2B1NA

Crystal structure of a papain-fold protein without the catalytic cysteine from seeds of pachyrhizus erosus
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
227
structure length
227
Chain Sequence
b'APESWDWSKKGVITKVKFQGQCGSGWAFSATGAIEAAHAIATGNLVSLSEQELIDCVDESEGCYNGWHYQSFEWVVKHGGIASEADYPYKARDGKCKANEIQDKVTIDNYGVQILSNESTESEAESSLQSFVLEQPISVSIDAKDFHFYSGGIYDGGNCSSPYGINHFVLIVGYGSEDGVDYWIAKNSWGEDWGIDGYIRIQRNTGNLLGVCGMNYFASYPIIEKSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPE31
publication title Crystal structure of a papain-fold protein without the catalytic residue: a novel member in the cysteine proteinase family
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 65
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2005-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2b1nA00
4QRVA 2YJCA 1QMYA 2P0RA 3H8BA 4MZSA 3V6EA 3CBJA 3IUTA 1NLJA 3PBHA 2E01A 1XKGA 2DJFB 2DCDA 1KHPA 2R9NA 2R9OA 4YVAA 2DCAA 4AXLA 3O1GA 2BDZA 2DC8A 4N4ZA 2WBFX 2FTDA 4PI3A 1F2BA 1QDQA 1CV8A 3U8EA 1PE6A 3LFYA 3OVZA 4FIPA 1U9QX 3DF0A 4BPVA 3RVWA 3IV2A 2P7UA 4K7CA 3QSDA 1GECE 3N3GA 1HUCB 3P5UA 4MSXA 2DC7A 4X6IA 4YYSA 3OVXA 1BP4A 1MEGA 3K24A 2DJGB 3F75A 5CHVA 2E03A 4N79A 2CIOA 2NQDB 2XU3A 1CVZA 2PADA 1ZCMA 3KWZA 1MHWA 1ME4A 1AECA 4Q8HA 2FRQA 4XR7A 1NL6A 2B1NA 4DMXA 1SP4B 3BCNA 3MTNA 3RVVA 4QH6A 3USVA 2AYOA 1MDWA 1Q6KA 5K16A 3K9MA 1ICFA 2YJ9A 1CQDA 3KFQA 5JA7A 1U5IA 3ERVA 1POPA 3BC3A 3HHAA 2R9FA 3N3KA 1QOLA 3P5WA 1AU0A 4KLBA 2FYEA 1AYUA 3LXSA 2F1GA 1PPDA 2VHSA 1FH0A 6PADA 1BY8A 2IPPB 1GLOA 1ITOA 2G8EA 2NQIA 4P6EA 3HHIA 9PAPA 2F7DA 4PADA 2R9CA 3BOWA 2BDLA 1ZIVA 1CTEA 4RY2A 4P6GA 2HXZA 3BWKA 4OEMA 1QXPA 2VHFA 2G6DA 3KX1A 2PREA 2AUZA 3TNXA 2JQGR 1CB5A 2NQAA 4QBBA 4YYVA 1PPPA 2YJBA 1TU6A 4BSQA 3O0UA 4I04A 4I05A 2DC6A 2XU5A 4PP1A 4XUIA 1KXRA 1MS6A 1GMYA 2FT2A 4I07A 1JQPA 2FQ9A 1KFXL 3PDFA 3ZUAA 2ARYA 3KKUA 1Y4HA 3GCBA 1VSNA 5CVOB 1IWDA 4OELA 2DZYA 1ME3A 1VJVA 2OP3A 1DF0A 4YYUA 3CH2X 4BS5A 3CBKA 2E02A 4WA6A 1MEMA 4W5BA 8PCHA 5EF4A 3MHSA 5PADA 3CH3X 3WXGA 1AU3A 1U9VA 3M99A 1EF7A 3OF9A 1Y08A 1NB3A 2GFOA 1KFUL 2AVWA 4BS6A 2Y6EA 3PW3A 4W4UA 2ACTA 4YV8A 2YJ2A 4W5CA 1YVBA 2P86A 1ATKA 3OISA 4PP2E 3BPMA 1YALA 1AYVA 1NPZA 1S4VA 1F2AA 3H89A 4CZWA 1M6DA 2R9MA 5F02A 4BQVA 3KSEA 3MHHA 3H8CA 2ATOA 4FK5A 2XU4A 1PXVA 2DCBA 2PNSA 1MIRA 1DEUA 1YK7A 2DZZA 1A6RA 5FPWA 3KW9A 3F5VA 2OULA 1TLOA 2YJ8A 1PADA 1EWMA 2R6NA 4CDEB 1AIMA 3K8UA 2DCCA 1NB5A 1BGOA 1TL9A 2C0YA 4FJCA 3WXFA 1F2CA 3H7DA 3HD3A 4N8WA 3IHPA 3C9EA 4X6HA 3MORA 1NQCA 1K3BB 3S3QA 1O0EA 4X6JA 3N4CA 3KWBX 1THEA 4QRGA 1EWPA 2PBHA 2GHUA 2DC9A 2FO5A 1AU4A 4CDDB 2G8JA 3WXEA 1PPOA 3D6SA 3PNRA 1EWOA 5CHTA 4YYQA 1SNKA 4AXMA 1X9YA 2AS8A 7PCKA 1U9WA 2FRAA 1PIPA 2HHNA 2B1MA 3NHEA 2HD5A 5EGWA 1CJLA 2IBIA 4YYWA 2FUDA 3BPFA 3IMAA 3OF8A 1PBHA 1PCIA 1CSBB 3IEJA 2XU1A 4DMYA 3B79A 1STFE 2O6XA 1U9XA 4CDCB 2NQGA 4CDFB 1AU2A 3IOQA 3QT4A 3V6CA 2Y5BA 1GCBA 5CVNB 2AUXA 4YYRA 2AIMA 3P5VA 1BQIA 1YT7A 2AYNA 2JQFR 5CVMA 2E00A 3P5XA 4MZOA 1KHQA 3I3TA 4QRXA 5JH3A 3HWNA 5A24A 4G54A 1CPJA 3I06A 1AYWA 2CB5A 2HH5A 2OZ2A 3QJ3A 3E1ZB 2G7YA 1PPNA 4HWYA 1EWLA 5J94A 2H7JA 3RVXA 4ZUXU 3S3RA 1YK8A 1CS8A 2AU1A 3H6SA 1F29A 3AI8A 4Q8GA
chains in the Genus database with same CATH superfamily
2BTWA 4QRVA 2YJCA 1QMYA 2P0RA 3H8BA 4MZSA 3V6EA 4RKXA 4RNAA 3CBJA 3IUTA 3C0RA 1NLJA 3PBHA 2E01A 1XKGA 2DJFB 2DCDA 3BBAA 1KHPA 1DKIA 4M0WA 2R9NA 2R9OA 4IUMA 4YVAA 2DCAA 3RNVA 4AXLA 3O1GA 2BDZA 2DC8A 4N4ZA 2WBFX 2FTDA 4PI3A 1F2BA 1QDQA 1CV8A 2DOSA 1YZBA 3U8EA 1PE6A 3LFYA 2JTCA 3OVZA 4PT5A 4FIPA 1U9QX 3DF0A 5JZEA 4BPVA 3RVWA 3IV2A 2HWKA 2P7UA 4K7CA 3QSDA 1GECE 3N3GA 1HUCB 3P5UA 4MSXA 2DC7A 3MTVA 4D8BA 4X6IA 4RF0A 4XZXA 4YYSA 3OVXA 1BP4A 1MEGA 3K24A 4ZTBA 4OVZB 2DJGB 3F75A 5CHVA 2E03A 4N79A 2CIOA 2NQDB 2XU3A 1CVZA 2PADA 1ZCMA 3KWZA 1MHWA 1ME4A 1AECA 4Q8HA 2FRQA 4XR7A 1NL6A 2B1NA 4DMXA 1SP4B 3BCNA 3MTNA 3RVVA 4QH6A 3USVA 2AYOA 1MDWA 1Q6KA 5K16A 3K9MA 3W30A 4BOPA 1ICFA 2YJ9A 1CQDA 3KFQA 5JA7A 1U5IA 3ERVA 1POPA 3BC3A 3PHWA 3HHAA 2R9FA 3N3KA 1QOLA 3P5WA 1AU0A 4KLBA 2FYEA 1AYUA 2JRIA 3LXSA 2F1GA 1PPDA 2VHSA 3E9SA 1FH0A 6PADA 1BY8A 3TMPA 2IPPB 1GLOA 1ITOA 2G8EA 2NQIA 4P6EA 3HHIA 9PAPA 2F7DA 4PADA 2R9CA 3BOWA 2BDLA 1ZIVA 1CTEA 4RY2A 1PVJA 4P6GA 2HXZA 3BWKA 4OW0A 4OEMA 1QXPA 2VHFA 2G6DA 3KX1A 2PREA 2AUZA 3TNXA 2JQGR 2Z84A 1CB5A 2NQAA 4QBBA 4YYVA 1PPPA 2YJBA 1TU6A 4BSQA 3O0UA 4I04A 4I05A 2DC6A 4OVZA 2XU5A 4PP1A 4XUIA 1KXRA 1MS6A 1GMYA 2UZJA 2FT2A 4I07A 1JQPA 2FQ9A 1KFXL 3PDFA 3ZUAA 2ARYA 3KKUA 1Y4HA 3GCBA 3PSEA 1VSNA 4BOZA 2BTWB 5CVOB 1IWDA 4OELA 2DZYA 1ME3A 1VJVA 3BB7A 4D8IA 3MJ5A 5E6JA 2OP3A 1DF0A 4YYUA 4MI7A 3CH2X 4BS5A 3CBKA 2E02A 4WA6A 1UKFA 1MEMA 4W5BA 8PCHA 5EF4A 3W31A 3MHSA 5PADA 3CH3X 3WXGA 2BU3A 3PRPA 1AU3A 1U9VA 3M99A 1EF7A 3OF9A 1Y08A 1NB3A 2GFOA 4BOSA 4GUAA 1KFUL 2AVWA 4BS6A 2Y6EA 3PW3A 2J7QC 4W4UA 2ACTA 4YV8A 2YJ2A 3PT2A 4W5CA 1YVBA 2P86A 1ATKA 3OISA 4PP2E 4BOUA 3BPMA 1YALA 1AYVA 1NPZA 1S4VA 1F2AA 3H89A 3PRMA 1M6DA 4CZWA 2R9MA 5F02A 4BQVA 3KSEA 3MHHA 3H8CA 2ATOA 4FK5A 1PXVA 3IFUA 2DCBA 2PNSA 1MIRA 1DEUA 5EZQA 1YK7A 5KO3A 2DZZA 1A6RA 5FPWA 3KW9A 4WURA 3F5VA 2OULA 1TLOA 2YJ8A 1PADA 2R6NA 1EWMA 4CDEB 1AIMA 3K8UA 2DCCA 1NB5A 3PHXA 1BGOA 1TL9A 2C0YA 4FJCA 3WXFA 1F2CA 3H7DA 3HD3A 4N8WA 3IHPA 3C9EA 4X6HA 3MORA 4BOQA 1NQCA 4REZA 1K3BB 3S3QA 1O0EA 4P16A 4X6JA 3OQCA 3N4CA 3KWBX 1THEA 4QRGA 1EWPA 2PBHA 2GHUA 2DC9A 2FO5A 1AU4A 4A5UA 2G8JA 4MM3B 4CDDB 3WXEA 1PPOA 3D6SA 3PNRA 1EWOA 4R3DA 5CHTA 4YYQA 1SNKA 4AXMA 4RF1A 1X9YA 2AGAA 2AS8A 1U9WA 7PCKA 3PHUA 2FRAA 1PIPA 2HHNA 2B1MA 3NHEA 2HD5A 5EGWA 5EZSA 1CJLA 2IBIA 4YYWA 2FUDA 3BPFA 3B21A 3IMAA 4Q8GA 3OF8A 1PBHA 1PCIA 1CSBB 3IEJA 2XU1A 4DMYA 3B79A 1STFE 2O6XA 1U9XA 3O65A 4CDCB 2NQGA 4CDFB 1AU2A 3IOQA 3QT4A 3V6CA 2Y5BA 4HXDB 1GCBA 5CVNB 3TRKA 2AUXA 4YYRA 2AIMA 3P5VA 1BQIA 1YT7A 2AYNA 2JQFR 5CVMA 2E00A 3ZNHA 3P5XA 4MZOA 1KHQA 3I3TA 4QRXA 5JH3A 2J7QA 3HWNA 5A24A 4G54A 1CPJA 3I06A 1AYWA 2CB5A 3MP2A 2HH5A 3BY4A 2OZ2A 3QJ3A 3E1ZB 4IP3A 2G7YA 1PPNA 4HWYA 1EWLA 5J94A 4D8EA 2H7JA 3RVXA 4ZUXU 3S3RA 1YK8A 2FE8A 1CS8A 2AU1A 3H6SA 1F29A 3AI8A 2XU4A
chains in the Genus database with same CATH topology
4QRVA 2YJCA 1QMYA 2P0RA 3H8BA 4MZSA 3V6EA 3CBJA 3IUTA 1W5RA 1NLJA 3PBHA 2E01A 1XKGA 2DJFB 2DCDA 1KHPA 2R9NA 2R9OA 4YVAA 2DCAA 4AXLA 3O1GA 2BDZA 2DC8A 4N4ZA 2WBFX 2FTDA 2VFCA 4PI3A 1F2BA 1QDQA 1CV8A 4NV8A 3U8EA 1PE6A 3LFYA 3OVZA 4FIPA 1U9QX 3DF0A 4BPVA 3RVWA 3IV2A 2P7UA 4K7CA 3QSDA 1GECE 3N3GA 4BGFA 1HUCB 3P5UA 4MSXA 2DC7A 4X6IA 4YYSA 3OVXA 1BP4A 1MEGA 3K24A 2DJGB 3F75A 5CHVA 2E03A 4N79A 2CIOA 2NQDB 2XU3A 1CVZA 2PADA 1ZCMA 3KWZA 1MHWA 1ME4A 1AECA 4Q8HA 2FRQA 4XR7A 1NL6A 1W6FA 2B1NA 4DMXA 1SP4B 3BCNA 3MTNA 1E2TA 3RVVA 4QH6A 3USVA 2AYOA 1MDWA 1Q6KA 5K16A 3K9MA 1ICFA 2YJ9A 4C5PA 1CQDA 3KFQA 5JA7A 1U5IA 3ERVA 1POPA 3BC3A 3HHAA 2R9FA 3N3KA 1QOLA 3P5WA 1AU0A 4KLBA 2FYEA 1AYUA 3LXSA 2F1GA 1PPDA 1W4TA 2VHSA 1FH0A 6PADA 1BY8A 2IPPB 1GLOA 1ITOA 2G8EA 2NQIA 4P6EA 3HHIA 9PAPA 2F7DA 4PADA 2R9CA 3BOWA 2BDLA 1ZIVA 1CTEA 4RY2A 4P6GA 2HXZA 3BWKA 4OEMA 1QXPA 2VHFA 2G6DA 3KX1A 2PREA 2AUZA 3TNXA 2JQGR 1CB5A 2NQAA 4QBBA 4YYVA 1PPPA 2YJBA 1TU6A 4B55A 4BSQA 3O0UA 4I04A 4I05A 2DC6A 2XU5A 4PP1A 4XUIA 1KXRA 1MS6A 1GMYA 2FT2A 4I07A 4GUZA 1JQPA 2FQ9A 1KFXL 3PDFA 3D9WA 3ZUAA 2ARYA 3KKUA 1Y4HA 3GCBA 1VSNA 5CVOB 1IWDA 4OELA 2DZYA 1ME3A 1VJVA 3LTWA 2OP3A 1DF0A 4YYUA 3CH2X 4BS5A 3CBKA 2E02A 4WA6A 1MEMA 4W5BA 8PCHA 5EF4A 3MHSA 5PADA 3CH3X 3WXGA 1AU3A 1U9VA 3M99A 1EF7A 3OF9A 1Y08A 1NB3A 2GFOA 1KFUL 2AVWA 4BS6A 2Y6EA 3PW3A 4W4UA 2ACTA 4YV8A 2YJ2A 4W5CA 1YVBA 2P86A 1ATKA 3OISA 4PP2E 3BPMA 1YALA 1AYVA 1NPZA 1S4VA 1F2AA 3H89A 4CZWA 1M6DA 2R9MA 5F02A 4BQVA 3KSEA 3MHHA 3H8CA 2ATOA 4FK5A 1PXVA 2DCBA 2PNSA 1MIRA 1DEUA 1YK7A 2DZZA 1A6RA 5FPWA 3KW9A 3F5VA 2OULA 1TLOA 2YJ8A 1PADA 1EWMA 2R6NA 4CDEB 1AIMA 3K8UA 2DCCA 1NB5A 2BSZA 1BGOA 1TL9A 2C0YA 4FJCA 3WXFA 1F2CA 3H7DA 3HD3A 4N8WA 3IHPA 3C9EA 4X6HA 3MORA 1NQCA 1K3BB 3S3QA 1O0EA 4X6JA 3N4CA 3KWBX 1THEA 4QRGA 1EWPA 2PBHA 2GHUA 2DC9A 2FO5A 1AU4A 4CDDB 2G8JA 3WXEA 1PPOA 3D6SA 3PNRA 1EWOA 5CHTA 4YYQA 1SNKA 4AXMA 1X9YA 2AS8A 7PCKA 1U9WA 2FRAA 1PIPA 2HHNA 2B1MA 3NHEA 2HD5A 2VFBA 5EGWA 1CJLA 2IBIA 4YYWA 2FUDA 3BPFA 3IMAA 4Q8GA 3OF8A 1PBHA 1PCIA 1CSBB 3IEJA 2XU1A 4DMYA 3B79A 1STFE 2O6XA 1U9XA 4CDCB 2NQGA 4CDFB 1AU2A 3IOQA 3QT4A 1GX3A 3V6CA 2Y5BA 1GCBA 5CVNB 2AUXA 4YYRA 2AIMA 3P5VA 1BQIA 1YT7A 2AYNA 2JQFR 5CVMA 2E00A 3P5XA 4MZOA 1KHQA 3I3TA 4QRXA 5JH3A 3HWNA 5A24A 4G54A 1CPJA 3I06A 1AYWA 2CB5A 2HH5A 2OZ2A 3QJ3A 3E1ZB 4NV7A 2G7YA 1PPNA 4HWYA 1EWLA 5J94A 2H7JA 3RVXA 4ZUXU 3S3RA 1YK8A 1CS8A 2AU1A 3H6SA 1F29A 3AI8A 2XU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QRV A;  2YJC A;  1QMY A;  2P0R A;  3H8B A;  4MZS A;  3V6E A;  3CBJ A;  3IUT A;  1NLJ A;  3PBH A;  2E01 A;  1XKG A;  2DJF B;  2DCD A;  1KHP A;  2R9N A;  2R9O A;  4YVA A;  2DCA A;  4AXL A;  3O1G A;  2BDZ A;  2DC8 A;  4N4Z A;  2WBF X;  2FTD A;  4PI3 A;  1F2B A;  1QDQ A;  1CV8 A;  3U8E A;  1PE6 A;  3LFY A;  3OVZ A;  4FIP A;  1U9Q X;  3DF0 A;  4BPV A;  3RVW A;  3IV2 A;  2P7U A;  4K7C A;  3QSD A;  1GEC E;  3N3G A;  1HUC B;  3P5U A;  4MSX A;  2DC7 A;  4X6I A;  4YYS A;  3OVX A;  1BP4 A;  1MEG A;  3K24 A;  2DJG B;  3F75 A;  5CHV A;  2E03 A;  4N79 A;  2CIO A;  2NQD B;  2XU3 A;  1CVZ A;  2PAD A;  1ZCM A;  3KWZ A;  1MHW A;  1ME4 A;  1AEC A;  4Q8H A;  2FRQ A;  4XR7 A;  1NL6 A;  2B1N A;  4DMX A;  1SP4 B;  3BCN A;  3MTN A;  3RVV A;  4QH6 A;  3USV A;  2AYO A;  1MDW A;  1Q6K A;  5K16 A;  3K9M A;  1ICF A;  2YJ9 A;  1CQD A;  3KFQ A;  5JA7 A;  1U5I A;  3ERV A;  1POP A;  3BC3 A;  3HHA A;  2R9F A;  3N3K A;  1QOL A;  3P5W A;  1AU0 A;  4KLB A;  2FYE A;  1AYU A;  3LXS A;  2F1G A;  1PPD A;  2VHS A;  1FH0 A;  6PAD A;  1BY8 A;  2IPP B;  1GLO A;  1ITO A;  2G8E A;  2NQI A;  4P6E A;  3HHI A;  9PAP A;  2F7D A;  4PAD A;  2R9C A;  3BOW A;  2BDL A;  1ZIV A;  1CTE A;  4RY2 A;  4P6G A;  2HXZ A;  3BWK A;  4OEM A;  1QXP A;  2VHF A;  2G6D A;  3KX1 A;  2PRE A;  2AUZ A;  3TNX A;  2JQG R;  1CB5 A;  2NQA A;  4QBB A;  4YYV A;  1PPP A;  2YJB A;  1TU6 A;  4BSQ A;  3O0U A;  4I04 A;  4I05 A;  2DC6 A;  2XU5 A;  4PP1 A;  4XUI A;  1KXR A;  1MS6 A;  1GMY A;  2FT2 A;  4I07 A;  1JQP A;  2FQ9 A;  1KFX L;  3PDF A;  3ZUA A;  2ARY A;  3KKU A;  1Y4H A;  3GCB A;  1VSN A;  5CVO B;  1IWD A;  4OEL A;  2DZY A;  1ME3 A;  1VJV A;  2OP3 A;  1DF0 A;  4YYU A;  3CH2 X;  4BS5 A;  3CBK A;  2E02 A;  4WA6 A;  1MEM A;  4W5B A;  8PCH A;  5EF4 A;  3MHS A;  5PAD A;  3CH3 X;  3WXG A;  1AU3 A;  1U9V A;  3M99 A;  1EF7 A;  3OF9 A;  1Y08 A;  1NB3 A;  2GFO A;  1KFU L;  2AVW A;  4BS6 A;  2Y6E A;  3PW3 A;  4W4U A;  2ACT A;  4YV8 A;  2YJ2 A;  4W5C A;  1YVB A;  2P86 A;  1ATK A;  3OIS A;  4PP2 E;  3BPM A;  1YAL A;  1AYV A;  1NPZ A;  1S4V A;  1F2A A;  3H89 A;  4CZW A;  1M6D A;  2R9M A;  5F02 A;  4BQV A;  3KSE A;  3MHH A;  3H8C A;  2ATO A;  4FK5 A;  2XU4 A;  1PXV A;  2DCB A;  2PNS A;  1MIR A;  1DEU A;  1YK7 A;  2DZZ A;  1A6R A;  5FPW A;  3KW9 A;  3F5V A;  2OUL A;  1TLO A;  2YJ8 A;  1PAD A;  1EWM A;  2R6N A;  4CDE B;  1AIM A;  3K8U A;  2DCC A;  1NB5 A;  1BGO A;  1TL9 A;  2C0Y A;  4FJC A;  3WXF A;  1F2C A;  3H7D A;  3HD3 A;  4N8W A;  3IHP A;  3C9E A;  4X6H A;  3MOR A;  1NQC A;  1K3B B;  3S3Q A;  1O0E A;  4X6J A;  3N4C A;  3KWB X;  1THE A;  4QRG A;  1EWP A;  2PBH A;  2GHU A;  2DC9 A;  2FO5 A;  1AU4 A;  4CDD B;  2G8J A;  3WXE A;  1PPO A;  3D6S A;  3PNR A;  1EWO A;  5CHT A;  4YYQ A;  1SNK A;  4AXM A;  1X9Y A;  2AS8 A;  7PCK A;  1U9W A;  2FRA A;  1PIP A;  2HHN A;  2B1M A;  3NHE A;  2HD5 A;  5EGW A;  1CJL A;  2IBI A;  4YYW A;  2FUD A;  3BPF A;  3IMA A;  3OF8 A;  1PBH A;  1PCI A;  1CSB B;  3IEJ A;  2XU1 A;  4DMY A;  3B79 A;  1STF E;  2O6X A;  1U9X A;  4CDC B;  2NQG A;  4CDF B;  1AU2 A;  3IOQ A;  3QT4 A;  3V6C A;  2Y5B A;  1GCB A;  5CVN B;  2AUX A;  4YYR A;  2AIM A;  3P5V A;  1BQI A;  1YT7 A;  2AYN A;  2JQF R;  5CVM A;  2E00 A;  3P5X A;  4MZO A;  1KHQ A;  3I3T A;  4QRX A;  5JH3 A;  3HWN A;  5A24 A;  4G54 A;  1CPJ A;  3I06 A;  1AYW A;  2CB5 A;  2HH5 A;  2OZ2 A;  3QJ3 A;  3E1Z B;  2G7Y A;  1PPN A;  4HWY A;  1EWL A;  5J94 A;  2H7J A;  3RVX A;  4ZUX U;  3S3R A;  1YK8 A;  1CS8 A;  2AU1 A;  3H6S A;  1F29 A;  3AI8 A;  4Q8G A; 
#chains in the Genus database with same CATH topology
 2BTW A;  4QRV A;  2YJC A;  1QMY A;  2P0R A;  3H8B A;  4MZS A;  3V6E A;  4RKX A;  4RNA A;  3CBJ A;  3IUT A;  3C0R A;  1NLJ A;  3PBH A;  2E01 A;  1XKG A;  2DJF B;  2DCD A;  3BBA A;  1KHP A;  1DKI A;  4M0W A;  2R9N A;  2R9O A;  4IUM A;  4YVA A;  2DCA A;  3RNV A;  4AXL A;  3O1G A;  2BDZ A;  2DC8 A;  4N4Z A;  2WBF X;  2FTD A;  4PI3 A;  1F2B A;  1QDQ A;  1CV8 A;  2DOS A;  1YZB A;  3U8E A;  1PE6 A;  3LFY A;  2JTC A;  3OVZ A;  4PT5 A;  4FIP A;  1U9Q X;  3DF0 A;  5JZE A;  4BPV A;  3RVW A;  3IV2 A;  2HWK A;  2P7U A;  4K7C A;  3QSD A;  1GEC E;  3N3G A;  1HUC B;  3P5U A;  4MSX A;  2DC7 A;  3MTV A;  4D8B A;  4X6I A;  4RF0 A;  4XZX A;  4YYS A;  3OVX A;  1BP4 A;  1MEG A;  3K24 A;  4ZTB A;  4OVZ B;  2DJG B;  3F75 A;  5CHV A;  2E03 A;  4N79 A;  2CIO A;  2NQD B;  2XU3 A;  1CVZ A;  2PAD A;  1ZCM A;  3KWZ A;  1MHW A;  1ME4 A;  1AEC A;  4Q8H A;  2FRQ A;  4XR7 A;  1NL6 A;  2B1N A;  4DMX A;  1SP4 B;  3BCN A;  3MTN A;  3RVV A;  4QH6 A;  3USV A;  2AYO A;  1MDW A;  1Q6K A;  5K16 A;  3K9M A;  3W30 A;  4BOP A;  1ICF A;  2YJ9 A;  1CQD A;  3KFQ A;  5JA7 A;  1U5I A;  3ERV A;  1POP A;  3BC3 A;  3PHW A;  3HHA A;  2R9F A;  3N3K A;  1QOL A;  3P5W A;  1AU0 A;  4KLB A;  2FYE A;  1AYU A;  2JRI A;  3LXS A;  2F1G A;  1PPD A;  2VHS A;  3E9S A;  1FH0 A;  6PAD A;  1BY8 A;  3TMP A;  2IPP B;  1GLO A;  1ITO A;  2G8E A;  2NQI A;  4P6E A;  3HHI A;  9PAP A;  2F7D A;  4PAD A;  2R9C A;  3BOW A;  2BDL A;  1ZIV A;  1CTE A;  4RY2 A;  1PVJ A;  4P6G A;  2HXZ A;  3BWK A;  4OW0 A;  4OEM A;  1QXP A;  2VHF A;  2G6D A;  3KX1 A;  2PRE A;  2AUZ A;  3TNX A;  2JQG R;  2Z84 A;  1CB5 A;  2NQA A;  4QBB A;  4YYV A;  1PPP A;  2YJB A;  1TU6 A;  4BSQ A;  3O0U A;  4I04 A;  4I05 A;  2DC6 A;  4OVZ A;  2XU5 A;  4PP1 A;  4XUI A;  1KXR A;  1MS6 A;  1GMY A;  2UZJ A;  2FT2 A;  4I07 A;  1JQP A;  2FQ9 A;  1KFX L;  3PDF A;  3ZUA A;  2ARY A;  3KKU A;  1Y4H A;  3GCB A;  3PSE A;  1VSN A;  4BOZ A;  2BTW B;  5CVO B;  1IWD A;  4OEL A;  2DZY A;  1ME3 A;  1VJV A;  3BB7 A;  4D8I A;  3MJ5 A;  5E6J A;  2OP3 A;  1DF0 A;  4YYU A;  4MI7 A;  3CH2 X;  4BS5 A;  3CBK A;  2E02 A;  4WA6 A;  1UKF A;  1MEM A;  4W5B A;  8PCH A;  5EF4 A;  3W31 A;  3MHS A;  5PAD A;  3CH3 X;  3WXG A;  2BU3 A;  3PRP A;  1AU3 A;  1U9V A;  3M99 A;  1EF7 A;  3OF9 A;  1Y08 A;  1NB3 A;  2GFO A;  4BOS A;  4GUA A;  1KFU L;  2AVW A;  4BS6 A;  2Y6E A;  3PW3 A;  2J7Q C;  4W4U A;  2ACT A;  4YV8 A;  2YJ2 A;  3PT2 A;  4W5C A;  1YVB A;  2P86 A;  1ATK A;  3OIS A;  4PP2 E;  4BOU A;  3BPM A;  1YAL A;  1AYV A;  1NPZ A;  1S4V A;  1F2A A;  3H89 A;  3PRM A;  1M6D A;  4CZW A;  2R9M A;  5F02 A;  4BQV A;  3KSE A;  3MHH A;  3H8C A;  2ATO A;  4FK5 A;  1PXV A;  3IFU A;  2DCB A;  2PNS A;  1MIR A;  1DEU A;  5EZQ A;  1YK7 A;  5KO3 A;  2DZZ A;  1A6R A;  5FPW A;  3KW9 A;  4WUR A;  3F5V A;  2OUL A;  1TLO A;  2YJ8 A;  1PAD A;  2R6N A;  1EWM A;  4CDE B;  1AIM A;  3K8U A;  2DCC A;  1NB5 A;  3PHX A;  1BGO A;  1TL9 A;  2C0Y A;  4FJC A;  3WXF A;  1F2C A;  3H7D A;  3HD3 A;  4N8W A;  3IHP A;  3C9E A;  4X6H A;  3MOR A;  4BOQ A;  1NQC A;  4REZ A;  1K3B B;  3S3Q A;  1O0E A;  4P16 A;  4X6J A;  3OQC A;  3N4C A;  3KWB X;  1THE A;  4QRG A;  1EWP A;  2PBH A;  2GHU A;  2DC9 A;  2FO5 A;  1AU4 A;  4A5U A;  2G8J A;  4MM3 B;  4CDD B;  3WXE A;  1PPO A;  3D6S A;  3PNR A;  1EWO A;  4R3D A;  5CHT A;  4YYQ A;  1SNK A;  4AXM A;  4RF1 A;  1X9Y A;  2AGA A;  2AS8 A;  1U9W A;  7PCK A;  3PHU A;  2FRA A;  1PIP A;  2HHN A;  2B1M A;  3NHE A;  2HD5 A;  5EGW A;  5EZS A;  1CJL A;  2IBI A;  4YYW A;  2FUD A;  3BPF A;  3B21 A;  3IMA A;  4Q8G A;  3OF8 A;  1PBH A;  1PCI A;  1CSB B;  3IEJ A;  2XU1 A;  4DMY A;  3B79 A;  1STF E;  2O6X A;  1U9X A;  3O65 A;  4CDC B;  2NQG A;  4CDF B;  1AU2 A;  3IOQ A;  3QT4 A;  3V6C A;  2Y5B A;  4HXD B;  1GCB A;  5CVN B;  3TRK A;  2AUX A;  4YYR A;  2AIM A;  3P5V A;  1BQI A;  1YT7 A;  2AYN A;  2JQF R;  5CVM A;  2E00 A;  3ZNH A;  3P5X A;  4MZO A;  1KHQ A;  3I3T A;  4QRX A;  5JH3 A;  2J7Q A;  3HWN A;  5A24 A;  4G54 A;  1CPJ A;  3I06 A;  1AYW A;  2CB5 A;  3MP2 A;  2HH5 A;  3BY4 A;  2OZ2 A;  3QJ3 A;  3E1Z B;  4IP3 A;  2G7Y A;  1PPN A;  4HWY A;  1EWL A;  5J94 A;  4D8E A;  2H7J A;  3RVX A;  4ZUX U;  3S3R A;  1YK8 A;  2FE8 A;  1CS8 A;  2AU1 A;  3H6S A;  1F29 A;  3AI8 A;  2XU4 A; 
#chains in the Genus database with same CATH homology
 4QRV A;  2YJC A;  1QMY A;  2P0R A;  3H8B A;  4MZS A;  3V6E A;  3CBJ A;  3IUT A;  1W5R A;  1NLJ A;  3PBH A;  2E01 A;  1XKG A;  2DJF B;  2DCD A;  1KHP A;  2R9N A;  2R9O A;  4YVA A;  2DCA A;  4AXL A;  3O1G A;  2BDZ A;  2DC8 A;  4N4Z A;  2WBF X;  2FTD A;  2VFC A;  4PI3 A;  1F2B A;  1QDQ A;  1CV8 A;  4NV8 A;  3U8E A;  1PE6 A;  3LFY A;  3OVZ A;  4FIP A;  1U9Q X;  3DF0 A;  4BPV A;  3RVW A;  3IV2 A;  2P7U A;  4K7C A;  3QSD A;  1GEC E;  3N3G A;  4BGF A;  1HUC B;  3P5U A;  4MSX A;  2DC7 A;  4X6I A;  4YYS A;  3OVX A;  1BP4 A;  1MEG A;  3K24 A;  2DJG B;  3F75 A;  5CHV A;  2E03 A;  4N79 A;  2CIO A;  2NQD B;  2XU3 A;  1CVZ A;  2PAD A;  1ZCM A;  3KWZ A;  1MHW A;  1ME4 A;  1AEC A;  4Q8H A;  2FRQ A;  4XR7 A;  1NL6 A;  1W6F A;  2B1N A;  4DMX A;  1SP4 B;  3BCN A;  3MTN A;  1E2T A;  3RVV A;  4QH6 A;  3USV A;  2AYO A;  1MDW A;  1Q6K A;  5K16 A;  3K9M A;  1ICF A;  2YJ9 A;  4C5P A;  1CQD A;  3KFQ A;  5JA7 A;  1U5I A;  3ERV A;  1POP A;  3BC3 A;  3HHA A;  2R9F A;  3N3K A;  1QOL A;  3P5W A;  1AU0 A;  4KLB A;  2FYE A;  1AYU A;  3LXS A;  2F1G A;  1PPD A;  1W4T A;  2VHS A;  1FH0 A;  6PAD A;  1BY8 A;  2IPP B;  1GLO A;  1ITO A;  2G8E A;  2NQI A;  4P6E A;  3HHI A;  9PAP A;  2F7D A;  4PAD A;  2R9C A;  3BOW A;  2BDL A;  1ZIV A;  1CTE A;  4RY2 A;  4P6G A;  2HXZ A;  3BWK A;  4OEM A;  1QXP A;  2VHF A;  2G6D A;  3KX1 A;  2PRE A;  2AUZ A;  3TNX A;  2JQG R;  1CB5 A;  2NQA A;  4QBB A;  4YYV A;  1PPP A;  2YJB A;  1TU6 A;  4B55 A;  4BSQ A;  3O0U A;  4I04 A;  4I05 A;  2DC6 A;  2XU5 A;  4PP1 A;  4XUI A;  1KXR A;  1MS6 A;  1GMY A;  2FT2 A;  4I07 A;  4GUZ A;  1JQP A;  2FQ9 A;  1KFX L;  3PDF A;  3D9W A;  3ZUA A;  2ARY A;  3KKU A;  1Y4H A;  3GCB A;  1VSN A;  5CVO B;  1IWD A;  4OEL A;  2DZY A;  1ME3 A;  1VJV A;  3LTW A;  2OP3 A;  1DF0 A;  4YYU A;  3CH2 X;  4BS5 A;  3CBK A;  2E02 A;  4WA6 A;  1MEM A;  4W5B A;  8PCH A;  5EF4 A;  3MHS A;  5PAD A;  3CH3 X;  3WXG A;  1AU3 A;  1U9V A;  3M99 A;  1EF7 A;  3OF9 A;  1Y08 A;  1NB3 A;  2GFO A;  1KFU L;  2AVW A;  4BS6 A;  2Y6E A;  3PW3 A;  4W4U A;  2ACT A;  4YV8 A;  2YJ2 A;  4W5C A;  1YVB A;  2P86 A;  1ATK A;  3OIS A;  4PP2 E;  3BPM A;  1YAL A;  1AYV A;  1NPZ A;  1S4V A;  1F2A A;  3H89 A;  4CZW A;  1M6D A;  2R9M A;  5F02 A;  4BQV A;  3KSE A;  3MHH A;  3H8C A;  2ATO A;  4FK5 A;  1PXV A;  2DCB A;  2PNS A;  1MIR A;  1DEU A;  1YK7 A;  2DZZ A;  1A6R A;  5FPW A;  3KW9 A;  3F5V A;  2OUL A;  1TLO A;  2YJ8 A;  1PAD A;  1EWM A;  2R6N A;  4CDE B;  1AIM A;  3K8U A;  2DCC A;  1NB5 A;  2BSZ A;  1BGO A;  1TL9 A;  2C0Y A;  4FJC A;  3WXF A;  1F2C A;  3H7D A;  3HD3 A;  4N8W A;  3IHP A;  3C9E A;  4X6H A;  3MOR A;  1NQC A;  1K3B B;  3S3Q A;  1O0E A;  4X6J A;  3N4C A;  3KWB X;  1THE A;  4QRG A;  1EWP A;  2PBH A;  2GHU A;  2DC9 A;  2FO5 A;  1AU4 A;  4CDD B;  2G8J A;  3WXE A;  1PPO A;  3D6S A;  3PNR A;  1EWO A;  5CHT A;  4YYQ A;  1SNK A;  4AXM A;  1X9Y A;  2AS8 A;  7PCK A;  1U9W A;  2FRA A;  1PIP A;  2HHN A;  2B1M A;  3NHE A;  2HD5 A;  2VFB A;  5EGW A;  1CJL A;  2IBI A;  4YYW A;  2FUD A;  3BPF A;  3IMA A;  4Q8G A;  3OF8 A;  1PBH A;  1PCI A;  1CSB B;  3IEJ A;  2XU1 A;  4DMY A;  3B79 A;  1STF E;  2O6X A;  1U9X A;  4CDC B;  2NQG A;  4CDF B;  1AU2 A;  3IOQ A;  3QT4 A;  1GX3 A;  3V6C A;  2Y5B A;  1GCB A;  5CVN B;  2AUX A;  4YYR A;  2AIM A;  3P5V A;  1BQI A;  1YT7 A;  2AYN A;  2JQF R;  5CVM A;  2E00 A;  3P5X A;  4MZO A;  1KHQ A;  3I3T A;  4QRX A;  5JH3 A;  3HWN A;  5A24 A;  4G54 A;  1CPJ A;  3I06 A;  1AYW A;  2CB5 A;  2HH5 A;  2OZ2 A;  3QJ3 A;  3E1Z B;  4NV7 A;  2G7Y A;  1PPN A;  4HWY A;  1EWL A;  5J94 A;  2H7J A;  3RVX A;  4ZUX U;  3S3R A;  1YK8 A;  1CS8 A;  2AU1 A;  3H6S A;  1F29 A;  3AI8 A;  2XU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...