4WA6A

Structure of yeast saga dubm with sgf73 n59d mutant at 2.36 angstroms resolution
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
471
structure length
440
Chain Sequence
MSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALNRQTGFIYLLTCAWKIQDAHEFWQFIINQIHQSYVLDLPNAKEVSRANNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNYHCGECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transcription
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
publication title Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
rcsb
source organism Saccharomyces cerevisiae
total genus 141
structure length 440
sequence length 471
chains with identical sequence D
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4wa6A01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4wa6A02
4W5BA 3ZNIA 2AYNA 2L0BA 5EF4A 1KXRA 4V3KC 2VP7A 1CJLA 1XWHA 2D8SA 2F42A 1YK7A 2NQAA 3WXEA 1MEGA 2E6RA 1XKGA 1MM2A 1MEMA 5TRBA 1GCBA 2OXQC 2O6XA 2VHFA 2YHNA 1F2BA 5FEYA 2ZETC 4PPEA 5KH7A 2C0YA 1QDQA 5CVNB 5PADA 5B77A 3CH3X 1F29A 2CKLA 3P5VA 2R9OA 3I3TA 3L1XA 3IHPA 2MD8C 3BC3A 2DCAA 2FRQA 3LQIA 4AP4A 3EB6A 2KU3A 2MNZA 3HHAA 3CBKA 3CH2X 2YJ9A 4CZWA 2YYRA 2HHNA 2YSJA 4CDCB 3U5MA 2JRJA 2E03A 1LDKC 1WESA 4A4CA 4V3LC 1Q6KA 3QT4A 3N9NA 4AUQB 5FERA 2L80A 4PP2E 3O34A 3BPFA 2KIZA 2C2LA 1MDWA 3B79A 3DPLR 4WZ0A 3D6SA 3SOXA 2M6MA 2ECJA 3M62A 1K2FA 1DVPA 3ZPV1 1WEVA 5D1LB 2R9NA 1CHCA 2AVWA 1ZBDB 2KWJA 1TL9A 2YJ2A 4GNFA 4LK9A 1EWLA 2G8JA 1NB5A 2XU5A 4YADA 1QOLA 3V6EA 2G7YA 2Y43A 1X4JA 1VSNA 2FUIA 2XB1A 4OELA 5A24A 4QRVA 3ZVYA 3O37A 5JG6A 4QBBA 4BS6A 3F5VA 2E6SA 4MSXA 3C5KA 4A4BA 1VJVA 2HH5A 2KREA 3KW9A 2YURA 3DQVR 4R8PK 1GECE 1G25A 4S3OC 4GB0A 1U5IA 2NQDB 2CB5A 3PUQA 4PADA 4K7CA 1IYMA 2ECNA 5I3LA 2K16A 1E4UA 2DX8A 3LRQA 4FJCA 3S3QA 4B86C 1DEUA 4YYVA 3RVXA 1N87A 3SOWA 3MORA 2ECIA 1WEQA 2MD7B 1BGOA 2ECGA 2RI7A 2MA6A 3OF9A 4I07A 4N4ZA 3AI8A 1AYWA 3MHHA 2KWKA 2NQIA 3KWZA 2YT5A 3KQIA 2FO5A 2YREA 4S3OB 1V87A 2KGIA 3H8BA 3T6RA 3U5PA 1WE9A 3CBJA 2R9CA 3PNRA 1AU0A 5FB1A 3PW3A 4WA6A 2VPGA 4X6HA 5CVOB 2UZGA 4YVAA 3ZYQA 1Z2QA 1GLOA 2AN6A 5TBNA 2LXHC 2G43A 2FUDA 3KNVA 4ZUXU 2KFTA 5B76A 3E1ZB 4X6IA 4LKAA 2EA6A 4FK5A 2C2VS 5KH3A 1RMDA 3KWBX 3IV2A 1TU6A 3K9MA 3GL6A 4DMYA 4XUIA 4YYQA 3HHIA 3H89A 1YK8A 2IBIA 3HCSA 3ZVZB 1HYIA 5H1VA 1AU3A 2F6NA 4MVTA 1NL6A 5FPWA 3RVWA 2G6DA 4HWYA 3IUTA 1KHPA 1JM7B 2XU1A 3LQJA 1MHWA 1QXPA 2ARYA 2DC9A 4BS5A 1ME4A 4XR7A 3HTKC 1CQDA 2Y1NA 3K8UA 2OP3A 1CS8A 2JMIA 2DZYA 2DC7A 2HD5A 5B8DA 2YW8A 2MIQA 5AITA 3PDFA 1O0EA 1EF7A 1NLJA 2EODA 1JQPA 2H0DA 4TKPB 1HUCB 1MM3A 2P7UA 2LXPC 3PHDA 3RTRB 3GV4A 1EWMA 4LLBA 2QIZA 1WENA 2FQ9A 2GFOA 4YABA 5LKXA 2LV9A 3OISA 4I05A 2B1MA 1AECA 2GHUA 1QMYA 5TDRA 2YQMA 3HCTA 3O70A 3H8CA 1VD4A 4BPVA 2BAYA 4N4FA 5J3XA 5EGWA 2DJGB 2L5UA 5H1UA 1WEEA 2Y1MA 4YV8A 4L58A 2E02A 1FH0A 2M3HA 1BORA 1PIPA 4PTBA 2OZ2A 3ZPVE 3BPMA 3RVVA 3PBHA 3H7DA 2VJEB 3O1GA 1CSBB 1CTEA 3BWKA 1WGMA 4C9ZA 2ECVA 4LADB 3KV6A 4N79A 4YBSA 4FIPA 1ITOA 3IEJA 3OF8A 4ZDTA 3N4CA 1PPDA 2PNXA 1YVBA 3BOWA 3F75A 7PCKA 1FP0A 2F1GA 3V43A 3IOQA 5FB0A 2DCDA 2DCCA 2FRAA 3DF0A 8PCHA 1PPNA 1AU2A 3ZTGA 3RPGC 4I7DA 2DJFB 4I7CA 4DMXA 2CT2A 1U6GB 5TDWA 2K17A 4GNDA 2MA5A 4GNEA 3KKUA 3SOUA 4W4UA 5DKAA 1CPJA 5EYAF 3U5OA 4CDEB 2IDAA 2YHOA 4BBQA 4GNGA 1WEMA 3IMAA 4CDDB 2IPPB 2KGGA 3NG2A 2CSYA 2L75A 2PADA 1WEOA 2VJEA 2NQGA 4UP5A 5C13A 1X4IA 4CDFB 4YYWA 2KWOA 4AXLA 4IC3A 1EWPA 3OVZA 4W5CA 5K16A 2PREA 4Q8GA 4I7BA 2VPDA 2AU1A 2FTDA 2YQLA 4X6JA 4O64A 3N9QA 2QICA 1FBVA 1S4VA 3RPGB 1PPOA 3QJ3A 3HWNA 3FL2A 2VJFB 3VK6A 3M99A 1Y4HA 4Q6FA 1U9WA 4YAXA 4MZOA 5G05B 3H6SA 2PNSA 2YJ8A 2YSMA 1CV8A 4QRGA 1DF0A 2KE1A 1VYXA 4OEMA 2P86A 2WBFX 2VNFA 2ATOA 1PBHA 2LQ6A 5DINA 1PE6A 2MUMA 4CCGX 3S3RA 2AUXA 2FUUA 4YYSA 3N9OA 3WXGA 4PP1A 1Y08A 5J94A 2YJCA 3I06A 1STFE 1Z6UA 3U5NA 4MZSA 2LN0A 1AIMA 4FO9A 4AVXA 2PBHA 1U9VA 1F2CA 1WEWA 2BDLA 4P6GA 2NAAA 3O33A 1ZCMA 3HD3A 3HCUA 1YT7A 2F7DA 3O35A 3N9MA 3QSDA 2XU3A 4L7XA 2R6NA 2VJFA 5G04B 4RY2A 1BY8A 2HYED 2JMJA 5B75A 4YATA 3I2DA 1AU4A 1PXVA 1BP4A 3GCBA 2RSDA 1IWDA 1TLOA 3KSEA 1WEPA 4R7EA 1U9QX 1KFUL 1VFYA 1THEA 4YYRA 3N3KA 2AYOA 2P0RA 1A6RA 3ERVA 2KYUA 2YJBA 4N3WA 2LDRA 2G8EA 3P5WA 1WEUA 2YU4A 1JM7A 2JMDA 3N9LA 3N9PA 2KR4A 2M85A 1CVZA 2DCBA 2R9FA 2LGGA 2XEUA 5TABA 2ECWA 4Q8HA 4YBMA 2BDZA 4AXMA 2EGPA 1ZIVA 1YALA 2K4DA 2JQGR 2FYEA 2AS8A 4KLBA 3V6CA 4AYCB 5JH3A 1X4UA 1F62A 2G6QA 2LGVA 4A49A 3LQHA 4ZQLA 4YYUA 3P5XA 1LDJB 2LGLA 2LGKA 3O7AA 1SNKA 3WXFA 5KH9A 3KV5A 4BHWA 2FSAA 5LKTA 2CSZA 1NB3A 1HYJA 1GMYA 1M6DA 3ASLA 5AIUA 5LCWB 4UP0A 3ZUAA 3O0UA 4BSQA 2MT5A 1PPPA 6PADA 4UI9B 5G0FA 1AYVA 3KFQA 1NPZA 2HXZA 4CA1A 1AYUA 4A0CD 1K3BB 4NN2A 5LKUA 3O36A 3C9EA 1ATKA 3QZVA 4QF3A 2VHSA 3SHBA 1EWOA 4P6EA 2F6JA 2Y5BA 3MHSA 3TNXA 3M63A 2KWNA 4AYCA 2E01A 4G54A 5CVMA 3N3GA 4R2YA 4QF2A 5B78A 1F2AA 3PURA 5C11A 4QRXA 3MTNA 2FT2A 4WZ2A 2Y6EA 3EB5A 2DC6A 3T7LA 2OULA 2DZZA 2YUCA 5D1KB 2R9MA 5JA7A 5F02A 4BQVA 5CHVA 3LFYA 2VPEA 1KHQA 4QH6A 2H7JA 2XU4A 1SP4B 1WIMA 2K1JA 2E00A 1WFKA 4XI1A 4N8WA 3BCNA 3L11A 5B79A 4PI3A 1ICFA 5H9MA 1BQIA 4IC2A 3USVA 2AIMA 3L1ZB 4LJNA 3U8EA 2ECTA 9PAPA 4I04A 2M1RA 3C6WA 1WILA 5H1TA 2MNYA 2CKLB 4WZ3B 2PUYA 4F52B 1ME3A 2I50A 4YC9A 1KFXL 3KX1A 2JQFR 4X3GA 1Z60A 2L43A 2LRIC 4B7YC 2QJ0A 1PADA 1PCIA 1X9YA 2B1NA 2DC8A 4YBTA 2ACTA 3OVXA 2G45A 2H0DB 5D1MB 1JOCA 1T1HA 2VPBA 3K24A 3LXSA 1NQCA 3P5UA 5CHTA 5LKZA 4P5OB 1CB5A 1POPA 2CIOA 3NHEA 2HDPA 1MS6A 1MIRA 2AUZA 1U9XA
chains in the Genus database with same CATH superfamily
4W5BA 3ZNIA 2AYNA 2L0BA 5EF4A 1KXRA 4V3KC 3KDEC 2VP7A 1CJLA 1XWHA 2D8SA 2F42A 1YK7A 2NQAA 3WXEA 1MEGA 4IUMA 2E6RA 1XKGA 4RKXA 1MM2A 1MEMA 5TRBA 4D8IA 1GCBA 2OXQC 2O6XA 2VHFA 2YHNA 2B0OE 2CSVA 3PLWA 1F2BA 5FEYA 2ZETC 4PPEA 5KH7A 2C0YA 1QDQA 5CVNB 5PADA 5B77A 4WURA 3CH3X 1F29A 3RNVA 2CKLA 3P5VA 2R9OA 2FE8A 3I3TA 3L1XA 2XP0A 3IHPA 2MD8C 2DCAA 2FRQA 3BC3A 3LQIA 4AP4A 3EB6A 2KU3A 2MNZA 3HHAA 3CBKA 4Z0OA 2YJ9A 3CH2X 2YYRA 2HHNA 2YSJA 4CZWA 4CDCB 3U5MA 2JRJA 2E03A 1LDKC 2M13A 1WESA 4A4CA 4V3LC 1Q6KA 4BOUA 3QT4A 3N9NA 4AUQB 5FERA 2L80A 4PP2E 3O34A 3BPFA 2KIZA 2C2LA 1MDWA 3B79A 3DPLR 2CONA 4WZ0A 3D6SA 3SOXA 4IP3A 2M6MA 2ECJA 3M62A 1K2FA 1DVPA 2KKXA 3ZPV1 1DCQA 1WEVA 5D1LB 2L7PA 1YZBA 1CHCA 2R9NA 2AVWA 2AGAA 1ZBDB 2KWJA 1TL9A 2YJ2A 4GNFA 3PHXA 4LK9A 1EWLA 2G8JA 1NB5A 2XU5A 4YADA 1QOLA 3V6EA 2G7YA 2Y43A 1X4JA 1VSNA 2FUIA 2XB1A 3PHWA 4OELA 5A24A 4QRVA 3ZVYA 3O37A 5JG6A 4QBBA 4BS6A 3F5VA 2E6SA 4MSXA 3C5KA 4A4BA 1VJVA 2HH5A 2KREA 3KW9A 3O47A 2YURA 3DQVR 4R8PK 1GECE 1G25A 4S3OC 4GB0A 1U5IA 2NQDB 2CB5A 3PUQA 4A5UA 4PADA 4K7CA 1IYMA 4OVZB 2ECNA 5I3LA 2K16A 1E4UA 4MM3B 2DX8A 3LRQA 4FJCA 3S3QA 4B86C 1DEUA 4YYVA 3RVXA 1N87A 3SOWA 3MORA 2ECIA 1WEQA 2MD7B 1BGOA 2ECGA 2RI7A 2MA6A 3OF9A 4I07A 4N4ZA 3AI8A 1AYWA 4P16A 3MHHA 2KWKA 2NQIA 3KWZA 2YT5A 3KQIA 2FO5A 4MI7A 2YREA 2FD4A 1V87A 4S3OB 2RR4A 2D8UA 2KGIA 3H8BA 3T6RA 3U5PA 1WE9A 3CBJA 2JRIA 2R9CA 2UZJA 3PNRA 1AU0A 5FB1A 3PW3A 4WA6A 2VPGA 4X6HA 5CVOB 2UZGA 4YVAA 3ZYQA 1Z2QA 1GLOA 2AN6A 5TBNA 2LXHC 2G43A 2FUDA 3PRPA 2CRWA 3KNVA 4ZUXU 2KFTA 5B76A 3E1ZB 4X6IA 4LKAA 2EA6A 4FK5A 2C2VS 4OVZA 5KH3A 1RMDA 2EXUA 3IV2A 3KWBX 1TU6A 3DWDA 3K9MA 3GL6A 4DMYA 4XUIA 4YYQA 3HHIA 3H89A 1YK8A 2DOSA 2IBIA 3HCSA 3ZVZB 1HYIA 5H1VA 2JM3A 2F6NA 4MVTA 1AU3A 3BBAA 2EGMA 1NL6A 5FPWA 3RVWA 2G6DA 4HWYA 3IUTA 4RF1A 1KHPA 4BOZA 3PT2A 3B21A 1JM7B 3M7KA 2XU1A 3LQJA 1MHWA 1QXPA 2ARYA 2DC9A 4BS5A 4OW0A 1ME4A 4XR7A 3HTKC 1CQDA 3JUEA 2Y1NA 3K8UA 2OP3A 1CS8A 2JMIA 2DZYA 4RNAA 2DC7A 2HD5A 5B8DA 2YW8A 2MIQA 2XOZA 5AITA 3PDFA 3LVRE 1O0EA 4O62A 3T9KA 1EF7A 1NLJA 3MP2A 2EODA 1JQPA 2H0DA 4TKPB 1HUCB 1MM3A 2P7UA 3TRKA 2LXPC 3PHDA 3RTRB 3GV4A 1EWMA 4LLBA 2QIZA 1WENA 4QQ4A 2FQ9A 2GFOA 4YABA 5LKXA 2LV9A 3OISA 4I05A 2B1MA 1AECA 2GHUA 1QMYA 5TDRA 2KKYA 2YQMA 3HCTA 3O70A 3H8CA 1VD4A 3FANA 4BPVA 2BAYA 4HXDB 4N4FA 5J3XA 5EGWA 2DJGB 2L5UA 4BOPA 1MBMA 5H1UA 1WEEA 2Y1MA 4YV8A 4L58A 2E02A 3MDBC 1FH0A 3O65A 2M3HA 1BORA 1PIPA 4PTBA 4BOQA 2OZ2A 3ZPVE 3BPMA 3BY4A 3RVVA 3PBHA 3H7DA 2VJEB 3O1GA 1CSBB 1CTEA 3BWKA 1WGMA 4C9ZA 2ECVA 4LADB 5KO3A 3KV6A 4N79A 4YBSA 4FIPA 1ITOA 3TMPA 3IEJA 3OF8A 4R3DA 4ZDTA 3N4CA 1PPDA 2PNXA 1YVBA 3BOWA 3F75A 7PCKA 3BB7A 1FP0A 3H7HA 2F1GA 1DKIA 3V43A 3IOQA 5FB0A 4OGCA 2DCDA 2DCCA 2FRAA 5E6JA 3E2DA 3DF0A 8PCHA 1PPNA 1AU2A 3ZTGA 3RPGC 4I7DA 2DJFB 4I7CA 4DMXA 2CT2A 1U6GB 5TDWA 2K17A 4GNDA 1PVJA 2MA5A 4GNEA 3KKUA 3SOUA 4W4UA 5DKAA 1CPJA 5EYAF 3U5OA 4CDEB 2IDAA 2YHOA 4BBQA 2CRRA 4GNGA 5SVIB 1WEMA 3IMAA 4CDDB 2IPPB 2KGGA 3NG2A 2CSYA 2L75A 2PADA 1WEOA 2VJEA 2NQGA 3E9SA 4UP5A 5C13A 1X4IA 4CDFB 4YYWA 2KWOA 4AXLA 4IC3A 1EWPA 3OVZA 4W5CA 5K16A 2PREA 4Q8GA 4I7BA 2VPDA 2AU1A 4D8BA 2FTDA 2JTCA 2YQLA 4X6JA 4O64A 4D8EA 4H9DA 3N9QA 2QICA 1FBVA 1S4VA 3RPGB 1PPOA 3QJ3A 3HWNA 3FL2A 2VJFB 3VK6A 3M99A 1Y4HA 4Q6FA 1U9WA 4YAXA 4MZOA 2DSMA 5G05B 3H6SA 2PNSA 2YJ8A 2YSMA 1CV8A 4QRGA 3W31A 1DF0A 2HWKA 2KE1A 3PSEA 1VYXA 4OEMA 2P86A 2WBFX 2VNFA 2ATOA 5SVXA 1PBHA 2LQ6A 5DINA 1PE6A 2XOYA 2MUMA 4CCGX 3S3RA 2AUXA 2FUUA 4YYSA 3N9OA 3WXGA 4PP1A 1Y08A 4REZA 4ZTBA 5J94A 2YJCA 3I06A 1STFE 1Z6UA 3U5NA 4MZSA 2LN0A 1AIMA 4FO9A 2OWAA 4AVXA 2PBHA 1U9VA 1F2CA 1WEWA 2LAUA 2BDLA 2NAAA 4P6GA 4BOSA 3O33A 1ZCMA 3HD3A 3FM8C 3HCUA 1YT7A 2F7DA 3PRMA 2JUNA 3O35A 3N9MA 2XOCA 3SUBA 3QSDA 2XU3A 4L7XA 2R6NA 4M0WA 2VJFA 5G04B 4RY2A 1BY8A 2HYED 2JMJA 5B75A 4YATA 3I2DA 1AU4A 4RF0A 1PXVA 4OGEA 1BP4A 3GCBA 2RSDA 3IFUA 1IWDA 1TLOA 3KSEA 1WEPA 4R7EA 1U9QX 1KFUL 1VFYA 1THEA 4YYRA 2MKEA 2DJAA 2IQJA 3N3KA 2AYOA 2P0RA 1A6RA 3ERVA 2KYUA 2YJBA 4N3WA 2LDRA 2G8EA 3P5WA 1WEUA 2YU4A 2BTWB 1JM7A 2JMDA 3N9LA 3N9PA 2KR4A 2M85A 1CVZA 2DCBA 2R9FA 2LGGA 2XEUA 5TABA 2ECWA 4Q8HA 4YBMA 2BDZA 4AXMA 2EGPA 1ZIVA 1YALA 5EZSA 2K4DA 2JQGR 3OQCA 2FYEA 4Z0RA 2AS8A 4KLBA 5K3QA 3V6CA 4AYCB 5JH3A 1X4UA 2J7QC 1F62A 2G6QA 2LGVA 4A49A 3LQHA 4ZQLA 4YYUA 3P5XA 1LDJB 2LGLA 2LGKA 3O7AA 1SNKA 3ZNHA 2P57A 3WXFA 5KH9A 3KV5A 4BHWA 2FSAA 5LKTA 2CSZA 3PHUA 1NB3A 1HYJA 3LDYA 2YVRA 1GMYA 1M6DA 3ASLA 3Q1DA 5AIUA 5LCWB 4UP0A 3ZUAA 1UKFA 3FAOA 3O0UA 4BSQA 2MT5A 1PPPA 2Z84A 6PADA 4UI9B 5G0FA 1AYVA 3KFQA 3FJUB 1NPZA 2HXZA 4CA1A 1AYUA 4A0CD 1K3BB 2BTWA 4NN2A 5LKUA 3O36A 3C9EA 1ATKA 3DDTA 3QZVA 4QF3A 2VHSA 5JZEA 3SHBA 1EWOA 4P6EA 2F6JA 2Y5BA 3MHSA 3TNXA 3M63A 2E61A 2KWNA 4XZXA 4AYCA 2E01A 4G54A 5CVMA 3N3GA 3LVQE 4R2YA 4QF2A 5B78A 1F2AA 3PURA 5C11A 4QRXA 3MTNA 2FT2A 4WZ2A 2Y6EA 3EB5A 2DC6A 3T7LA 2OULA 2DZZA 2YUCA 5D1KB 3LJUX 2R9MA 5F02A 4BQVA 5JA7A 5CHVA 3LFYA 2VPEA 1KHQA 4QH6A 2H7JA 2XU4A 1SP4B 1WIMA 2K1JA 2E00A 1WFKA 4XI1A 4N8WA 5SVYA 3BCNA 3L11A 5B79A 4PI3A 1ICFA 5H9MA 5EZQA 1BQIA 4IC2A 3USVA 3MTVA 2AIMA 3L1ZB 4GUAA 4F1PA 4LJNA 3U8EA 2ECTA 9PAPA 3W30A 4I04A 2M1RA 3C6WA 1WILA 5H1TA 2MNYA 2CKLB 2J7QA 4WZ3B 2PUYA 4F52B 1ME3A 2I50A 4YC9A 1KFXL 3FEHA 3KX1A 2JQFR 4X3GA 1Z60A 2L43A 2LRIC 5SVIA 4B7YC 2QJ0A 1PADA 2FFWA 1PCIA 1X9YA 2B1NA 2DC8A 4PT5A 4YBTA 2ACTA 3MJ5A 3OVXA 2G45A 2H0DB 5D1MB 1JOCA 1T1HA 2VPBA 3K24A 3LXSA 1NQCA 3P5UA 5CHTA 5LKZA 4P5OB 1CB5A 1POPA 2CIOA 2BU3A 3NHEA 2HDPA 1MS6A 1MIRA 2AUZA 3C0RA 1U9XA
chains in the Genus database with same CATH topology
4W5BA 3ZNIA 2AYNA 2L0BA 5EF4A 1KXRA 4V3KC 2VP7A 1CJLA 1XWHA 2D8SA 2F42A 1YK7A 2NQAA 3WXEA 1MEGA 2E6RA 1XKGA 1MM2A 1MEMA 5TRBA 1GCBA 2OXQC 2O6XA 2VHFA 4BGFA 2YHNA 1F2BA 5FEYA 2ZETC 4PPEA 5KH7A 2C0YA 1QDQA 5CVNB 5PADA 5B77A 3CH3X 1F29A 2CKLA 3P5VA 2R9OA 3I3TA 3L1XA 3IHPA 2MD8C 3BC3A 2DCAA 2FRQA 3LQIA 4AP4A 3EB6A 2KU3A 2MNZA 3HHAA 3CBKA 3CH2X 2YJ9A 4CZWA 2YYRA 2HHNA 2YSJA 4CDCB 3U5MA 2JRJA 2E03A 1LDKC 1WESA 4A4CA 4V3LC 1Q6KA 3QT4A 3N9NA 4AUQB 5FERA 2L80A 4PP2E 3O34A 3BPFA 2KIZA 2C2LA 1MDWA 3B79A 1GX3A 3DPLR 4WZ0A 3D6SA 3SOXA 2M6MA 2ECJA 3M62A 1K2FA 1DVPA 3ZPV1 1WEVA 5D1LB 2R9NA 1CHCA 2AVWA 1ZBDB 2KWJA 1TL9A 2YJ2A 4GNFA 4LK9A 1EWLA 2G8JA 1NB5A 2XU5A 4YADA 1QOLA 3V6EA 2G7YA 2Y43A 1X4JA 1VSNA 2FUIA 2XB1A 4OELA 5A24A 4QRVA 3ZVYA 3O37A 5JG6A 4QBBA 4BS6A 3F5VA 2E6SA 4MSXA 3C5KA 4A4BA 1VJVA 2HH5A 2KREA 3KW9A 1W5RA 2YURA 3DQVR 4R8PK 1GECE 1G25A 4S3OC 4GB0A 1U5IA 2NQDB 2CB5A 3PUQA 4PADA 4K7CA 1IYMA 2ECNA 5I3LA 2K16A 1E4UA 2DX8A 3LRQA 4FJCA 1W4TA 4B86C 3S3QA 1DEUA 4YYVA 3RVXA 1N87A 3SOWA 3MORA 2ECIA 1WEQA 2MD7B 1BGOA 2ECGA 2RI7A 2MA6A 3OF9A 4I07A 4N4ZA 3AI8A 1AYWA 3MHHA 2KWKA 2NQIA 3KWZA 2YT5A 3KQIA 2FO5A 2YREA 4S3OB 1V87A 2KGIA 3H8BA 3T6RA 3U5PA 1WE9A 3CBJA 2R9CA 3PNRA 1AU0A 5FB1A 3PW3A 4WA6A 2VPGA 4X6HA 5CVOB 2UZGA 4YVAA 3ZYQA 1Z2QA 1GLOA 2AN6A 5TBNA 2LXHC 2G43A 2FUDA 3KNVA 4ZUXU 2KFTA 5B76A 3E1ZB 4X6IA 4LKAA 2EA6A 4FK5A 2C2VS 5KH3A 1RMDA 3KWBX 3IV2A 1TU6A 3K9MA 3GL6A 4DMYA 4XUIA 4YYQA 3HHIA 3H89A 2VFCA 1YK8A 2IBIA 3HCSA 3ZVZB 1HYIA 5H1VA 1AU3A 2F6NA 4MVTA 1NL6A 5FPWA 3RVWA 2G6DA 4HWYA 3IUTA 1KHPA 1JM7B 2XU1A 3LQJA 1MHWA 1QXPA 2ARYA 2DC9A 4BS5A 1E2TA 1ME4A 4XR7A 3HTKC 1CQDA 2Y1NA 3K8UA 2OP3A 1CS8A 2JMIA 2DZYA 4B55A 2DC7A 2HD5A 5B8DA 2YW8A 2MIQA 5AITA 3PDFA 1O0EA 1EF7A 1NLJA 2EODA 1JQPA 2H0DA 4TKPB 1HUCB 1MM3A 2P7UA 2LXPC 3PHDA 3RTRB 3GV4A 1EWMA 4LLBA 2QIZA 1WENA 2FQ9A 2GFOA 4YABA 5LKXA 2LV9A 3OISA 3D9WA 2B1MA 1AECA 2GHUA 1QMYA 5TDRA 4I05A 2YQMA 3HCTA 3O70A 3H8CA 1VD4A 4BPVA 2BAYA 4N4FA 5J3XA 5EGWA 2DJGB 2L5UA 5H1UA 1WEEA 2Y1MA 4YV8A 4L58A 2E02A 1FH0A 2M3HA 1BORA 1PIPA 4PTBA 2OZ2A 3ZPVE 3BPMA 3RVVA 3PBHA 3H7DA 2VJEB 3O1GA 1CSBB 1CTEA 3BWKA 1WGMA 4C9ZA 2ECVA 4LADB 3KV6A 4N79A 4YBSA 4FIPA 1ITOA 3IEJA 3OF8A 4ZDTA 3N4CA 1PPDA 2PNXA 1YVBA 3BOWA 3F75A 7PCKA 1FP0A 2F1GA 3V43A 3IOQA 5FB0A 2DCDA 2DCCA 2FRAA 3DF0A 8PCHA 1PPNA 1AU2A 3ZTGA 3RPGC 4I7DA 2DJFB 4I7CA 4DMXA 2CT2A 1U6GB 5TDWA 2K17A 4GNDA 2MA5A 4GNEA 3KKUA 3SOUA 4W4UA 5DKAA 1CPJA 5EYAF 3U5OA 4CDEB 2IDAA 2YHOA 4BBQA 4GNGA 1WEMA 3IMAA 4CDDB 2IPPB 2KGGA 3NG2A 2CSYA 2L75A 2PADA 1WEOA 2VJEA 2NQGA 4UP5A 5C13A 1X4IA 4CDFB 4YYWA 2KWOA 4AXLA 4IC3A 1EWPA 3OVZA 4W5CA 5K16A 2PREA 4Q8GA 4I7BA 2VPDA 2AU1A 2FTDA 2YQLA 4X6JA 4O64A 3N9QA 2QICA 1FBVA 1S4VA 3RPGB 1PPOA 3QJ3A 2VFBA 3HWNA 3FL2A 2VJFB 3VK6A 3M99A 1Y4HA 4Q6FA 1U9WA 4YAXA 4MZOA 5G05B 3H6SA 2PNSA 2YJ8A 2YSMA 1CV8A 4QRGA 1DF0A 2KE1A 1VYXA 4OEMA 2P86A 2WBFX 2VNFA 2ATOA 1PBHA 2LQ6A 5DINA 1PE6A 2MUMA 4CCGX 3S3RA 2AUXA 2FUUA 4YYSA 3N9OA 3WXGA 4PP1A 1Y08A 5J94A 2YJCA 3I06A 1STFE 1Z6UA 3U5NA 4MZSA 2LN0A 1AIMA 4FO9A 4AVXA 2PBHA 1U9VA 1F2CA 1WEWA 2BDLA 4P6GA 2NAAA 3O33A 1ZCMA 3HD3A 3HCUA 1YT7A 2F7DA 3O35A 3N9MA 3QSDA 2XU3A 4L7XA 2R6NA 2VJFA 5G04B 4RY2A 1BY8A 2HYED 2JMJA 5B75A 4YATA 3I2DA 1AU4A 1PXVA 1BP4A 3GCBA 2RSDA 1IWDA 1TLOA 3KSEA 1WEPA 4R7EA 1U9QX 1KFUL 1VFYA 1THEA 4YYRA 3N3KA 2AYOA 2P0RA 1A6RA 3ERVA 2KYUA 2YJBA 4N3WA 2LDRA 2G8EA 3P5WA 1WEUA 2YU4A 1JM7A 2JMDA 3N9LA 3N9PA 2KR4A 2M85A 1CVZA 2DCBA 2R9FA 2LGGA 2XEUA 5TABA 2ECWA 4Q8HA 4YBMA 2BDZA 4AXMA 2EGPA 1ZIVA 1YALA 2K4DA 2JQGR 2FYEA 2AS8A 4KLBA 3V6CA 4AYCB 5JH3A 1X4UA 1F62A 2G6QA 2LGVA 4A49A 3LQHA 4ZQLA 4YYUA 3P5XA 1LDJB 2LGLA 2LGKA 4GUZA 3O7AA 1SNKA 3WXFA 5KH9A 3KV5A 4BHWA 2FSAA 5LKTA 2CSZA 1NB3A 1HYJA 1GMYA 1M6DA 3ASLA 2BSZA 5AIUA 5LCWB 4UP0A 3ZUAA 3O0UA 4BSQA 2MT5A 1PPPA 6PADA 4UI9B 5G0FA 1AYVA 3KFQA 1NPZA 2HXZA 4CA1A 1AYUA 4A0CD 1K3BB 4NN2A 5LKUA 3O36A 3C9EA 1ATKA 4NV8A 3LTWA 3QZVA 4QF3A 1W6FA 2VHSA 3SHBA 1EWOA 4P6EA 2F6JA 2Y5BA 3MHSA 3TNXA 4NV7A 3M63A 2KWNA 4AYCA 2E01A 4G54A 5CVMA 3N3GA 4R2YA 4QF2A 5B78A 1F2AA 3PURA 5C11A 4QRXA 4C5PA 3MTNA 2FT2A 4WZ2A 2Y6EA 3EB5A 2DC6A 3T7LA 2OULA 2DZZA 2YUCA 5D1KB 2R9MA 5JA7A 5F02A 4BQVA 5CHVA 3LFYA 2VPEA 1KHQA 4QH6A 2H7JA 2XU4A 1SP4B 1WIMA 2K1JA 2E00A 1WFKA 4XI1A 4N8WA 3BCNA 3L11A 5B79A 4PI3A 1ICFA 5H9MA 1BQIA 4IC2A 3USVA 2AIMA 3L1ZB 4LJNA 3U8EA 2ECTA 9PAPA 4I04A 2M1RA 3C6WA 1WILA 5H1TA 2MNYA 2CKLB 4WZ3B 2PUYA 4F52B 1ME3A 2I50A 4YC9A 1KFXL 3KX1A 2JQFR 4X3GA 1Z60A 2L43A 2LRIC 4B7YC 2QJ0A 1PADA 1PCIA 1X9YA 2B1NA 2DC8A 4YBTA 2ACTA 3OVXA 2G45A 2H0DB 5D1MB 1JOCA 1T1HA 2VPBA 3K24A 3LXSA 1NQCA 3P5UA 5CHTA 5LKZA 4P5OB 1CB5A 1POPA 2CIOA 3NHEA 2HDPA 1MS6A 1MIRA 2AUZA 1U9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W5B A;  3ZNI A;  2AYN A;  2L0B A;  5EF4 A;  1KXR A;  4V3K C;  2VP7 A;  1CJL A;  1XWH A;  2D8S A;  2F42 A;  1YK7 A;  2NQA A;  3WXE A;  1MEG A;  2E6R A;  1XKG A;  1MM2 A;  1MEM A;  5TRB A;  1GCB A;  2OXQ C;  2O6X A;  2VHF A;  2YHN A;  1F2B A;  5FEY A;  2ZET C;  4PPE A;  5KH7 A;  2C0Y A;  1QDQ A;  5CVN B;  5PAD A;  5B77 A;  3CH3 X;  1F29 A;  2CKL A;  3P5V A;  2R9O A;  3I3T A;  3L1X A;  3IHP A;  2MD8 C;  3BC3 A;  2DCA A;  2FRQ A;  3LQI A;  4AP4 A;  3EB6 A;  2KU3 A;  2MNZ A;  3HHA A;  3CBK A;  3CH2 X;  2YJ9 A;  4CZW A;  2YYR A;  2HHN A;  2YSJ A;  4CDC B;  3U5M A;  2JRJ A;  2E03 A;  1LDK C;  1WES A;  4A4C A;  4V3L C;  1Q6K A;  3QT4 A;  3N9N A;  4AUQ B;  5FER A;  2L80 A;  4PP2 E;  3O34 A;  3BPF A;  2KIZ A;  2C2L A;  1MDW A;  3B79 A;  3DPL R;  4WZ0 A;  3D6S A;  3SOX A;  2M6M A;  2ECJ A;  3M62 A;  1K2F A;  1DVP A;  3ZPV 1;  1WEV A;  5D1L B;  2R9N A;  1CHC A;  2AVW A;  1ZBD B;  2KWJ A;  1TL9 A;  2YJ2 A;  4GNF A;  4LK9 A;  1EWL A;  2G8J A;  1NB5 A;  2XU5 A;  4YAD A;  1QOL A;  3V6E A;  2G7Y A;  2Y43 A;  1X4J A;  1VSN A;  2FUI A;  2XB1 A;  4OEL A;  5A24 A;  4QRV A;  3ZVY A;  3O37 A;  5JG6 A;  4QBB A;  4BS6 A;  3F5V A;  2E6S A;  4MSX A;  3C5K A;  4A4B A;  1VJV A;  2HH5 A;  2KRE A;  3KW9 A;  2YUR A;  3DQV R;  4R8P K;  1GEC E;  1G25 A;  4S3O C;  4GB0 A;  1U5I A;  2NQD B;  2CB5 A;  3PUQ A;  4PAD A;  4K7C A;  1IYM A;  2ECN A;  5I3L A;  2K16 A;  1E4U A;  2DX8 A;  3LRQ A;  4FJC A;  3S3Q A;  4B86 C;  1DEU A;  4YYV A;  3RVX A;  1N87 A;  3SOW A;  3MOR A;  2ECI A;  1WEQ A;  2MD7 B;  1BGO A;  2ECG A;  2RI7 A;  2MA6 A;  3OF9 A;  4I07 A;  4N4Z A;  3AI8 A;  1AYW A;  3MHH A;  2KWK A;  2NQI A;  3KWZ A;  2YT5 A;  3KQI A;  2FO5 A;  2YRE A;  4S3O B;  1V87 A;  2KGI A;  3H8B A;  3T6R A;  3U5P A;  1WE9 A;  3CBJ A;  2R9C A;  3PNR A;  1AU0 A;  5FB1 A;  3PW3 A;  4WA6 A;  2VPG A;  4X6H A;  5CVO B;  2UZG A;  4YVA A;  3ZYQ A;  1Z2Q A;  1GLO A;  2AN6 A;  5TBN A;  2LXH C;  2G43 A;  2FUD A;  3KNV A;  4ZUX U;  2KFT A;  5B76 A;  3E1Z B;  4X6I A;  4LKA A;  2EA6 A;  4FK5 A;  2C2V S;  5KH3 A;  1RMD A;  3KWB X;  3IV2 A;  1TU6 A;  3K9M A;  3GL6 A;  4DMY A;  4XUI A;  4YYQ A;  3HHI A;  3H89 A;  1YK8 A;  2IBI A;  3HCS A;  3ZVZ B;  1HYI A;  5H1V A;  1AU3 A;  2F6N A;  4MVT A;  1NL6 A;  5FPW A;  3RVW A;  2G6D A;  4HWY A;  3IUT A;  1KHP A;  1JM7 B;  2XU1 A;  3LQJ A;  1MHW A;  1QXP A;  2ARY A;  2DC9 A;  4BS5 A;  1ME4 A;  4XR7 A;  3HTK C;  1CQD A;  2Y1N A;  3K8U A;  2OP3 A;  1CS8 A;  2JMI A;  2DZY A;  2DC7 A;  2HD5 A;  5B8D A;  2YW8 A;  2MIQ A;  5AIT A;  3PDF A;  1O0E A;  1EF7 A;  1NLJ A;  2EOD A;  1JQP A;  2H0D A;  4TKP B;  1HUC B;  1MM3 A;  2P7U A;  2LXP C;  3PHD A;  3RTR B;  3GV4 A;  1EWM A;  4LLB A;  2QIZ A;  1WEN A;  2FQ9 A;  2GFO A;  4YAB A;  5LKX A;  2LV9 A;  3OIS A;  4I05 A;  2B1M A;  1AEC A;  2GHU A;  1QMY A;  5TDR A;  2YQM A;  3HCT A;  3O70 A;  3H8C A;  1VD4 A;  4BPV A;  2BAY A;  4N4F A;  5J3X A;  5EGW A;  2DJG B;  2L5U A;  5H1U A;  1WEE A;  2Y1M A;  4YV8 A;  4L58 A;  2E02 A;  1FH0 A;  2M3H A;  1BOR A;  1PIP A;  4PTB A;  2OZ2 A;  3ZPV E;  3BPM A;  3RVV A;  3PBH A;  3H7D A;  2VJE B;  3O1G A;  1CSB B;  1CTE A;  3BWK A;  1WGM A;  4C9Z A;  2ECV A;  4LAD B;  3KV6 A;  4N79 A;  4YBS A;  4FIP A;  1ITO A;  3IEJ A;  3OF8 A;  4ZDT A;  3N4C A;  1PPD A;  2PNX A;  1YVB A;  3BOW A;  3F75 A;  7PCK A;  1FP0 A;  2F1G A;  3V43 A;  3IOQ A;  5FB0 A;  2DCD A;  2DCC A;  2FRA A;  3DF0 A;  8PCH A;  1PPN A;  1AU2 A;  3ZTG A;  3RPG C;  4I7D A;  2DJF B;  4I7C A;  4DMX A;  2CT2 A;  1U6G B;  5TDW A;  2K17 A;  4GND A;  2MA5 A;  4GNE A;  3KKU A;  3SOU A;  4W4U A;  5DKA A;  1CPJ A;  5EYA F;  3U5O A;  4CDE B;  2IDA A;  2YHO A;  4BBQ A;  4GNG A;  1WEM A;  3IMA A;  4CDD B;  2IPP B;  2KGG A;  3NG2 A;  2CSY A;  2L75 A;  2PAD A;  1WEO A;  2VJE A;  2NQG A;  4UP5 A;  5C13 A;  1X4I A;  4CDF B;  4YYW A;  2KWO A;  4AXL A;  4IC3 A;  1EWP A;  3OVZ A;  4W5C A;  5K16 A;  2PRE A;  4Q8G A;  4I7B A;  2VPD A;  2AU1 A;  2FTD A;  2YQL A;  4X6J A;  4O64 A;  3N9Q A;  2QIC A;  1FBV A;  1S4V A;  3RPG B;  1PPO A;  3QJ3 A;  3HWN A;  3FL2 A;  2VJF B;  3VK6 A;  3M99 A;  1Y4H A;  4Q6F A;  1U9W A;  4YAX A;  4MZO A;  5G05 B;  3H6S A;  2PNS A;  2YJ8 A;  2YSM A;  1CV8 A;  4QRG A;  1DF0 A;  2KE1 A;  1VYX A;  4OEM A;  2P86 A;  2WBF X;  2VNF A;  2ATO A;  1PBH A;  2LQ6 A;  5DIN A;  1PE6 A;  2MUM A;  4CCG X;  3S3R A;  2AUX A;  2FUU A;  4YYS A;  3N9O A;  3WXG A;  4PP1 A;  1Y08 A;  5J94 A;  2YJC A;  3I06 A;  1STF E;  1Z6U A;  3U5N A;  4MZS A;  2LN0 A;  1AIM A;  4FO9 A;  4AVX A;  2PBH A;  1U9V A;  1F2C A;  1WEW A;  2BDL A;  4P6G A;  2NAA A;  3O33 A;  1ZCM A;  3HD3 A;  3HCU A;  1YT7 A;  2F7D A;  3O35 A;  3N9M A;  3QSD A;  2XU3 A;  4L7X A;  2R6N A;  2VJF A;  5G04 B;  4RY2 A;  1BY8 A;  2HYE D;  2JMJ A;  5B75 A;  4YAT A;  3I2D A;  1AU4 A;  1PXV A;  1BP4 A;  3GCB A;  2RSD A;  1IWD A;  1TLO A;  3KSE A;  1WEP A;  4R7E A;  1U9Q X;  1KFU L;  1VFY A;  1THE A;  4YYR A;  3N3K A;  2AYO A;  2P0R A;  1A6R A;  3ERV A;  2KYU A;  2YJB A;  4N3W A;  2LDR A;  2G8E A;  3P5W A;  1WEU A;  2YU4 A;  1JM7 A;  2JMD A;  3N9L A;  3N9P A;  2KR4 A;  2M85 A;  1CVZ A;  2DCB A;  2R9F A;  2LGG A;  2XEU A;  5TAB A;  2ECW A;  4Q8H A;  4YBM A;  2BDZ A;  4AXM A;  2EGP A;  1ZIV A;  1YAL A;  2K4D A;  2JQG R;  2FYE A;  2AS8 A;  4KLB A;  3V6C A;  4AYC B;  5JH3 A;  1X4U A;  1F62 A;  2G6Q A;  2LGV A;  4A49 A;  3LQH A;  4ZQL A;  4YYU A;  3P5X A;  1LDJ B;  2LGL A;  2LGK A;  3O7A A;  1SNK A;  3WXF A;  5KH9 A;  3KV5 A;  4BHW A;  2FSA A;  5LKT A;  2CSZ A;  1NB3 A;  1HYJ A;  1GMY A;  1M6D A;  3ASL A;  5AIU A;  5LCW B;  4UP0 A;  3ZUA A;  3O0U A;  4BSQ A;  2MT5 A;  1PPP A;  6PAD A;  4UI9 B;  5G0F A;  1AYV A;  3KFQ A;  1NPZ A;  2HXZ A;  4CA1 A;  1AYU A;  4A0C D;  1K3B B;  4NN2 A;  5LKU A;  3O36 A;  3C9E A;  1ATK A;  3QZV A;  4QF3 A;  2VHS A;  3SHB A;  1EWO A;  4P6E A;  2F6J A;  2Y5B A;  3MHS A;  3TNX A;  3M63 A;  2KWN A;  4AYC A;  2E01 A;  4G54 A;  5CVM A;  3N3G A;  4R2Y A;  4QF2 A;  5B78 A;  1F2A A;  3PUR A;  5C11 A;  4QRX A;  3MTN A;  2FT2 A;  4WZ2 A;  2Y6E A;  3EB5 A;  2DC6 A;  3T7L A;  2OUL A;  2DZZ A;  2YUC A;  5D1K B;  2R9M A;  5JA7 A;  5F02 A;  4BQV A;  5CHV A;  3LFY A;  2VPE A;  1KHQ A;  4QH6 A;  2H7J A;  2XU4 A;  1SP4 B;  1WIM A;  2K1J A;  2E00 A;  1WFK A;  4XI1 A;  4N8W A;  3BCN A;  3L11 A;  5B79 A;  4PI3 A;  1ICF A;  5H9M A;  1BQI A;  4IC2 A;  3USV A;  2AIM A;  3L1Z B;  4LJN A;  3U8E A;  2ECT A;  9PAP A;  4I04 A;  2M1R A;  3C6W A;  1WIL A;  5H1T A;  2MNY A;  2CKL B;  4WZ3 B;  2PUY A;  4F52 B;  1ME3 A;  2I50 A;  4YC9 A;  1KFX L;  3KX1 A;  2JQF R;  4X3G A;  1Z60 A;  2L43 A;  2LRI C;  4B7Y C;  2QJ0 A;  1PAD A;  1PCI A;  1X9Y A;  2B1N A;  2DC8 A;  4YBT A;  2ACT A;  3OVX A;  2G45 A;  2H0D B;  5D1M B;  1JOC A;  1T1H A;  2VPB A;  3K24 A;  3LXS A;  1NQC A;  3P5U A;  5CHT A;  5LKZ A;  4P5O B;  1CB5 A;  1POP A;  2CIO A;  3NHE A;  2HDP A;  1MS6 A;  1MIR A;  2AUZ A;  1U9X A; 
#chains in the Genus database with same CATH topology
 4W5B A;  3ZNI A;  2AYN A;  2L0B A;  5EF4 A;  1KXR A;  4V3K C;  3KDE C;  2VP7 A;  1CJL A;  1XWH A;  2D8S A;  2F42 A;  1YK7 A;  2NQA A;  3WXE A;  1MEG A;  4IUM A;  2E6R A;  1XKG A;  4RKX A;  1MM2 A;  1MEM A;  5TRB A;  4D8I A;  1GCB A;  2OXQ C;  2O6X A;  2VHF A;  2YHN A;  2B0O E;  2CSV A;  3PLW A;  1F2B A;  5FEY A;  2ZET C;  4PPE A;  5KH7 A;  2C0Y A;  1QDQ A;  5CVN B;  5PAD A;  5B77 A;  4WUR A;  3CH3 X;  1F29 A;  3RNV A;  2CKL A;  3P5V A;  2R9O A;  2FE8 A;  3I3T A;  3L1X A;  2XP0 A;  3IHP A;  2MD8 C;  2DCA A;  2FRQ A;  3BC3 A;  3LQI A;  4AP4 A;  3EB6 A;  2KU3 A;  2MNZ A;  3HHA A;  3CBK A;  4Z0O A;  2YJ9 A;  3CH2 X;  2YYR A;  2HHN A;  2YSJ A;  4CZW A;  4CDC B;  3U5M A;  2JRJ A;  2E03 A;  1LDK C;  2M13 A;  1WES A;  4A4C A;  4V3L C;  1Q6K A;  4BOU A;  3QT4 A;  3N9N A;  4AUQ B;  5FER A;  2L80 A;  4PP2 E;  3O34 A;  3BPF A;  2KIZ A;  2C2L A;  1MDW A;  3B79 A;  3DPL R;  2CON A;  4WZ0 A;  3D6S A;  3SOX A;  4IP3 A;  2M6M A;  2ECJ A;  3M62 A;  1K2F A;  1DVP A;  2KKX A;  3ZPV 1;  1DCQ A;  1WEV A;  5D1L B;  2L7P A;  1YZB A;  1CHC A;  2R9N A;  2AVW A;  2AGA A;  1ZBD B;  2KWJ A;  1TL9 A;  2YJ2 A;  4GNF A;  3PHX A;  4LK9 A;  1EWL A;  2G8J A;  1NB5 A;  2XU5 A;  4YAD A;  1QOL A;  3V6E A;  2G7Y A;  2Y43 A;  1X4J A;  1VSN A;  2FUI A;  2XB1 A;  3PHW A;  4OEL A;  5A24 A;  4QRV A;  3ZVY A;  3O37 A;  5JG6 A;  4QBB A;  4BS6 A;  3F5V A;  2E6S A;  4MSX A;  3C5K A;  4A4B A;  1VJV A;  2HH5 A;  2KRE A;  3KW9 A;  3O47 A;  2YUR A;  3DQV R;  4R8P K;  1GEC E;  1G25 A;  4S3O C;  4GB0 A;  1U5I A;  2NQD B;  2CB5 A;  3PUQ A;  4A5U A;  4PAD A;  4K7C A;  1IYM A;  4OVZ B;  2ECN A;  5I3L A;  2K16 A;  1E4U A;  4MM3 B;  2DX8 A;  3LRQ A;  4FJC A;  3S3Q A;  4B86 C;  1DEU A;  4YYV A;  3RVX A;  1N87 A;  3SOW A;  3MOR A;  2ECI A;  1WEQ A;  2MD7 B;  1BGO A;  2ECG A;  2RI7 A;  2MA6 A;  3OF9 A;  4I07 A;  4N4Z A;  3AI8 A;  1AYW A;  4P16 A;  3MHH A;  2KWK A;  2NQI A;  3KWZ A;  2YT5 A;  3KQI A;  2FO5 A;  4MI7 A;  2YRE A;  2FD4 A;  1V87 A;  4S3O B;  2RR4 A;  2D8U A;  2KGI A;  3H8B A;  3T6R A;  3U5P A;  1WE9 A;  3CBJ A;  2JRI A;  2R9C A;  2UZJ A;  3PNR A;  1AU0 A;  5FB1 A;  3PW3 A;  4WA6 A;  2VPG A;  4X6H A;  5CVO B;  2UZG A;  4YVA A;  3ZYQ A;  1Z2Q A;  1GLO A;  2AN6 A;  5TBN A;  2LXH C;  2G43 A;  2FUD A;  3PRP A;  2CRW A;  3KNV A;  4ZUX U;  2KFT A;  5B76 A;  3E1Z B;  4X6I A;  4LKA A;  2EA6 A;  4FK5 A;  2C2V S;  4OVZ A;  5KH3 A;  1RMD A;  2EXU A;  3IV2 A;  3KWB X;  1TU6 A;  3DWD A;  3K9M A;  3GL6 A;  4DMY A;  4XUI A;  4YYQ A;  3HHI A;  3H89 A;  1YK8 A;  2DOS A;  2IBI A;  3HCS A;  3ZVZ B;  1HYI A;  5H1V A;  2JM3 A;  2F6N A;  4MVT A;  1AU3 A;  3BBA A;  2EGM A;  1NL6 A;  5FPW A;  3RVW A;  2G6D A;  4HWY A;  3IUT A;  4RF1 A;  1KHP A;  4BOZ A;  3PT2 A;  3B21 A;  1JM7 B;  3M7K A;  2XU1 A;  3LQJ A;  1MHW A;  1QXP A;  2ARY A;  2DC9 A;  4BS5 A;  4OW0 A;  1ME4 A;  4XR7 A;  3HTK C;  1CQD A;  3JUE A;  2Y1N A;  3K8U A;  2OP3 A;  1CS8 A;  2JMI A;  2DZY A;  4RNA A;  2DC7 A;  2HD5 A;  5B8D A;  2YW8 A;  2MIQ A;  2XOZ A;  5AIT A;  3PDF A;  3LVR E;  1O0E A;  4O62 A;  3T9K A;  1EF7 A;  1NLJ A;  3MP2 A;  2EOD A;  1JQP A;  2H0D A;  4TKP B;  1HUC B;  1MM3 A;  2P7U A;  3TRK A;  2LXP C;  3PHD A;  3RTR B;  3GV4 A;  1EWM A;  4LLB A;  2QIZ A;  1WEN A;  4QQ4 A;  2FQ9 A;  2GFO A;  4YAB A;  5LKX A;  2LV9 A;  3OIS A;  4I05 A;  2B1M A;  1AEC A;  2GHU A;  1QMY A;  5TDR A;  2KKY A;  2YQM A;  3HCT A;  3O70 A;  3H8C A;  1VD4 A;  3FAN A;  4BPV A;  2BAY A;  4HXD B;  4N4F A;  5J3X A;  5EGW A;  2DJG B;  2L5U A;  4BOP A;  1MBM A;  5H1U A;  1WEE A;  2Y1M A;  4YV8 A;  4L58 A;  2E02 A;  3MDB C;  1FH0 A;  3O65 A;  2M3H A;  1BOR A;  1PIP A;  4PTB A;  4BOQ A;  2OZ2 A;  3ZPV E;  3BPM A;  3BY4 A;  3RVV A;  3PBH A;  3H7D A;  2VJE B;  3O1G A;  1CSB B;  1CTE A;  3BWK A;  1WGM A;  4C9Z A;  2ECV A;  4LAD B;  5KO3 A;  3KV6 A;  4N79 A;  4YBS A;  4FIP A;  1ITO A;  3TMP A;  3IEJ A;  3OF8 A;  4R3D A;  4ZDT A;  3N4C A;  1PPD A;  2PNX A;  1YVB A;  3BOW A;  3F75 A;  7PCK A;  3BB7 A;  1FP0 A;  3H7H A;  2F1G A;  1DKI A;  3V43 A;  3IOQ A;  5FB0 A;  4OGC A;  2DCD A;  2DCC A;  2FRA A;  5E6J A;  3E2D A;  3DF0 A;  8PCH A;  1PPN A;  1AU2 A;  3ZTG A;  3RPG C;  4I7D A;  2DJF B;  4I7C A;  4DMX A;  2CT2 A;  1U6G B;  5TDW A;  2K17 A;  4GND A;  1PVJ A;  2MA5 A;  4GNE A;  3KKU A;  3SOU A;  4W4U A;  5DKA A;  1CPJ A;  5EYA F;  3U5O A;  4CDE B;  2IDA A;  2YHO A;  4BBQ A;  2CRR A;  4GNG A;  5SVI B;  1WEM A;  3IMA A;  4CDD B;  2IPP B;  2KGG A;  3NG2 A;  2CSY A;  2L75 A;  2PAD A;  1WEO A;  2VJE A;  2NQG A;  3E9S A;  4UP5 A;  5C13 A;  1X4I A;  4CDF B;  4YYW A;  2KWO A;  4AXL A;  4IC3 A;  1EWP A;  3OVZ A;  4W5C A;  5K16 A;  2PRE A;  4Q8G A;  4I7B A;  2VPD A;  2AU1 A;  4D8B A;  2FTD A;  2JTC A;  2YQL A;  4X6J A;  4O64 A;  4D8E A;  4H9D A;  3N9Q A;  2QIC A;  1FBV A;  1S4V A;  3RPG B;  1PPO A;  3QJ3 A;  3HWN A;  3FL2 A;  2VJF B;  3VK6 A;  3M99 A;  1Y4H A;  4Q6F A;  1U9W A;  4YAX A;  4MZO A;  2DSM A;  5G05 B;  3H6S A;  2PNS A;  2YJ8 A;  2YSM A;  1CV8 A;  4QRG A;  3W31 A;  1DF0 A;  2HWK A;  2KE1 A;  3PSE A;  1VYX A;  4OEM A;  2P86 A;  2WBF X;  2VNF A;  2ATO A;  5SVX A;  1PBH A;  2LQ6 A;  5DIN A;  1PE6 A;  2XOY A;  2MUM A;  4CCG X;  3S3R A;  2AUX A;  2FUU A;  4YYS A;  3N9O A;  3WXG A;  4PP1 A;  1Y08 A;  4REZ A;  4ZTB A;  5J94 A;  2YJC A;  3I06 A;  1STF E;  1Z6U A;  3U5N A;  4MZS A;  2LN0 A;  1AIM A;  4FO9 A;  2OWA A;  4AVX A;  2PBH A;  1U9V A;  1F2C A;  1WEW A;  2LAU A;  2BDL A;  2NAA A;  4P6G A;  4BOS A;  3O33 A;  1ZCM A;  3HD3 A;  3FM8 C;  3HCU A;  1YT7 A;  2F7D A;  3PRM A;  2JUN A;  3O35 A;  3N9M A;  2XOC A;  3SUB A;  3QSD A;  2XU3 A;  4L7X A;  2R6N A;  4M0W A;  2VJF A;  5G04 B;  4RY2 A;  1BY8 A;  2HYE D;  2JMJ A;  5B75 A;  4YAT A;  3I2D A;  1AU4 A;  4RF0 A;  1PXV A;  4OGE A;  1BP4 A;  3GCB A;  2RSD A;  3IFU A;  1IWD A;  1TLO A;  3KSE A;  1WEP A;  4R7E A;  1U9Q X;  1KFU L;  1VFY A;  1THE A;  4YYR A;  2MKE A;  2DJA A;  2IQJ A;  3N3K A;  2AYO A;  2P0R A;  1A6R A;  3ERV A;  2KYU A;  2YJB A;  4N3W A;  2LDR A;  2G8E A;  3P5W A;  1WEU A;  2YU4 A;  2BTW B;  1JM7 A;  2JMD A;  3N9L A;  3N9P A;  2KR4 A;  2M85 A;  1CVZ A;  2DCB A;  2R9F A;  2LGG A;  2XEU A;  5TAB A;  2ECW A;  4Q8H A;  4YBM A;  2BDZ A;  4AXM A;  2EGP A;  1ZIV A;  1YAL A;  5EZS A;  2K4D A;  2JQG R;  3OQC A;  2FYE A;  4Z0R A;  2AS8 A;  4KLB A;  5K3Q A;  3V6C A;  4AYC B;  5JH3 A;  1X4U A;  2J7Q C;  1F62 A;  2G6Q A;  2LGV A;  4A49 A;  3LQH A;  4ZQL A;  4YYU A;  3P5X A;  1LDJ B;  2LGL A;  2LGK A;  3O7A A;  1SNK A;  3ZNH A;  2P57 A;  3WXF A;  5KH9 A;  3KV5 A;  4BHW A;  2FSA A;  5LKT A;  2CSZ A;  3PHU A;  1NB3 A;  1HYJ A;  3LDY A;  2YVR A;  1GMY A;  1M6D A;  3ASL A;  3Q1D A;  5AIU A;  5LCW B;  4UP0 A;  3ZUA A;  1UKF A;  3FAO A;  3O0U A;  4BSQ A;  2MT5 A;  1PPP A;  2Z84 A;  6PAD A;  4UI9 B;  5G0F A;  1AYV A;  3KFQ A;  3FJU B;  1NPZ A;  2HXZ A;  4CA1 A;  1AYU A;  4A0C D;  1K3B B;  2BTW A;  4NN2 A;  5LKU A;  3O36 A;  3C9E A;  1ATK A;  3DDT A;  3QZV A;  4QF3 A;  2VHS A;  5JZE A;  3SHB A;  1EWO A;  4P6E A;  2F6J A;  2Y5B A;  3MHS A;  3TNX A;  3M63 A;  2E61 A;  2KWN A;  4XZX A;  4AYC A;  2E01 A;  4G54 A;  5CVM A;  3N3G A;  3LVQ E;  4R2Y A;  4QF2 A;  5B78 A;  1F2A A;  3PUR A;  5C11 A;  4QRX A;  3MTN A;  2FT2 A;  4WZ2 A;  2Y6E A;  3EB5 A;  2DC6 A;  3T7L A;  2OUL A;  2DZZ A;  2YUC A;  5D1K B;  3LJU X;  2R9M A;  5F02 A;  4BQV A;  5JA7 A;  5CHV A;  3LFY A;  2VPE A;  1KHQ A;  4QH6 A;  2H7J A;  2XU4 A;  1SP4 B;  1WIM A;  2K1J A;  2E00 A;  1WFK A;  4XI1 A;  4N8W A;  5SVY A;  3BCN A;  3L11 A;  5B79 A;  4PI3 A;  1ICF A;  5H9M A;  5EZQ A;  1BQI A;  4IC2 A;  3USV A;  3MTV A;  2AIM A;  3L1Z B;  4GUA A;  4F1P A;  4LJN A;  3U8E A;  2ECT A;  9PAP A;  3W30 A;  4I04 A;  2M1R A;  3C6W A;  1WIL A;  5H1T A;  2MNY A;  2CKL B;  2J7Q A;  4WZ3 B;  2PUY A;  4F52 B;  1ME3 A;  2I50 A;  4YC9 A;  1KFX L;  3FEH A;  3KX1 A;  2JQF R;  4X3G A;  1Z60 A;  2L43 A;  2LRI C;  5SVI A;  4B7Y C;  2QJ0 A;  1PAD A;  2FFW A;  1PCI A;  1X9Y A;  2B1N A;  2DC8 A;  4PT5 A;  4YBT A;  2ACT A;  3MJ5 A;  3OVX A;  2G45 A;  2H0D B;  5D1M B;  1JOC A;  1T1H A;  2VPB A;  3K24 A;  3LXS A;  1NQC A;  3P5U A;  5CHT A;  5LKZ A;  4P5O B;  1CB5 A;  1POP A;  2CIO A;  2BU3 A;  3NHE A;  2HDP A;  1MS6 A;  1MIR A;  2AUZ A;  3C0R A;  1U9X A; 
#chains in the Genus database with same CATH homology
 4W5B A;  3ZNI A;  2AYN A;  2L0B A;  5EF4 A;  1KXR A;  4V3K C;  2VP7 A;  1CJL A;  1XWH A;  2D8S A;  2F42 A;  1YK7 A;  2NQA A;  3WXE A;  1MEG A;  2E6R A;  1XKG A;  1MM2 A;  1MEM A;  5TRB A;  1GCB A;  2OXQ C;  2O6X A;  2VHF A;  4BGF A;  2YHN A;  1F2B A;  5FEY A;  2ZET C;  4PPE A;  5KH7 A;  2C0Y A;  1QDQ A;  5CVN B;  5PAD A;  5B77 A;  3CH3 X;  1F29 A;  2CKL A;  3P5V A;  2R9O A;  3I3T A;  3L1X A;  3IHP A;  2MD8 C;  3BC3 A;  2DCA A;  2FRQ A;  3LQI A;  4AP4 A;  3EB6 A;  2KU3 A;  2MNZ A;  3HHA A;  3CBK A;  3CH2 X;  2YJ9 A;  4CZW A;  2YYR A;  2HHN A;  2YSJ A;  4CDC B;  3U5M A;  2JRJ A;  2E03 A;  1LDK C;  1WES A;  4A4C A;  4V3L C;  1Q6K A;  3QT4 A;  3N9N A;  4AUQ B;  5FER A;  2L80 A;  4PP2 E;  3O34 A;  3BPF A;  2KIZ A;  2C2L A;  1MDW A;  3B79 A;  1GX3 A;  3DPL R;  4WZ0 A;  3D6S A;  3SOX A;  2M6M A;  2ECJ A;  3M62 A;  1K2F A;  1DVP A;  3ZPV 1;  1WEV A;  5D1L B;  2R9N A;  1CHC A;  2AVW A;  1ZBD B;  2KWJ A;  1TL9 A;  2YJ2 A;  4GNF A;  4LK9 A;  1EWL A;  2G8J A;  1NB5 A;  2XU5 A;  4YAD A;  1QOL A;  3V6E A;  2G7Y A;  2Y43 A;  1X4J A;  1VSN A;  2FUI A;  2XB1 A;  4OEL A;  5A24 A;  4QRV A;  3ZVY A;  3O37 A;  5JG6 A;  4QBB A;  4BS6 A;  3F5V A;  2E6S A;  4MSX A;  3C5K A;  4A4B A;  1VJV A;  2HH5 A;  2KRE A;  3KW9 A;  1W5R A;  2YUR A;  3DQV R;  4R8P K;  1GEC E;  1G25 A;  4S3O C;  4GB0 A;  1U5I A;  2NQD B;  2CB5 A;  3PUQ A;  4PAD A;  4K7C A;  1IYM A;  2ECN A;  5I3L A;  2K16 A;  1E4U A;  2DX8 A;  3LRQ A;  4FJC A;  1W4T A;  4B86 C;  3S3Q A;  1DEU A;  4YYV A;  3RVX A;  1N87 A;  3SOW A;  3MOR A;  2ECI A;  1WEQ A;  2MD7 B;  1BGO A;  2ECG A;  2RI7 A;  2MA6 A;  3OF9 A;  4I07 A;  4N4Z A;  3AI8 A;  1AYW A;  3MHH A;  2KWK A;  2NQI A;  3KWZ A;  2YT5 A;  3KQI A;  2FO5 A;  2YRE A;  4S3O B;  1V87 A;  2KGI A;  3H8B A;  3T6R A;  3U5P A;  1WE9 A;  3CBJ A;  2R9C A;  3PNR A;  1AU0 A;  5FB1 A;  3PW3 A;  4WA6 A;  2VPG A;  4X6H A;  5CVO B;  2UZG A;  4YVA A;  3ZYQ A;  1Z2Q A;  1GLO A;  2AN6 A;  5TBN A;  2LXH C;  2G43 A;  2FUD A;  3KNV A;  4ZUX U;  2KFT A;  5B76 A;  3E1Z B;  4X6I A;  4LKA A;  2EA6 A;  4FK5 A;  2C2V S;  5KH3 A;  1RMD A;  3KWB X;  3IV2 A;  1TU6 A;  3K9M A;  3GL6 A;  4DMY A;  4XUI A;  4YYQ A;  3HHI A;  3H89 A;  2VFC A;  1YK8 A;  2IBI A;  3HCS A;  3ZVZ B;  1HYI A;  5H1V A;  1AU3 A;  2F6N A;  4MVT A;  1NL6 A;  5FPW A;  3RVW A;  2G6D A;  4HWY A;  3IUT A;  1KHP A;  1JM7 B;  2XU1 A;  3LQJ A;  1MHW A;  1QXP A;  2ARY A;  2DC9 A;  4BS5 A;  1E2T A;  1ME4 A;  4XR7 A;  3HTK C;  1CQD A;  2Y1N A;  3K8U A;  2OP3 A;  1CS8 A;  2JMI A;  2DZY A;  4B55 A;  2DC7 A;  2HD5 A;  5B8D A;  2YW8 A;  2MIQ A;  5AIT A;  3PDF A;  1O0E A;  1EF7 A;  1NLJ A;  2EOD A;  1JQP A;  2H0D A;  4TKP B;  1HUC B;  1MM3 A;  2P7U A;  2LXP C;  3PHD A;  3RTR B;  3GV4 A;  1EWM A;  4LLB A;  2QIZ A;  1WEN A;  2FQ9 A;  2GFO A;  4YAB A;  5LKX A;  2LV9 A;  3OIS A;  3D9W A;  2B1M A;  1AEC A;  2GHU A;  1QMY A;  5TDR A;  4I05 A;  2YQM A;  3HCT A;  3O70 A;  3H8C A;  1VD4 A;  4BPV A;  2BAY A;  4N4F A;  5J3X A;  5EGW A;  2DJG B;  2L5U A;  5H1U A;  1WEE A;  2Y1M A;  4YV8 A;  4L58 A;  2E02 A;  1FH0 A;  2M3H A;  1BOR A;  1PIP A;  4PTB A;  2OZ2 A;  3ZPV E;  3BPM A;  3RVV A;  3PBH A;  3H7D A;  2VJE B;  3O1G A;  1CSB B;  1CTE A;  3BWK A;  1WGM A;  4C9Z A;  2ECV A;  4LAD B;  3KV6 A;  4N79 A;  4YBS A;  4FIP A;  1ITO A;  3IEJ A;  3OF8 A;  4ZDT A;  3N4C A;  1PPD A;  2PNX A;  1YVB A;  3BOW A;  3F75 A;  7PCK A;  1FP0 A;  2F1G A;  3V43 A;  3IOQ A;  5FB0 A;  2DCD A;  2DCC A;  2FRA A;  3DF0 A;  8PCH A;  1PPN A;  1AU2 A;  3ZTG A;  3RPG C;  4I7D A;  2DJF B;  4I7C A;  4DMX A;  2CT2 A;  1U6G B;  5TDW A;  2K17 A;  4GND A;  2MA5 A;  4GNE A;  3KKU A;  3SOU A;  4W4U A;  5DKA A;  1CPJ A;  5EYA F;  3U5O A;  4CDE B;  2IDA A;  2YHO A;  4BBQ A;  4GNG A;  1WEM A;  3IMA A;  4CDD B;  2IPP B;  2KGG A;  3NG2 A;  2CSY A;  2L75 A;  2PAD A;  1WEO A;  2VJE A;  2NQG A;  4UP5 A;  5C13 A;  1X4I A;  4CDF B;  4YYW A;  2KWO A;  4AXL A;  4IC3 A;  1EWP A;  3OVZ A;  4W5C A;  5K16 A;  2PRE A;  4Q8G A;  4I7B A;  2VPD A;  2AU1 A;  2FTD A;  2YQL A;  4X6J A;  4O64 A;  3N9Q A;  2QIC A;  1FBV A;  1S4V A;  3RPG B;  1PPO A;  3QJ3 A;  2VFB A;  3HWN A;  3FL2 A;  2VJF B;  3VK6 A;  3M99 A;  1Y4H A;  4Q6F A;  1U9W A;  4YAX A;  4MZO A;  5G05 B;  3H6S A;  2PNS A;  2YJ8 A;  2YSM A;  1CV8 A;  4QRG A;  1DF0 A;  2KE1 A;  1VYX A;  4OEM A;  2P86 A;  2WBF X;  2VNF A;  2ATO A;  1PBH A;  2LQ6 A;  5DIN A;  1PE6 A;  2MUM A;  4CCG X;  3S3R A;  2AUX A;  2FUU A;  4YYS A;  3N9O A;  3WXG A;  4PP1 A;  1Y08 A;  5J94 A;  2YJC A;  3I06 A;  1STF E;  1Z6U A;  3U5N A;  4MZS A;  2LN0 A;  1AIM A;  4FO9 A;  4AVX A;  2PBH A;  1U9V A;  1F2C A;  1WEW A;  2BDL A;  4P6G A;  2NAA A;  3O33 A;  1ZCM A;  3HD3 A;  3HCU A;  1YT7 A;  2F7D A;  3O35 A;  3N9M A;  3QSD A;  2XU3 A;  4L7X A;  2R6N A;  2VJF A;  5G04 B;  4RY2 A;  1BY8 A;  2HYE D;  2JMJ A;  5B75 A;  4YAT A;  3I2D A;  1AU4 A;  1PXV A;  1BP4 A;  3GCB A;  2RSD A;  1IWD A;  1TLO A;  3KSE A;  1WEP A;  4R7E A;  1U9Q X;  1KFU L;  1VFY A;  1THE A;  4YYR A;  3N3K A;  2AYO A;  2P0R A;  1A6R A;  3ERV A;  2KYU A;  2YJB A;  4N3W A;  2LDR A;  2G8E A;  3P5W A;  1WEU A;  2YU4 A;  1JM7 A;  2JMD A;  3N9L A;  3N9P A;  2KR4 A;  2M85 A;  1CVZ A;  2DCB A;  2R9F A;  2LGG A;  2XEU A;  5TAB A;  2ECW A;  4Q8H A;  4YBM A;  2BDZ A;  4AXM A;  2EGP A;  1ZIV A;  1YAL A;  2K4D A;  2JQG R;  2FYE A;  2AS8 A;  4KLB A;  3V6C A;  4AYC B;  5JH3 A;  1X4U A;  1F62 A;  2G6Q A;  2LGV A;  4A49 A;  3LQH A;  4ZQL A;  4YYU A;  3P5X A;  1LDJ B;  2LGL A;  2LGK A;  4GUZ A;  3O7A A;  1SNK A;  3WXF A;  5KH9 A;  3KV5 A;  4BHW A;  2FSA A;  5LKT A;  2CSZ A;  1NB3 A;  1HYJ A;  1GMY A;  1M6D A;  3ASL A;  2BSZ A;  5AIU A;  5LCW B;  4UP0 A;  3ZUA A;  3O0U A;  4BSQ A;  2MT5 A;  1PPP A;  6PAD A;  4UI9 B;  5G0F A;  1AYV A;  3KFQ A;  1NPZ A;  2HXZ A;  4CA1 A;  1AYU A;  4A0C D;  1K3B B;  4NN2 A;  5LKU A;  3O36 A;  3C9E A;  1ATK A;  4NV8 A;  3LTW A;  3QZV A;  4QF3 A;  1W6F A;  2VHS A;  3SHB A;  1EWO A;  4P6E A;  2F6J A;  2Y5B A;  3MHS A;  3TNX A;  4NV7 A;  3M63 A;  2KWN A;  4AYC A;  2E01 A;  4G54 A;  5CVM A;  3N3G A;  4R2Y A;  4QF2 A;  5B78 A;  1F2A A;  3PUR A;  5C11 A;  4QRX A;  4C5P A;  3MTN A;  2FT2 A;  4WZ2 A;  2Y6E A;  3EB5 A;  2DC6 A;  3T7L A;  2OUL A;  2DZZ A;  2YUC A;  5D1K B;  2R9M A;  5JA7 A;  5F02 A;  4BQV A;  5CHV A;  3LFY A;  2VPE A;  1KHQ A;  4QH6 A;  2H7J A;  2XU4 A;  1SP4 B;  1WIM A;  2K1J A;  2E00 A;  1WFK A;  4XI1 A;  4N8W A;  3BCN A;  3L11 A;  5B79 A;  4PI3 A;  1ICF A;  5H9M A;  1BQI A;  4IC2 A;  3USV A;  2AIM A;  3L1Z B;  4LJN A;  3U8E A;  2ECT A;  9PAP A;  4I04 A;  2M1R A;  3C6W A;  1WIL A;  5H1T A;  2MNY A;  2CKL B;  4WZ3 B;  2PUY A;  4F52 B;  1ME3 A;  2I50 A;  4YC9 A;  1KFX L;  3KX1 A;  2JQF R;  4X3G A;  1Z60 A;  2L43 A;  2LRI C;  4B7Y C;  2QJ0 A;  1PAD A;  1PCI A;  1X9Y A;  2B1N A;  2DC8 A;  4YBT A;  2ACT A;  3OVX A;  2G45 A;  2H0D B;  5D1M B;  1JOC A;  1T1H A;  2VPB A;  3K24 A;  3LXS A;  1NQC A;  3P5U A;  5CHT A;  5LKZ A;  4P5O B;  1CB5 A;  1POP A;  2CIO A;  3NHE A;  2HDP A;  1MS6 A;  1MIR A;  2AUZ A;  1U9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...