1X4JA 4L7XA 3K9MA 1X4IA 4G54A 2YSJA 4W5CA 4CDCB 5FEYA 3SOXA 3SOUA 2R9FA 4ZDTA 7PCKA 4W4UA 1PIPA 4DMYA 1FP0A 4PI3A 1CJLA 5DKAA 4N8WA 3H8BA 3P5UA 1TL9A 3O70A 3K24A 3CBJA 3N3KA 1QXPA 1ATKA 2P7UA 2LGGA 2YHOA 1F2BA 1MEMA 1V87A 2ARYA 5CHVA 2Y5BA 3PUQA 2F1GA 2G8JA 4CDDB 2PADA 3O34A 3U5PA 1KFXL 2ECVA 3LQIA 3C5KA 4LADB 2AUXA 1JM7A 2KWJA 3AI8A 4FK5A 3RVVA 2ECTA 1VJVA 3ZYQA 1EWMA 3N9MA 1EWPA 1JOCA 1PCIA 2WBFX 2MT5A 4BS6A 1T1HA
chains in the Genus database with same CATH superfamily
1HYJA 2IDAA 1U9WA 4I05A 3SHBA 4PTBA 2I50A 1F2AA 2OZ2A 3BCNA 5TDWA 3T6RA 4I07A 1F2CA 4X3GA 2OWAA 5PADA 3H89A 4D8EA 3P5VA 3U5OA 5K16A 2LXHC 3N9OA 4ZQLA 2HXZA 2JMJA 2JMDA 3MORA 3DPLR 1JM7B 4OGEA 2HD5A 2MNYA 4Z0OA 4BSQA 4WZ0A 2KWOA 2YQLA 3D6SA 5KH9A 1HYIA 1MDWA 2FFWA 3WXGA 2C2VS 3N4CA 3KKUA 3SOWA 2BU3A 4YBTA 5SVXA 3PHUA 4CA1A 1TLOA 2AVWA 2NAAA 4IC3A 4DMXA 5AITA 3O7AA 2BDZA 2G45A 4RY2A 2ACTA 5SVIA 2CIOA 4D8IA 2JRIA 2HHNA 2DZZA 4A49A 3PRMA 2CRWA 4AVXA 1MS6A 2LAUA 2KWKA 2LGVA 2XOYA 2G8EA 2RR4A 3CH3X 3KNVA 3LJUX 1O0EA 3E2DA 3PHXA 1Z2QA 2P0RA 2XEUA 5LKTA 3P5WA 1WEWA 4ZUXU 2KU3A 1WEOA 2GHUA 3PDFA 2Y43A 2DCDA 2KKXA 2VJEA 1VD4A 3KFQA 4GUAA 2B1NA 5SVIB 3FJUB 2C0YA 1VYXA 4A5UA 1AYWA 4FO9A 1MM3A 3E1ZB 5JH3A 5C11A 2VHFA 3L1XA 4QRGA 2OXQC 5B78A 2L43A 4IP3A 3ZPV1 1Q6KA 9PAPA 5SVYA 3MHSA 1HUCB 3I3TA 2ECWA 3LDYA 4IUMA 3OQCA 1PXVA 4X6HA 1PE6A 2VJEB 3O47A 2KGGA 2R6NA 1U5IA 4P5OB 3BC3A 3IV2A 5AIUA 1M6DA 2AIMA 3E9SA 3QSDA 5FERA 1K2FA 2G6QA 2K1JA 5F02A 1ZIVA 5KH3A 3USVA 2DOSA 1AU2A 3K8UA 3B79A 4V3KC 5JG6A 2GFOA 1THEA 3OISA 5EZSA 4I04A 2MIQA 4F52B 3BWKA 3IUTA 4WA6A 2E00A 4OW0A 3PNRA 4A0CD 3LVRE 1F29A 3LFYA 5H1VA 2XU5A 3TNXA 3ZPVE 5LKUA 1FH0A 1EF7A 4YV8A 3IOQA 4PADA 2JUNA 4CZWA 2AN6A 2CSYA 3RPGC 4BOZA 1XWHA 2VNFA 2E03A 3M63A 2FT2A 2YYRA 1RMDA 4L58A 2YT5A 5B79A 3FL2A 5G05B 2CKLA 4X6IA 2YREA 3H6SA 2XU1A 2R9OA 5B76A 1BORA 1WESA 5FB1A 1XKGA 2FYEA 1BGOA 4N4ZA 2VPBA 3VK6A 3BOWA 1VSNA 3ASLA 1A6RA 1MIRA 2E02A 1VFYA 1ZCMA 1CQDA 2YJ8A 2FUIA 2VPDA 3PHDA 1YK7A 1EWLA 3U8EA 2JQGR 2DJFB 5TBNA 2CKLB 3HCSA 2YUCA 4TKPB 2UZJA 3KV5A 2KREA 5J3XA 1PBHA 1U9QX 3HCUA 2OULA 2Y6EA 1NL6A 2L80A 1U6GB 1WILA 1TU6A 4YYQA 1KHQA 2NQGA 1QDQA 2L5UA 4KLBA 4HWYA 4OVZA 4YVAA 3RVXA 3ZTGA 4XI1A 4S3OC 5H1UA 2M85A 3OVZA 4LKAA 1CTEA 2YJBA 4YBMA 3IEJA 3O0UA 2EGMA 2QICA 3MP2A 1WGMA 2DCAA 5FPWA 2IPPB 2H7JA 5CVOB 3GV4A 3TRKA 3C9EA 5E6JA 4M0WA 2F42A 1CSBB 1AECA 4OVZB 2PBHA 1UKFA 3QJ3A 2M3HA 4GNGA 1U9XA 3WXFA 1Z60A 3W31A 2DJAA 3PBHA 2YW8A 4V3LC 1ZBDB 2ZETC 5DINA 2JMIA 2M13A 3OVXA 2JM3A 4X6JA 2EA6A 2PUYA 1NLJA 8PCHA 2YJ2A 3NG2A 3FANA 4RKXA 1ME4A 5CVMA 2F7DA 2XU4A 3KSEA 3C0RA 1S4VA 3DWDA 3IMAA 1WEEA 3IHPA 4YYVA 4Q8HA 3SUBA 1MBMA 1CS8A 4WURA 4QF3A 2PNSA 3PHWA 2LN0A 1WEMA 5TRBA 3B21A 2PREA 3LRQA 1YVBA 3O35A 3DF0A 1KXRA 5LKZA 4REZA 3BPFA 1ME3A 3CH2X 3S3QA 2CB5A 1NB3A 4O64A 5I3LA 2MA6A 1DEUA 5JZEA 3V6EA 3QZVA 5FB0A 2EXUA 2JRJA 1WENA 2G7YA 4XR7A 2L0BA 2DC8A 3RNVA 2IBIA 5G04B 3M62A 2LQ6A 2VPEA 2YURA 3LQJA 4OEMA 4P6GA 4FJCA 2YQMA 2MD7B 2FUDA 2AYNA 3FEHA 4BS5A 2NQAA 4N3WA 2G43A 1KHPA 2M1RA 2E6RA 2NQIA 3MJ5A 1X9YA 3ZUAA 2ECIA 3WXEA 4AXMA 4HXDB 4QRVA 2HWKA 1POPA 3HTKC 2DZYA 2FQ9A 3QT4A 1CVZA 5CVNB 4YYWA 1BP4A 2Y1MA 1YK8A 5KO3A 2J7QA 3KV6A 4LJNA 2FSAA 1Z6UA 2KWNA 4MSXA 4XUIA 3ZNIA 1JQPA 2AUZA 3DQVR 1PVJA 2LGLA 2P86A 3FAOA 2FRQA 3S3RA 1QMYA 4ZTBA 4P6EA 2AS8A 3LXSA 1DCQA 3KWBX 4OELA 4CDFB 2G6DA 2BAYA 2KR4A 2AYOA 2DJGB 3BBAA 2R9CA 2ECGA 3MDBC 2YJCA 1CHCA 1G25A 4WZ3B 2K4DA 4AUQB 3ERVA 2P57A 2KGIA 2YSMA 3ZVYA 1AIMA 2R9NA 3MTNA 2O6XA 4MI7A 5EZQA 2BDLA 2CT2A 2KFTA 2YVRA 5K3QA 4NN2A 4BBQA 4H9DA 2LXPC 1NPZA 2HDPA 3CBKA 4YADA 2Y1NA 1ICFA 2L75A 1U9VA 2H0DA 5EYAF 3L11A 1BQIA 2XU3A 4RF0A 3OF8A 2YJ9A 2D8SA 1Y4HA 3HD3A 2VPGA 4YABA 1IYMA 1K3BB 1YALA 1IWDA 4YAXA 3EB5A 1PPPA 1WFKA 3LQHA 4GNDA 2DCBA 4B7YC 3BB7A 4XZXA 3T7LA 5JA7A 2BTWB 1SNKA 3GL6A 4C9ZA 3KX1A 2MA5A 1GCBA 2M6MA 1PPOA 2E61A 2H0DB 2VJFA 2LGKA 3O33A 3PURA 3DDTA 3RTRB 1X4UA 5KH7A 5G0FA 3N9QA 3I2DA 2YHNA 3MHHA 5TDRA 3TMPA 2Z84A 3LVQE 3KWZA 2ECNA 3PSEA 2AGAA 3O1GA 4QRXA 4FIPA 5TABA 2K17A 1N87A 2XOZA 4YATA 4W5BA 5EF4A 2HH5A 2CSZA 4I7CA 1WEUA 2FD4A 2XB1A 4LK9A 3NHEA 4BOQA 4K7CA 4MZOA 3L1ZB 2D8UA 2VJFB 1NB5A 2EODA 5LCWB 2VP7A 2JTCA 2HYED 1ITOA 3KDEC 2C2LA 5A24A 1NQCA 1PADA 3Q1DA 2KKYA 3RVWA 3HHIA 3N9LA 1F62A 2F6JA 3HHAA 1YZBA 3V6CA 2L7PA 1DF0A 3N9NA 2LV9A 4IC2A 5EGWA 3MTVA 2RSDA 4CCGX 2LDRA 4BOPA 4Q8GA 5B8DA 1GLOA 4BHWA 3I06A 4Q6FA 4O62A 1LDKC 4RF1A 1WE9A 3C6WA 4UI9B 1AU3A 3F5VA 6PADA 3HCTA 4D8BA 5C13A 3N3GA 4I7DA 4I7BA 4AYCA 5CHTA 5B77A 1EWOA 2K16A 1YT7A 2ATOA 3U5NA 2IQJA 2R9MA 4PP2E 3M7KA 4B86C 3FM8C 3V43A 4AXLA 4CDEB 2ECJA 1AU4A 2F6NA 1WEVA 1AYUA 2NQDB 2FTDA 2DCCA 3KW9A 4MVTA 2XOCA 2YU4A 4R3DA 4GNFA 1MM2A 2DX8A 4YC9A 4AYCB 1STFE 1DVPA 2PNXA 2DC7A 4PP1A 3BPMA 1PPNA 4BPVA 1BY8A 4UP5A 3GCBA 3PRPA 2QJ0A 5LKXA 2MUMA 3OF9A 4BOSA 4WZ2A 1WEPA 5D1LB 3RPGB 2DC9A 4MZSA 4RNAA 1AU0A 1CPJA 2E01A 4YYRA 3T9KA 4AP4A 1LDJB 4R7EA 4MM3B 1E4UA 5D1KB 3W30A 2MKEA 3H7DA 5H1TA 2KIZA 2FE8A 2DC6A 1QOLA 1Y08A 3O37A 2E6SA 1PPDA 3P5XA 1FBVA 4QBBA 4QH6A 1GECE 1SP4B 4BQVA 5H9MA 1KFUL 1AYVA 2UZGA 2KE1A 2FUUA 4OGCA 3O65A 5J94A 3U5MA 4A4CA 4GNEA 3M99A 2QIZA 4N4FA 4QF2A 2B1MA 1MEGA 4UP0A 5D1MB 4LLBA 4N79A 4QQ4A 4R8PK 1WEQA 2FRAA 2KYUA 3H8CA 3F75A 2OP3A 3HWNA 3ZVZB 2JQFR 4GB0A 4PPEA 2RI7A 2VHSA 3O36A 4YYUA 3KQIA 3EB6A 2BTWA 3PW3A 4YYSA 4YBSA 2EGPA 1DKIA 1MHWA 5B75A 2MNZA 2CONA 4R2YA 1CB5A 1GMYA 1CV8A 2AU1A 2LRIC 3N9PA 1WIMA 4S3OB 2MD8C 4A4BA 2FO5A 1X4JA 4L7XA 3K9MA 1X4IA 4G54A 2YSJA 4W5CA 4CDCB 2XP0A 5FEYA 3SOXA 3SOUA 2R9FA 4P16A 4ZDTA 7PCKA 4BOUA 4W4UA 3IFUA 1PIPA 2CRRA 4DMYA 1FP0A 3PLWA 1CJLA 5DKAA 4N8WA 4PI3A 3H8BA 3P5UA 1TL9A 3O70A 2DSMA 3K24A 3CBJA 3N3KA 3JUEA 1QXPA 1ATKA 4Z0RA 2P7UA 2LGGA 2YHOA 1F2BA 1MEMA 1V87A 2ARYA 5CHVA 2Y5BA 3BY4A 3PUQA 2F1GA 2G8JA 4CDDB 2PADA 3O34A 3U5PA 1KFXL 2ECVA 3H7HA 3LQIA 2CSVA 3C5KA 2J7QC 4LADB 2AUXA 1JM7A 2KWJA 3AI8A 4FK5A 3RVVA 2ECTA 1VJVA 4PT5A 3ZYQA 1EWMA 2B0OE 3N9MA 4F1PA 1JOCA 1EWPA 1PCIA 2MT5A 2WBFX 3ZNHA 4BS6A 1T1HA 3PT2A
chains in the Genus database with same CATH topology
1HYJA 2IDAA 1U9WA 4I05A 3SHBA 4PTBA 2I50A 1F2AA 2OZ2A 3BCNA 5TDWA 3T6RA 4I07A 1F2CA 4X3GA 5PADA 3H89A 3P5VA 3U5OA 5K16A 2LXHC 3N9OA 4ZQLA 2HXZA 2JMJA 2JMDA 3MORA 3DPLR 1JM7B 2HD5A 2MNYA 4BSQA 4WZ0A 2KWOA 2YQLA 3D6SA 5KH9A 1HYIA 1MDWA 3WXGA 2C2VS 3N4CA 3KKUA 3SOWA 4YBTA 4CA1A 1TLOA 2AVWA 2NAAA 4IC3A 4DMXA 5AITA 3O7AA 2BDZA 2G45A 4RY2A 2ACTA 2CIOA 1E2TA 2HHNA 4NV8A 2DZZA 4A49A 4AVXA 1MS6A 2KWKA 2LGVA 2G8EA 3CH3X 3KNVA 1O0EA 1Z2QA 2P0RA 2XEUA 5LKTA 3P5WA 1WEWA 4ZUXU 2KU3A 1WEOA 2GHUA 4BGFA 3PDFA 2Y43A 2DCDA 2VJEA 1VD4A 3KFQA 2B1NA 2C0YA 1VYXA 1AYWA 1MM3A 4FO9A 3E1ZB 5JH3A 5C11A 2VHFA 3L1XA 4QRGA 2OXQC 5B78A 2L43A 3ZPV1 1Q6KA 9PAPA 3MHSA 1HUCB 3I3TA 2ECWA 1PXVA 4X6HA 1PE6A 2VJEB 2KGGA 2R6NA 1U5IA 4P5OB 3BC3A 3IV2A 5AIUA 1M6DA 2AIMA 3QSDA 5FERA 1K2FA 2G6QA 2K1JA 5F02A 1ZIVA 5KH3A 3USVA 1AU2A 3K8UA 3B79A 4V3KC 5JG6A 2GFOA 1THEA 3OISA 4I04A 2MIQA 4F52B 3BWKA 3IUTA 4WA6A 2E00A 3PNRA 4A0CD 1F29A 3LFYA 1W4TA 5H1VA 2XU5A 3TNXA 3ZPVE 5LKUA 1FH0A 1EF7A 4YV8A 3IOQA 4PADA 4CZWA 2AN6A 2CSYA 3RPGC 1XWHA 2VNFA 2E03A 3M63A 2FT2A 2YYRA 1RMDA 4L58A 2YT5A 5B79A 3FL2A 5G05B 2CKLA 4X6IA 2YREA 4C5PA 3H6SA 2XU1A 2R9OA 5B76A 1BORA 1WESA 5FB1A 1XKGA 2FYEA 1BGOA 4N4ZA 2VPBA 3VK6A 3BOWA 1VSNA 3ASLA 1A6RA 1MIRA 2VFBA 2E02A 1VFYA 1ZCMA 1CQDA 2YJ8A 2FUIA 2VPDA 3PHDA 1YK7A 1EWLA 3U8EA 2JQGR 2DJFB 5TBNA 2CKLB 3HCSA 2YUCA 4TKPB 3KV5A 2KREA 5J3XA 1PBHA 1U9QX 3HCUA 2OULA 2Y6EA 1NL6A 2L80A 1U6GB 1WILA 1TU6A 4YYQA 1KHQA 2NQGA 1QDQA 2L5UA 4KLBA 4HWYA 4YVAA 3RVXA 3ZTGA 4XI1A 4S3OC 5H1UA 2M85A 3OVZA 4LKAA 1CTEA 2YJBA 4YBMA 3IEJA 3O0UA 2QICA 1WGMA 2DCAA 5FPWA 2IPPB 2H7JA 5CVOB 3GV4A 3C9EA 2F42A 1CSBB 3LTWA 1AECA 2PBHA 3WXFA 3QJ3A 2M3HA 4GNGA 1U9XA 1Z60A 3PBHA 2YW8A 4V3LC 5DINA 1ZBDB 2ZETC 2JMIA 3OVXA 4X6JA 2EA6A 2PUYA 1NLJA 8PCHA 2YJ2A 3NG2A 1ME4A 5CVMA 2F7DA 2XU4A 3KSEA 1S4VA 3IMAA 1WEEA 3IHPA 4YYVA 4Q8HA 1W5RA 1CS8A 4QF3A 2PNSA 2LN0A 1WEMA 5TRBA 2PREA 3LRQA 1YVBA 3O35A 3DF0A 1KXRA 5LKZA 2VFCA 3BPFA 1ME3A 3CH2X 3S3QA 2CB5A 1NB3A 4O64A 5I3LA 2MA6A 1DEUA 3V6EA 3QZVA 5FB0A 2JRJA 1WENA 2G7YA 4XR7A 2L0BA 2DC8A 2IBIA 5G04B 3M62A 2LQ6A 2VPEA 2YURA 3LQJA 4OEMA 4P6GA 4FJCA 2YQMA 2MD7B 2FUDA 2AYNA 4BS5A 2NQAA 2G43A 4N3WA 1KHPA 2M1RA 2BSZA 2E6RA 2NQIA 4GUZA 1X9YA 3ZUAA 2ECIA 3WXEA 4AXMA 4QRVA 1POPA 3HTKC 2DZYA 2FQ9A 3QT4A 1CVZA 5CVNB 4YYWA 1BP4A 2Y1MA 1YK8A 3KV6A 4LJNA 2FSAA 1Z6UA 2KWNA 4MSXA 4XUIA 3ZNIA 1JQPA 2AUZA 3DQVR 2LGLA 2P86A 2FRQA 3S3RA 1QMYA 4P6EA 2AS8A 3LXSA 3KWBX 4OELA 4CDFB 2G6DA 2BAYA 2KR4A 2AYOA 2DJGB 2R9CA 2ECGA 2YJCA 1CHCA 1G25A 4WZ3B 2K4DA 4AUQB 3ERVA 2KGIA 2YSMA 3ZVYA 1AIMA 2R9NA 3MTNA 2O6XA 2BDLA 2CT2A 2KFTA 4NN2A 4BBQA 2LXPC 1NPZA 2HDPA 3CBKA 4YADA 2Y1NA 1ICFA 2L75A 1U9VA 2H0DA 5EYAF 3L11A 1BQIA 2XU3A 3OF8A 2YJ9A 2D8SA 1Y4HA 3HD3A 2VPGA 4YABA 1IYMA 1K3BB 1YALA 1IWDA 4YAXA 3EB5A 1PPPA 1WFKA 3LQHA 4GNDA 2DCBA 4B7YC 3T7LA 5JA7A 1SNKA 3GL6A 4C9ZA 3KX1A 2MA5A 1GCBA 2M6MA 1PPOA 3O33A 2H0DB 2VJFA 2LGKA 3PURA 3RTRB 1X4UA 5KH7A 5G0FA 3N9QA 3I2DA 2YHNA 3MHHA 5TDRA 3KWZA 2ECNA 3O1GA 4QRXA 4FIPA 5TABA 2K17A 1N87A 4W5BA 4YATA 5EF4A 2HH5A 2CSZA 4I7CA 1WEUA 2XB1A 4LK9A 3NHEA 4K7CA 4MZOA 3L1ZB 2VJFB 1NB5A 2EODA 5LCWB 2VP7A 2HYED 1ITOA 2C2LA 5A24A 1NQCA 1PADA 3RVWA 3HHIA 3N9LA 1F62A 2F6JA 3HHAA 3V6CA 1DF0A 3N9NA 2LV9A 4IC2A 5EGWA 2RSDA 4CCGX 2LDRA 4Q8GA 5B8DA 1GLOA 4BHWA 3I06A 4Q6FA 1LDKC 4B55A 4UI9B 1WE9A 3C6WA 1AU3A 3F5VA 6PADA 3HCTA 5C13A 3N3GA 4I7DA 4I7BA 4AYCA 5CHTA 5B77A 1EWOA 2K16A 1YT7A 2ATOA 3U5NA 2R9MA 4PP2E 4B86C 3V43A 4AXLA 4CDEB 2ECJA 1AU4A 2F6NA 1WEVA 1AYUA 2NQDB 2FTDA 2DCCA 3KW9A 4MVTA 2YU4A 4GNFA 1MM2A 2DX8A 4YC9A 4AYCB 1STFE 3D9WA 1DVPA 2PNXA 2DC7A 4PP1A 3BPMA 1PPNA 4BPVA 1BY8A 4UP5A 3GCBA 2QJ0A 5LKXA 2MUMA 3OF9A 4WZ2A 1WEPA 5D1LB 3RPGB 2DC9A 4MZSA 1AU0A 1CPJA 2E01A 4YYRA 4AP4A 1LDJB 4R7EA 1E4UA 5D1KB 3H7DA 5H1TA 2KIZA 2DC6A 1QOLA 1Y08A 3O37A 2E6SA 1PPDA 3P5XA 1FBVA 4QBBA 4QH6A 1GECE 1GX3A 1SP4B 4BQVA 5H9MA 1KFUL 1AYVA 2UZGA 2KE1A 2FUUA 4NV7A 5J94A 3U5MA 4A4CA 4GNEA 3M99A 2QIZA 4N4FA 4QF2A 2B1MA 1MEGA 4UP0A 5D1MB 4LLBA 4N79A 4R8PK 1WEQA 2FRAA 2KYUA 3H8CA 3F75A 2OP3A 3HWNA 3ZVZB 2JQFR 4GB0A 4PPEA 2RI7A 2VHSA 3O36A 4YYUA 3KQIA 3EB6A 3PW3A 4YYSA 4YBSA 2EGPA 1MHWA 5B75A 2MNZA 4R2YA 1CB5A 1GMYA 1CV8A 2AU1A 2LRIC 3N9PA 1WIMA 4S3OB 2MD8C 4A4BA 2FO5A 1X4JA 4L7XA 3K9MA 1X4IA 4G54A 2YSJA 4W5CA 4CDCB 5FEYA 3SOXA 3SOUA 2R9FA 4ZDTA 7PCKA 4W4UA 1PIPA 4DMYA 1FP0A 4PI3A 1CJLA 5DKAA 4N8WA 3H8BA 3P5UA 1TL9A 3O70A 3K24A 3CBJA 3N3KA 1QXPA 1ATKA 2P7UA 2LGGA 2YHOA 1F2BA 1MEMA 1W6FA 1V87A 2ARYA 5CHVA 2Y5BA 3PUQA 2F1GA 2G8JA 4CDDB 2PADA 3O34A 3U5PA 1KFXL 2ECVA 3LQIA 3C5KA 4LADB 2AUXA 1JM7A 2KWJA 3AI8A 4FK5A 3RVVA 2ECTA 1VJVA 3ZYQA 1EWMA 3N9MA 1EWPA 1JOCA 1PCIA 2WBFX 2MT5A 4BS6A 1T1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HYJ A;  2IDA A;  1U9W A;  4I05 A;  3SHB A;  4PTB A;  2I50 A;  1F2A A;  2OZ2 A;  3BCN A;  5TDW A;  3T6R A;  4I07 A;  1F2C A;  4X3G A;  5PAD A;  3H89 A;  3P5V A;  3U5O A;  5K16 A;  2LXH C;  3N9O A;  4ZQL A;  2HXZ A;  2JMJ A;  2JMD A;  3MOR A;  3DPL R;  1JM7 B;  2HD5 A;  2MNY A;  4BSQ A;  4WZ0 A;  2KWO A;  2YQL A;  3D6S A;  5KH9 A;  1HYI A;  1MDW A;  3WXG A;  2C2V S;  3N4C A;  3KKU A;  3SOW A;  4YBT A;  4CA1 A;  1TLO A;  2AVW A;  2NAA A;  4IC3 A;  4DMX A;  5AIT A;  3O7A A;  2BDZ A;  2G45 A;  4RY2 A;  2ACT A;  2CIO A;  2HHN A;  2DZZ A;  4A49 A;  4AVX A;  1MS6 A;  2KWK A;  2LGV A;  2G8E A;  3CH3 X;  3KNV A;  1O0E A;  1Z2Q A;  2P0R A;  2XEU A;  5LKT A;  3P5W A;  1WEW A;  4ZUX U;  2KU3 A;  1WEO A;  2GHU A;  3PDF A;  2Y43 A;  2DCD A;  2VJE A;  1VD4 A;  3KFQ A;  2B1N A;  2C0Y A;  1VYX A;  1AYW A;  1MM3 A;  4FO9 A;  3E1Z B;  5JH3 A;  5C11 A;  2VHF A;  3L1X A;  4QRG A;  2OXQ C;  5B78 A;  2L43 A;  3ZPV 1;  1Q6K A;  9PAP A;  3MHS A;  1HUC B;  3I3T A;  2ECW A;  1PXV A;  4X6H A;  1PE6 A;  2VJE B;  2KGG A;  2R6N A;  1U5I A;  4P5O B;  3BC3 A;  3IV2 A;  5AIU A;  1M6D A;  2AIM A;  3QSD A;  5FER A;  1K2F A;  2G6Q A;  2K1J A;  5F02 A;  1ZIV A;  5KH3 A;  3USV A;  1AU2 A;  3K8U A;  3B79 A;  4V3K C;  5JG6 A;  2GFO A;  1THE A;  3OIS A;  4I04 A;  2MIQ A;  4F52 B;  3BWK A;  3IUT A;  4WA6 A;  2E00 A;  3PNR A;  4A0C D;  1F29 A;  3LFY A;  5H1V A;  2XU5 A;  3TNX A;  3ZPV E;  5LKU A;  1FH0 A;  1EF7 A;  4YV8 A;  3IOQ A;  4PAD A;  4CZW A;  2AN6 A;  2CSY A;  3RPG C;  1XWH A;  2VNF A;  2E03 A;  3M63 A;  2FT2 A;  2YYR A;  1RMD A;  4L58 A;  2YT5 A;  5B79 A;  3FL2 A;  5G05 B;  2CKL A;  4X6I A;  2YRE A;  3H6S A;  2XU1 A;  2R9O A;  5B76 A;  1BOR A;  1WES A;  5FB1 A;  1XKG A;  2FYE A;  1BGO A;  4N4Z A;  2VPB A;  3VK6 A;  3BOW A;  1VSN A;  3ASL A;  1A6R A;  1MIR A;  2E02 A;  1VFY A;  1ZCM A;  1CQD A;  2YJ8 A;  2FUI A;  2VPD A;  3PHD A;  1YK7 A;  1EWL A;  3U8E A;  2JQG R;  2DJF B;  5TBN A;  2CKL B;  3HCS A;  2YUC A;  4TKP B;  3KV5 A;  2KRE A;  5J3X A;  1PBH A;  1U9Q X;  3HCU A;  2OUL A;  2Y6E A;  1NL6 A;  2L80 A;  1U6G B;  1WIL A;  1TU6 A;  4YYQ A;  1KHQ A;  2NQG A;  1QDQ A;  2L5U A;  4KLB A;  4HWY A;  4YVA A;  3RVX A;  3ZTG A;  4XI1 A;  4S3O C;  5H1U A;  2M85 A;  3OVZ A;  4LKA A;  1CTE A;  2YJB A;  4YBM A;  3IEJ A;  3O0U A;  2QIC A;  1WGM A;  2DCA A;  5FPW A;  2IPP B;  2H7J A;  5CVO B;  3GV4 A;  3C9E A;  2F42 A;  1CSB B;  1AEC A;  2PBH A;  3WXF A;  3QJ3 A;  2M3H A;  4GNG A;  1U9X A;  1Z60 A;  3PBH A;  2YW8 A;  4V3L C;  5DIN A;  1ZBD B;  2ZET C;  2JMI A;  3OVX A;  4X6J A;  2EA6 A;  2PUY A;  1NLJ A;  8PCH A;  2YJ2 A;  3NG2 A;  1ME4 A;  5CVM A;  2F7D A;  2XU4 A;  3KSE A;  1S4V A;  3IMA A;  1WEE A;  3IHP A;  4YYV A;  4Q8H A;  1CS8 A;  4QF3 A;  2PNS A;  2LN0 A;  1WEM A;  5TRB A;  2PRE A;  3LRQ A;  1YVB A;  3O35 A;  3DF0 A;  1KXR A;  5LKZ A;  3BPF A;  1ME3 A;  3CH2 X;  3S3Q A;  2CB5 A;  1NB3 A;  4O64 A;  5I3L A;  2MA6 A;  1DEU A;  3V6E A;  3QZV A;  5FB0 A;  2JRJ A;  1WEN A;  2G7Y A;  4XR7 A;  2L0B A;  2DC8 A;  2IBI A;  5G04 B;  3M62 A;  2LQ6 A;  2VPE A;  2YUR A;  3LQJ A;  4OEM A;  4P6G A;  4FJC A;  2YQM A;  2MD7 B;  2FUD A;  2AYN A;  4BS5 A;  2NQA A;  2G43 A;  4N3W A;  1KHP A;  2M1R A;  2E6R A;  2NQI A;  3ZUA A;  1X9Y A;  4AXM A;  2ECI A;  3WXE A;  4QRV A;  1POP A;  3HTK C;  2DZY A;  2FQ9 A;  3QT4 A;  1CVZ A;  5CVN B;  4YYW A;  1BP4 A;  2Y1M A;  1YK8 A;  3KV6 A;  4LJN A;  2FSA A;  1Z6U A;  2KWN A;  4MSX A;  4XUI A;  3ZNI A;  1JQP A;  2AUZ A;  3DQV R;  2LGL A;  2P86 A;  2FRQ A;  3S3R A;  1QMY A;  4P6E A;  2AS8 A;  3LXS A;  3KWB X;  4OEL A;  4CDF B;  2G6D A;  2BAY A;  2KR4 A;  2AYO A;  2DJG B;  2R9C A;  2ECG A;  2YJC A;  1CHC A;  1G25 A;  4WZ3 B;  2K4D A;  4AUQ B;  3ERV A;  2KGI A;  2YSM A;  3ZVY A;  1AIM A;  2R9N A;  3MTN A;  2O6X A;  2BDL A;  2CT2 A;  2KFT A;  4NN2 A;  4BBQ A;  2LXP C;  1NPZ A;  2HDP A;  3CBK A;  4YAD A;  2Y1N A;  1ICF A;  2L75 A;  1U9V A;  2H0D A;  5EYA F;  3L11 A;  1BQI A;  2XU3 A;  3OF8 A;  2YJ9 A;  2D8S A;  1Y4H A;  3HD3 A;  2VPG A;  4YAB A;  1IYM A;  1K3B B;  1YAL A;  1IWD A;  4YAX A;  3EB5 A;  1PPP A;  1WFK A;  3LQH A;  4GND A;  2DCB A;  4B7Y C;  3T7L A;  5JA7 A;  1SNK A;  3GL6 A;  4C9Z A;  3KX1 A;  2MA5 A;  1GCB A;  2M6M A;  1PPO A;  3O33 A;  2H0D B;  2VJF A;  2LGK A;  3PUR A;  3RTR B;  1X4U A;  5KH7 A;  5G0F A;  3N9Q A;  3I2D A;  2YHN A;  3MHH A;  5TDR A;  3KWZ A;  2ECN A;  3O1G A;  4QRX A;  4FIP A;  5TAB A;  2K17 A;  1N87 A;  4W5B A;  4YAT A;  5EF4 A;  2HH5 A;  2CSZ A;  4I7C A;  1WEU A;  2XB1 A;  4LK9 A;  3NHE A;  4K7C A;  4MZO A;  3L1Z B;  2VJF B;  1NB5 A;  2EOD A;  5LCW B;  2VP7 A;  2HYE D;  1ITO A;  2C2L A;  5A24 A;  1NQC A;  1PAD A;  3RVW A;  3HHI A;  3N9L A;  1F62 A;  2F6J A;  3HHA A;  3V6C A;  1DF0 A;  3N9N A;  2LV9 A;  4IC2 A;  5EGW A;  2RSD A;  4CCG X;  2LDR A;  4Q8G A;  5B8D A;  1GLO A;  4BHW A;  3I06 A;  4Q6F A;  1LDK C;  4UI9 B;  1WE9 A;  3C6W A;  1AU3 A;  3F5V A;  6PAD A;  3HCT A;  5C13 A;  3N3G A;  4I7D A;  4I7B A;  4AYC A;  5CHT A;  5B77 A;  1EWO A;  2K16 A;  1YT7 A;  2ATO A;  3U5N A;  2R9M A;  4PP2 E;  4B86 C;  3V43 A;  4AXL A;  4CDE B;  2ECJ A;  1AU4 A;  2F6N A;  1WEV A;  1AYU A;  2NQD B;  2FTD A;  2DCC A;  3KW9 A;  4MVT A;  2YU4 A;  4GNF A;  1MM2 A;  2DX8 A;  4YC9 A;  4AYC B;  1STF E;  1DVP A;  2PNX A;  2DC7 A;  4PP1 A;  3BPM A;  1PPN A;  4BPV A;  1BY8 A;  4UP5 A;  3GCB A;  2QJ0 A;  5LKX A;  2MUM A;  3OF9 A;  4WZ2 A;  1WEP A;  5D1L B;  3RPG B;  2DC9 A;  4MZS A;  1AU0 A;  1CPJ A;  2E01 A;  4YYR A;  4AP4 A;  1LDJ B;  4R7E A;  1E4U A;  5D1K B;  3H7D A;  5H1T A;  2KIZ A;  2DC6 A;  1QOL A;  1Y08 A;  3O37 A;  2E6S A;  1PPD A;  3P5X A;  1FBV A;  4QBB A;  4QH6 A;  1GEC E;  1SP4 B;  4BQV A;  5H9M A;  1KFU L;  1AYV A;  2UZG A;  2KE1 A;  2FUU A;  5J94 A;  3U5M A;  4A4C A;  4GNE A;  3M99 A;  2QIZ A;  4N4F A;  4QF2 A;  2B1M A;  1MEG A;  4UP0 A;  5D1M B;  4LLB A;  4N79 A;  4R8P K;  1WEQ A;  2FRA A;  2KYU A;  3H8C A;  3F75 A;  2OP3 A;  3HWN A;  3ZVZ B;  2JQF R;  4GB0 A;  4PPE A;  2RI7 A;  2VHS A;  3O36 A;  4YYU A;  3KQI A;  3EB6 A;  3PW3 A;  4YYS A;  4YBS A;  2EGP A;  1MHW A;  5B75 A;  2MNZ A;  4R2Y A;  1CB5 A;  1GMY A;  1CV8 A;  2AU1 A;  2LRI C;  3N9P A;  1WIM A;  4S3O B;  2MD8 C;  4A4B A;  2FO5 A;  1X4J A;  4L7X A;  3K9M A;  1X4I A;  4G54 A;  2YSJ A;  4W5C A;  4CDC B;  5FEY A;  3SOX A;  3SOU A;  2R9F A;  4ZDT A;  7PCK A;  4W4U A;  1PIP A;  4DMY A;  1FP0 A;  4PI3 A;  1CJL A;  5DKA A;  4N8W A;  3H8B A;  3P5U A;  1TL9 A;  3O70 A;  3K24 A;  3CBJ A;  3N3K A;  1QXP A;  1ATK A;  2P7U A;  2LGG A;  2YHO A;  1F2B A;  1MEM A;  1V87 A;  2ARY A;  5CHV A;  2Y5B A;  3PUQ A;  2F1G A;  2G8J A;  4CDD B;  2PAD A;  3O34 A;  3U5P A;  1KFX L;  2ECV A;  3LQI A;  3C5K A;  4LAD B;  2AUX A;  1JM7 A;  2KWJ A;  3AI8 A;  4FK5 A;  3RVV A;  2ECT A;  1VJV A;  3ZYQ A;  1EWM A;  3N9M A;  1EWP A;  1JOC A;  1PCI A;  2WBF X;  2MT5 A;  4BS6 A;  1T1H A; 
#chains in the Genus database with same CATH topology
 1HYJ A;  2IDA A;  1U9W A;  4I05 A;  3SHB A;  4PTB A;  2I50 A;  1F2A A;  2OZ2 A;  3BCN A;  5TDW A;  3T6R A;  4I07 A;  1F2C A;  4X3G A;  2OWA A;  5PAD A;  3H89 A;  4D8E A;  3P5V A;  3U5O A;  5K16 A;  2LXH C;  3N9O A;  4ZQL A;  2HXZ A;  2JMJ A;  2JMD A;  3MOR A;  3DPL R;  1JM7 B;  4OGE A;  2HD5 A;  2MNY A;  4Z0O A;  4BSQ A;  4WZ0 A;  2KWO A;  2YQL A;  3D6S A;  5KH9 A;  1HYI A;  1MDW A;  2FFW A;  3WXG A;  2C2V S;  3N4C A;  3KKU A;  3SOW A;  2BU3 A;  4YBT A;  5SVX A;  3PHU A;  4CA1 A;  1TLO A;  2AVW A;  2NAA A;  4IC3 A;  4DMX A;  5AIT A;  3O7A A;  2BDZ A;  2G45 A;  4RY2 A;  2ACT A;  5SVI A;  2CIO A;  4D8I A;  2JRI A;  2HHN A;  2DZZ A;  4A49 A;  3PRM A;  2CRW A;  4AVX A;  1MS6 A;  2LAU A;  2KWK A;  2LGV A;  2XOY A;  2G8E A;  2RR4 A;  3CH3 X;  3KNV A;  3LJU X;  1O0E A;  3E2D A;  3PHX A;  1Z2Q A;  2P0R A;  2XEU A;  5LKT A;  3P5W A;  1WEW A;  4ZUX U;  2KU3 A;  1WEO A;  2GHU A;  3PDF A;  2Y43 A;  2DCD A;  2KKX A;  2VJE A;  1VD4 A;  3KFQ A;  4GUA A;  2B1N A;  5SVI B;  3FJU B;  2C0Y A;  1VYX A;  4A5U A;  1AYW A;  4FO9 A;  1MM3 A;  3E1Z B;  5JH3 A;  5C11 A;  2VHF A;  3L1X A;  4QRG A;  2OXQ C;  5B78 A;  2L43 A;  4IP3 A;  3ZPV 1;  1Q6K A;  9PAP A;  5SVY A;  3MHS A;  1HUC B;  3I3T A;  2ECW A;  3LDY A;  4IUM A;  3OQC A;  1PXV A;  4X6H A;  1PE6 A;  2VJE B;  3O47 A;  2KGG A;  2R6N A;  1U5I A;  4P5O B;  3BC3 A;  3IV2 A;  5AIU A;  1M6D A;  2AIM A;  3E9S A;  3QSD A;  5FER A;  1K2F A;  2G6Q A;  2K1J A;  5F02 A;  1ZIV A;  5KH3 A;  3USV A;  2DOS A;  1AU2 A;  3K8U A;  3B79 A;  4V3K C;  5JG6 A;  2GFO A;  1THE A;  3OIS A;  5EZS A;  4I04 A;  2MIQ A;  4F52 B;  3BWK A;  3IUT A;  4WA6 A;  2E00 A;  4OW0 A;  3PNR A;  4A0C D;  3LVR E;  1F29 A;  3LFY A;  5H1V A;  2XU5 A;  3TNX A;  3ZPV E;  5LKU A;  1FH0 A;  1EF7 A;  4YV8 A;  3IOQ A;  4PAD A;  2JUN A;  4CZW A;  2AN6 A;  2CSY A;  3RPG C;  4BOZ A;  1XWH A;  2VNF A;  2E03 A;  3M63 A;  2FT2 A;  2YYR A;  1RMD A;  4L58 A;  2YT5 A;  5B79 A;  3FL2 A;  5G05 B;  2CKL A;  4X6I A;  2YRE A;  3H6S A;  2XU1 A;  2R9O A;  5B76 A;  1BOR A;  1WES A;  5FB1 A;  1XKG A;  2FYE A;  1BGO A;  4N4Z A;  2VPB A;  3VK6 A;  3BOW A;  1VSN A;  3ASL A;  1A6R A;  1MIR A;  2E02 A;  1VFY A;  1ZCM A;  1CQD A;  2YJ8 A;  2FUI A;  2VPD A;  3PHD A;  1YK7 A;  1EWL A;  3U8E A;  2JQG R;  2DJF B;  5TBN A;  2CKL B;  3HCS A;  2YUC A;  4TKP B;  2UZJ A;  3KV5 A;  2KRE A;  5J3X A;  1PBH A;  1U9Q X;  3HCU A;  2OUL A;  2Y6E A;  1NL6 A;  2L80 A;  1U6G B;  1WIL A;  1TU6 A;  4YYQ A;  1KHQ A;  2NQG A;  1QDQ A;  2L5U A;  4KLB A;  4HWY A;  4OVZ A;  4YVA A;  3RVX A;  3ZTG A;  4XI1 A;  4S3O C;  5H1U A;  2M85 A;  3OVZ A;  4LKA A;  1CTE A;  2YJB A;  4YBM A;  3IEJ A;  3O0U A;  2EGM A;  2QIC A;  3MP2 A;  1WGM A;  2DCA A;  5FPW A;  2IPP B;  2H7J A;  5CVO B;  3GV4 A;  3TRK A;  3C9E A;  5E6J A;  4M0W A;  2F42 A;  1CSB B;  1AEC A;  4OVZ B;  2PBH A;  1UKF A;  3QJ3 A;  2M3H A;  4GNG A;  1U9X A;  3WXF A;  1Z60 A;  3W31 A;  2DJA A;  3PBH A;  2YW8 A;  4V3L C;  1ZBD B;  2ZET C;  5DIN A;  2JMI A;  2M13 A;  3OVX A;  2JM3 A;  4X6J A;  2EA6 A;  2PUY A;  1NLJ A;  8PCH A;  2YJ2 A;  3NG2 A;  3FAN A;  4RKX A;  1ME4 A;  5CVM A;  2F7D A;  2XU4 A;  3KSE A;  3C0R A;  1S4V A;  3DWD A;  3IMA A;  1WEE A;  3IHP A;  4YYV A;  4Q8H A;  3SUB A;  1MBM A;  1CS8 A;  4WUR A;  4QF3 A;  2PNS A;  3PHW A;  2LN0 A;  1WEM A;  5TRB A;  3B21 A;  2PRE A;  3LRQ A;  1YVB A;  3O35 A;  3DF0 A;  1KXR A;  5LKZ A;  4REZ A;  3BPF A;  1ME3 A;  3CH2 X;  3S3Q A;  2CB5 A;  1NB3 A;  4O64 A;  5I3L A;  2MA6 A;  1DEU A;  5JZE A;  3V6E A;  3QZV A;  5FB0 A;  2EXU A;  2JRJ A;  1WEN A;  2G7Y A;  4XR7 A;  2L0B A;  2DC8 A;  3RNV A;  2IBI A;  5G04 B;  3M62 A;  2LQ6 A;  2VPE A;  2YUR A;  3LQJ A;  4OEM A;  4P6G A;  4FJC A;  2YQM A;  2MD7 B;  2FUD A;  2AYN A;  3FEH A;  4BS5 A;  2NQA A;  4N3W A;  2G43 A;  1KHP A;  2M1R A;  2E6R A;  2NQI A;  3MJ5 A;  1X9Y A;  3ZUA A;  2ECI A;  3WXE A;  4AXM A;  4HXD B;  4QRV A;  2HWK A;  1POP A;  3HTK C;  2DZY A;  2FQ9 A;  3QT4 A;  1CVZ A;  5CVN B;  4YYW A;  1BP4 A;  2Y1M A;  1YK8 A;  5KO3 A;  2J7Q A;  3KV6 A;  4LJN A;  2FSA A;  1Z6U A;  2KWN A;  4MSX A;  4XUI A;  3ZNI A;  1JQP A;  2AUZ A;  3DQV R;  1PVJ A;  2LGL A;  2P86 A;  3FAO A;  2FRQ A;  3S3R A;  1QMY A;  4ZTB A;  4P6E A;  2AS8 A;  3LXS A;  1DCQ A;  3KWB X;  4OEL A;  4CDF B;  2G6D A;  2BAY A;  2KR4 A;  2AYO A;  2DJG B;  3BBA A;  2R9C A;  2ECG A;  3MDB C;  2YJC A;  1CHC A;  1G25 A;  4WZ3 B;  2K4D A;  4AUQ B;  3ERV A;  2P57 A;  2KGI A;  2YSM A;  3ZVY A;  1AIM A;  2R9N A;  3MTN A;  2O6X A;  4MI7 A;  5EZQ A;  2BDL A;  2CT2 A;  2KFT A;  2YVR A;  5K3Q A;  4NN2 A;  4BBQ A;  4H9D A;  2LXP C;  1NPZ A;  2HDP A;  3CBK A;  4YAD A;  2Y1N A;  1ICF A;  2L75 A;  1U9V A;  2H0D A;  5EYA F;  3L11 A;  1BQI A;  2XU3 A;  4RF0 A;  3OF8 A;  2YJ9 A;  2D8S A;  1Y4H A;  3HD3 A;  2VPG A;  4YAB A;  1IYM A;  1K3B B;  1YAL A;  1IWD A;  4YAX A;  3EB5 A;  1PPP A;  1WFK A;  3LQH A;  4GND A;  2DCB A;  4B7Y C;  3BB7 A;  4XZX A;  3T7L A;  5JA7 A;  2BTW B;  1SNK A;  3GL6 A;  4C9Z A;  3KX1 A;  2MA5 A;  1GCB A;  2M6M A;  1PPO A;  2E61 A;  2H0D B;  2VJF A;  2LGK A;  3O33 A;  3PUR A;  3DDT A;  3RTR B;  1X4U A;  5KH7 A;  5G0F A;  3N9Q A;  3I2D A;  2YHN A;  3MHH A;  5TDR A;  3TMP A;  2Z84 A;  3LVQ E;  3KWZ A;  2ECN A;  3PSE A;  2AGA A;  3O1G A;  4QRX A;  4FIP A;  5TAB A;  2K17 A;  1N87 A;  2XOZ A;  4YAT A;  4W5B A;  5EF4 A;  2HH5 A;  2CSZ A;  4I7C A;  1WEU A;  2FD4 A;  2XB1 A;  4LK9 A;  3NHE A;  4BOQ A;  4K7C A;  4MZO A;  3L1Z B;  2D8U A;  2VJF B;  1NB5 A;  2EOD A;  5LCW B;  2VP7 A;  2JTC A;  2HYE D;  1ITO A;  3KDE C;  2C2L A;  5A24 A;  1NQC A;  1PAD A;  3Q1D A;  2KKY A;  3RVW A;  3HHI A;  3N9L A;  1F62 A;  2F6J A;  3HHA A;  1YZB A;  3V6C A;  2L7P A;  1DF0 A;  3N9N A;  2LV9 A;  4IC2 A;  5EGW A;  3MTV A;  2RSD A;  4CCG X;  2LDR A;  4BOP A;  4Q8G A;  5B8D A;  1GLO A;  4BHW A;  3I06 A;  4Q6F A;  4O62 A;  1LDK C;  4RF1 A;  1WE9 A;  3C6W A;  4UI9 B;  1AU3 A;  3F5V A;  6PAD A;  3HCT A;  4D8B A;  5C13 A;  3N3G A;  4I7D A;  4I7B A;  4AYC A;  5CHT A;  5B77 A;  1EWO A;  2K16 A;  1YT7 A;  2ATO A;  3U5N A;  2IQJ A;  2R9M A;  4PP2 E;  3M7K A;  4B86 C;  3FM8 C;  3V43 A;  4AXL A;  4CDE B;  2ECJ A;  1AU4 A;  2F6N A;  1WEV A;  1AYU A;  2NQD B;  2FTD A;  2DCC A;  3KW9 A;  4MVT A;  2XOC A;  2YU4 A;  4R3D A;  4GNF A;  1MM2 A;  2DX8 A;  4YC9 A;  4AYC B;  1STF E;  1DVP A;  2PNX A;  2DC7 A;  4PP1 A;  3BPM A;  1PPN A;  4BPV A;  1BY8 A;  4UP5 A;  3GCB A;  3PRP A;  2QJ0 A;  5LKX A;  2MUM A;  3OF9 A;  4BOS A;  4WZ2 A;  1WEP A;  5D1L B;  3RPG B;  2DC9 A;  4MZS A;  4RNA A;  1AU0 A;  1CPJ A;  2E01 A;  4YYR A;  3T9K A;  4AP4 A;  1LDJ B;  4R7E A;  4MM3 B;  1E4U A;  5D1K B;  3W30 A;  2MKE A;  3H7D A;  5H1T A;  2KIZ A;  2FE8 A;  2DC6 A;  1QOL A;  1Y08 A;  3O37 A;  2E6S A;  1PPD A;  3P5X A;  1FBV A;  4QBB A;  4QH6 A;  1GEC E;  1SP4 B;  4BQV A;  5H9M A;  1KFU L;  1AYV A;  2UZG A;  2KE1 A;  2FUU A;  4OGC A;  3O65 A;  5J94 A;  3U5M A;  4A4C A;  4GNE A;  3M99 A;  2QIZ A;  4N4F A;  4QF2 A;  2B1M A;  1MEG A;  4UP0 A;  5D1M B;  4LLB A;  4N79 A;  4QQ4 A;  4R8P K;  1WEQ A;  2FRA A;  2KYU A;  3H8C A;  3F75 A;  2OP3 A;  3HWN A;  3ZVZ B;  2JQF R;  4GB0 A;  4PPE A;  2RI7 A;  2VHS A;  3O36 A;  4YYU A;  3KQI A;  3EB6 A;  2BTW A;  3PW3 A;  4YYS A;  4YBS A;  2EGP A;  1DKI A;  1MHW A;  5B75 A;  2MNZ A;  2CON A;  4R2Y A;  1CB5 A;  1GMY A;  1CV8 A;  2AU1 A;  2LRI C;  3N9P A;  1WIM A;  4S3O B;  2MD8 C;  4A4B A;  2FO5 A;  1X4J A;  4L7X A;  3K9M A;  1X4I A;  4G54 A;  2YSJ A;  4W5C A;  4CDC B;  2XP0 A;  5FEY A;  3SOX A;  3SOU A;  2R9F A;  4P16 A;  4ZDT A;  7PCK A;  4BOU A;  4W4U A;  3IFU A;  1PIP A;  2CRR A;  4DMY A;  1FP0 A;  3PLW A;  1CJL A;  5DKA A;  4N8W A;  4PI3 A;  3H8B A;  3P5U A;  1TL9 A;  3O70 A;  2DSM A;  3K24 A;  3CBJ A;  3N3K A;  3JUE A;  1QXP A;  1ATK A;  4Z0R A;  2P7U A;  2LGG A;  2YHO A;  1F2B A;  1MEM A;  1V87 A;  2ARY A;  5CHV A;  2Y5B A;  3BY4 A;  3PUQ A;  2F1G A;  2G8J A;  4CDD B;  2PAD A;  3O34 A;  3U5P A;  1KFX L;  2ECV A;  3H7H A;  3LQI A;  2CSV A;  3C5K A;  2J7Q C;  4LAD B;  2AUX A;  1JM7 A;  2KWJ A;  3AI8 A;  4FK5 A;  3RVV A;  2ECT A;  1VJV A;  4PT5 A;  3ZYQ A;  1EWM A;  2B0O E;  3N9M A;  4F1P A;  1JOC A;  1EWP A;  1PCI A;  2MT5 A;  2WBF X;  3ZNH A;  4BS6 A;  1T1H A;  3PT2 A; 
#chains in the Genus database with same CATH homology
 1HYJ A;  2IDA A;  1U9W A;  4I05 A;  3SHB A;  4PTB A;  2I50 A;  1F2A A;  2OZ2 A;  3BCN A;  5TDW A;  3T6R A;  4I07 A;  1F2C A;  4X3G A;  5PAD A;  3H89 A;  3P5V A;  3U5O A;  5K16 A;  2LXH C;  3N9O A;  4ZQL A;  2HXZ A;  2JMJ A;  2JMD A;  3MOR A;  3DPL R;  1JM7 B;  2HD5 A;  2MNY A;  4BSQ A;  4WZ0 A;  2KWO A;  2YQL A;  3D6S A;  5KH9 A;  1HYI A;  1MDW A;  3WXG A;  2C2V S;  3N4C A;  3KKU A;  3SOW A;  4YBT A;  4CA1 A;  1TLO A;  2AVW A;  2NAA A;  4IC3 A;  4DMX A;  5AIT A;  3O7A A;  2BDZ A;  2G45 A;  4RY2 A;  2ACT A;  2CIO A;  1E2T A;  2HHN A;  4NV8 A;  2DZZ A;  4A49 A;  4AVX A;  1MS6 A;  2KWK A;  2LGV A;  2G8E A;  3CH3 X;  3KNV A;  1O0E A;  1Z2Q A;  2P0R A;  2XEU A;  5LKT A;  3P5W A;  1WEW A;  4ZUX U;  2KU3 A;  1WEO A;  2GHU A;  4BGF A;  3PDF A;  2Y43 A;  2DCD A;  2VJE A;  1VD4 A;  3KFQ A;  2B1N A;  2C0Y A;  1VYX A;  1AYW A;  1MM3 A;  4FO9 A;  3E1Z B;  5JH3 A;  5C11 A;  2VHF A;  3L1X A;  4QRG A;  2OXQ C;  5B78 A;  2L43 A;  3ZPV 1;  1Q6K A;  9PAP A;  3MHS A;  1HUC B;  3I3T A;  2ECW A;  1PXV A;  4X6H A;  1PE6 A;  2VJE B;  2KGG A;  2R6N A;  1U5I A;  4P5O B;  3BC3 A;  3IV2 A;  5AIU A;  1M6D A;  2AIM A;  3QSD A;  5FER A;  1K2F A;  2G6Q A;  2K1J A;  5F02 A;  1ZIV A;  5KH3 A;  3USV A;  1AU2 A;  3K8U A;  3B79 A;  4V3K C;  5JG6 A;  2GFO A;  1THE A;  3OIS A;  4I04 A;  2MIQ A;  4F52 B;  3BWK A;  3IUT A;  4WA6 A;  2E00 A;  3PNR A;  4A0C D;  1F29 A;  3LFY A;  1W4T A;  5H1V A;  2XU5 A;  3TNX A;  3ZPV E;  5LKU A;  1FH0 A;  1EF7 A;  4YV8 A;  3IOQ A;  4PAD A;  4CZW A;  2AN6 A;  2CSY A;  3RPG C;  1XWH A;  2VNF A;  2E03 A;  3M63 A;  2FT2 A;  2YYR A;  1RMD A;  4L58 A;  2YT5 A;  5B79 A;  3FL2 A;  5G05 B;  2CKL A;  4X6I A;  2YRE A;  4C5P A;  3H6S A;  2XU1 A;  2R9O A;  5B76 A;  1BOR A;  1WES A;  5FB1 A;  1XKG A;  2FYE A;  1BGO A;  4N4Z A;  2VPB A;  3VK6 A;  3BOW A;  1VSN A;  3ASL A;  1A6R A;  1MIR A;  2VFB A;  2E02 A;  1VFY A;  1ZCM A;  1CQD A;  2YJ8 A;  2FUI A;  2VPD A;  3PHD A;  1YK7 A;  1EWL A;  3U8E A;  2JQG R;  2DJF B;  5TBN A;  2CKL B;  3HCS A;  2YUC A;  4TKP B;  3KV5 A;  2KRE A;  5J3X A;  1PBH A;  1U9Q X;  3HCU A;  2OUL A;  2Y6E A;  1NL6 A;  2L80 A;  1U6G B;  1WIL A;  1TU6 A;  4YYQ A;  1KHQ A;  2NQG A;  1QDQ A;  2L5U A;  4KLB A;  4HWY A;  4YVA A;  3RVX A;  3ZTG A;  4XI1 A;  4S3O C;  5H1U A;  2M85 A;  3OVZ A;  4LKA A;  1CTE A;  2YJB A;  4YBM A;  3IEJ A;  3O0U A;  2QIC A;  1WGM A;  2DCA A;  5FPW A;  2IPP B;  2H7J A;  5CVO B;  3GV4 A;  3C9E A;  2F42 A;  1CSB B;  3LTW A;  1AEC A;  2PBH A;  3WXF A;  3QJ3 A;  2M3H A;  4GNG A;  1U9X A;  1Z60 A;  3PBH A;  2YW8 A;  4V3L C;  5DIN A;  1ZBD B;  2ZET C;  2JMI A;  3OVX A;  4X6J A;  2EA6 A;  2PUY A;  1NLJ A;  8PCH A;  2YJ2 A;  3NG2 A;  1ME4 A;  5CVM A;  2F7D A;  2XU4 A;  3KSE A;  1S4V A;  3IMA A;  1WEE A;  3IHP A;  4YYV A;  4Q8H A;  1W5R A;  1CS8 A;  4QF3 A;  2PNS A;  2LN0 A;  1WEM A;  5TRB A;  2PRE A;  3LRQ A;  1YVB A;  3O35 A;  3DF0 A;  1KXR A;  5LKZ A;  2VFC A;  3BPF A;  1ME3 A;  3CH2 X;  3S3Q A;  2CB5 A;  1NB3 A;  4O64 A;  5I3L A;  2MA6 A;  1DEU A;  3V6E A;  3QZV A;  5FB0 A;  2JRJ A;  1WEN A;  2G7Y A;  4XR7 A;  2L0B A;  2DC8 A;  2IBI A;  5G04 B;  3M62 A;  2LQ6 A;  2VPE A;  2YUR A;  3LQJ A;  4OEM A;  4P6G A;  4FJC A;  2YQM A;  2MD7 B;  2FUD A;  2AYN A;  4BS5 A;  2NQA A;  2G43 A;  4N3W A;  1KHP A;  2M1R A;  2BSZ A;  2E6R A;  2NQI A;  4GUZ A;  1X9Y A;  3ZUA A;  2ECI A;  3WXE A;  4AXM A;  4QRV A;  1POP A;  3HTK C;  2DZY A;  2FQ9 A;  3QT4 A;  1CVZ A;  5CVN B;  4YYW A;  1BP4 A;  2Y1M A;  1YK8 A;  3KV6 A;  4LJN A;  2FSA A;  1Z6U A;  2KWN A;  4MSX A;  4XUI A;  3ZNI A;  1JQP A;  2AUZ A;  3DQV R;  2LGL A;  2P86 A;  2FRQ A;  3S3R A;  1QMY A;  4P6E A;  2AS8 A;  3LXS A;  3KWB X;  4OEL A;  4CDF B;  2G6D A;  2BAY A;  2KR4 A;  2AYO A;  2DJG B;  2R9C A;  2ECG A;  2YJC A;  1CHC A;  1G25 A;  4WZ3 B;  2K4D A;  4AUQ B;  3ERV A;  2KGI A;  2YSM A;  3ZVY A;  1AIM A;  2R9N A;  3MTN A;  2O6X A;  2BDL A;  2CT2 A;  2KFT A;  4NN2 A;  4BBQ A;  2LXP C;  1NPZ A;  2HDP A;  3CBK A;  4YAD A;  2Y1N A;  1ICF A;  2L75 A;  1U9V A;  2H0D A;  5EYA F;  3L11 A;  1BQI A;  2XU3 A;  3OF8 A;  2YJ9 A;  2D8S A;  1Y4H A;  3HD3 A;  2VPG A;  4YAB A;  1IYM A;  1K3B B;  1YAL A;  1IWD A;  4YAX A;  3EB5 A;  1PPP A;  1WFK A;  3LQH A;  4GND A;  2DCB A;  4B7Y C;  3T7L A;  5JA7 A;  1SNK A;  3GL6 A;  4C9Z A;  3KX1 A;  2MA5 A;  1GCB A;  2M6M A;  1PPO A;  3O33 A;  2H0D B;  2VJF A;  2LGK A;  3PUR A;  3RTR B;  1X4U A;  5KH7 A;  5G0F A;  3N9Q A;  3I2D A;  2YHN A;  3MHH A;  5TDR A;  3KWZ A;  2ECN A;  3O1G A;  4QRX A;  4FIP A;  5TAB A;  2K17 A;  1N87 A;  4W5B A;  4YAT A;  5EF4 A;  2HH5 A;  2CSZ A;  4I7C A;  1WEU A;  2XB1 A;  4LK9 A;  3NHE A;  4K7C A;  4MZO A;  3L1Z B;  2VJF B;  1NB5 A;  2EOD A;  5LCW B;  2VP7 A;  2HYE D;  1ITO A;  2C2L A;  5A24 A;  1NQC A;  1PAD A;  3RVW A;  3HHI A;  3N9L A;  1F62 A;  2F6J A;  3HHA A;  3V6C A;  1DF0 A;  3N9N A;  2LV9 A;  4IC2 A;  5EGW A;  2RSD A;  4CCG X;  2LDR A;  4Q8G A;  5B8D A;  1GLO A;  4BHW A;  3I06 A;  4Q6F A;  1LDK C;  4B55 A;  4UI9 B;  1WE9 A;  3C6W A;  1AU3 A;  3F5V A;  6PAD A;  3HCT A;  5C13 A;  3N3G A;  4I7D A;  4I7B A;  4AYC A;  5CHT A;  5B77 A;  1EWO A;  2K16 A;  1YT7 A;  2ATO A;  3U5N A;  2R9M A;  4PP2 E;  4B86 C;  3V43 A;  4AXL A;  4CDE B;  2ECJ A;  1AU4 A;  2F6N A;  1WEV A;  1AYU A;  2NQD B;  2FTD A;  2DCC A;  3KW9 A;  4MVT A;  2YU4 A;  4GNF A;  1MM2 A;  2DX8 A;  4YC9 A;  4AYC B;  1STF E;  3D9W A;  1DVP A;  2PNX A;  2DC7 A;  4PP1 A;  3BPM A;  1PPN A;  4BPV A;  1BY8 A;  4UP5 A;  3GCB A;  2QJ0 A;  5LKX A;  2MUM A;  3OF9 A;  4WZ2 A;  1WEP A;  5D1L B;  3RPG B;  2DC9 A;  4MZS A;  1AU0 A;  1CPJ A;  2E01 A;  4YYR A;  4AP4 A;  1LDJ B;  4R7E A;  1E4U A;  5D1K B;  3H7D A;  5H1T A;  2KIZ A;  2DC6 A;  1QOL A;  1Y08 A;  3O37 A;  2E6S A;  1PPD A;  3P5X A;  1FBV A;  4QBB A;  4QH6 A;  1GEC E;  1GX3 A;  1SP4 B;  4BQV A;  5H9M A;  1KFU L;  1AYV A;  2UZG A;  2KE1 A;  2FUU A;  4NV7 A;  5J94 A;  3U5M A;  4A4C A;  4GNE A;  3M99 A;  2QIZ A;  4N4F A;  4QF2 A;  2B1M A;  1MEG A;  4UP0 A;  5D1M B;  4LLB A;  4N79 A;  4R8P K;  1WEQ A;  2FRA A;  2KYU A;  3H8C A;  3F75 A;  2OP3 A;  3HWN A;  3ZVZ B;  2JQF R;  4GB0 A;  4PPE A;  2RI7 A;  2VHS A;  3O36 A;  4YYU A;  3KQI A;  3EB6 A;  3PW3 A;  4YYS A;  4YBS A;  2EGP A;  1MHW A;  5B75 A;  2MNZ A;  4R2Y A;  1CB5 A;  1GMY A;  1CV8 A;  2AU1 A;  2LRI C;  3N9P A;  1WIM A;  4S3O B;  2MD8 C;  4A4B A;  2FO5 A;  1X4J A;  4L7X A;  3K9M A;  1X4I A;  4G54 A;  2YSJ A;  4W5C A;  4CDC B;  5FEY A;  3SOX A;  3SOU A;  2R9F A;  4ZDT A;  7PCK A;  4W4U A;  1PIP A;  4DMY A;  1FP0 A;  4PI3 A;  1CJL A;  5DKA A;  4N8W A;  3H8B A;  3P5U A;  1TL9 A;  3O70 A;  3K24 A;  3CBJ A;  3N3K A;  1QXP A;  1ATK A;  2P7U A;  2LGG A;  2YHO A;  1F2B A;  1MEM A;  1W6F A;  1V87 A;  2ARY A;  5CHV A;  2Y5B A;  3PUQ A;  2F1G A;  2G8J A;  4CDD B;  2PAD A;  3O34 A;  3U5P A;  1KFX L;  2ECV A;  3LQI A;  3C5K A;  4LAD B;  2AUX A;  1JM7 A;  2KWJ A;  3AI8 A;  4FK5 A;  3RVV A;  2ECT A;  1VJV A;  3ZYQ A;  1EWM A;  3N9M A;  1EWP A;  1JOC A;  1PCI A;  2WBF X;  2MT5 A;  4BS6 A;  1T1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...