2B1NA

Crystal structure of a papain-fold protein without the catalytic cysteine from seeds of pachyrhizus erosus
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
227
structure length
227
Chain Sequence
APESWDWSKKGVITKVKFQGQCGSGWAFSATGAIEAAHAIATGNLVSLSEQELIDCVDESEGCYNGWHYQSFEWVVKHGGIASEADYPYKARDGKCKANEIQDKVTIDNYGVQILSNESTESEAESSLQSFVLEQPISVSIDAKDFHFYSGGIYDGGNCSSPYGINHFVLIVGYGSEDGVDYWIAKNSWGEDWGIDGYIRIQRNTGNLLGVCGMNYFASYPIIEKSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a papain-fold protein without the catalytic residue: a novel member in the cysteine proteinase family
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords SPE31
total genus 65
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2005-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2b1nA00
3USVA 3BWKA 3KKUA 1A6RA 4P6GA 3V6EA 2R9FA 3QT4A 4K7CA 3O1GA 1MHWA 1F29A 1ZCMA 2F1GA 3QJ3A 2FRAA 3F5VA 2YJCA 3H89A 4BSQA 4OEMA 1AU4A 4QRGA 5CVNB 4KLBA 1AYUA 4YYSA 3WXEA 5PADA 4I05A 1CVZA 4BQVA 1AU2A 2DJGB 3U8EA 4YVAA 3MHHA 1CS8A 2Y6EA 4MZOA 1CTEA 2B1NA 2HHNA 3KWZA 2DZYA 1BP4A 4N4ZA 1PPOA 1MEGA 4P6EA 1M6DA 2FUDA 2BDZA 2FQ9A 1IWDA 5J94A 2YJ8A 5JH3A 2OP3A 1YK8A 4CZWA 4X6IA 1DEUA 3GCBA 3CH3X 3N4CA 3HHIA 1GMYA 4YYVA 3V6CA 3B79A 1DF0A 1ICFA 4RY2A 3BPMA 2AUZA 4Q8GA 1TLOA 3S3QA 5F02A 1MS6A 2CIOA 3IUTA 3MTNA 2DJFB 1S4VA 1TL9A 1U9VA 4YYWA 1MDWA 3I06A 2ATOA 3OF8A 3K8UA 3HHAA 1CJLA 2CB5A 2XU5A 3P5VA 1Y4HA 3TNXA 1CSBB 3N3GA 2AIMA 2FTDA 8PCHA 4I04A 3RVVA 1EWPA 3H7DA 2R6NA 2GHUA 4XUIA 4WA6A 4BS6A 1F2CA 3OVZA 1EWLA 2NQIA 2JQFR 1NB3A 1KFUL 1NPZA 1AU3A 3E1ZB 3KSEA 3I3TA 4OELA 4PP2E 1NLJA 1FH0A 2DCAA 3HWNA 2ACTA 2FYEA 2XU3A 2NQAA 2PNSA 3C9EA 3S3RA 1F2AA 1U9WA 1PXVA 2Y5BA 1NL6A 1U5IA 2IBIA 3O0UA 1GCBA 2FRQA 3KWBX 2B1MA 2G8EA 2E03A 4BS5A 2NQGA 4AXMA 1AU0A 2E00A 3IHPA 4HWYA 2OULA 3AI8A 1YALA 1EF7A 2G8JA 3F75A 3QSDA 3P5XA 4CDFB 1ZIVA 1PPNA 2GFOA 1VSNA 1ME3A 1YK7A 3MORA 2AU1A 1MIRA 2C0YA 2WBFX 2IPPB 3WXFA 1QDQA 1AIMA 2DCDA 2E01A 4I07A 1QXPA 3H6SA 1ATKA 2DZZA 1X9YA 2FT2A 3M99A 1SNKA 1KFXL 3LFYA 4DMXA 4W5BA 3NHEA 2R9CA 2AS8A 3N3KA 1AYVA 2PBHA 4CDEB 3MHSA 1EWOA 2VHFA 1YT7A 2JQGR 4N8WA 3BPFA 1AECA 1ITOA 2XU4A 5A24A 2BDLA 3OF9A 2G6DA 4PP1A 1MEMA 1GLOA 1Y08A 4FJCA 2OZ2A 2ARYA 1AYWA 1PCIA 4MZSA 4DMYA 4N79A 2AUXA 3D6SA 3OISA 3HD3A 3IV2A 3PNRA 2R9OA 1POPA 2AYNA 5EF4A 1NQCA 5CVOB 3P5WA 2DC6A 1THEA 2DC7A 3RVXA 2VHSA 1O0EA 2PREA 1HUCB 1GECE 2P86A 3PBHA 4ZUXU 3WXGA 2P7UA 1PBHA 4X6JA 3K24A 2P0RA 3RVWA 1EWMA 3CH2X 3KFQA 3PDFA 1U9QX 3PW3A 5JA7A 2HD5A 1JQPA 2DC9A 4XR7A 9PAPA 2DC8A 4FIPA 3KW9A 2NQDB 4W4UA 3ERVA 1BQIA 1PE6A 1KHQA 3CBKA 1PIPA 1KHPA 2FO5A 5CHVA 3KX1A 1PADA 2G7YA 3DF0A 1STFE 1PPDA 3CBJA 3IEJA 5FPWA 2HH5A 1QMYA 6PADA 4AXLA 4QRVA 1F2BA 1BY8A 4CDDB 2YJBA 3K9MA 1CPJA 2R9MA 1BGOA 1SP4B 2AYOA 1VJVA 7PCKA 5EGWA 3BCNA 3ZUAA 3BC3A 3OVXA 1K3BB 3H8CA 2PADA 2YJ9A 4QBBA 4FK5A 4W5CA 3IMAA 2DCBA 3H8BA 4YYRA 2O6XA 2AVWA 4QRXA 3P5UA 5CHTA 1CV8A 1KXRA 5K16A 2HXZA 1ME4A 2R9NA 3BOWA 4X6HA 1TU6A 3LXSA 4YYUA 2E02A 2XU1A 1U9XA 4CDCB 4QH6A 4YYQA 4MSXA 4PADA 4PI3A 1CQDA 4Q8HA 1YVBA 4BPVA 2H7JA 1NB5A 4G54A 1CB5A 3IOQA 5CVMA 1PPPA 2F7DA 1XKGA 1Q6KA 4YV8A 1QOLA 2YJ2A 2DCCA
chains in the Genus database with same CATH superfamily
3USVA 3BWKA 4D8EA 3KKUA 1A6RA 4P6GA 3V6EA 2R9FA 3QT4A 4K7CA 3O1GA 1MHWA 1F29A 1ZCMA 2F1GA 3QJ3A 3PSEA 2BTWA 2FRAA 3F5VA 2YJCA 3H89A 4BSQA 4OEMA 1AU4A 4QRGA 5CVNB 4KLBA 1AYUA 4YYSA 3WXEA 2J7QC 5PADA 4I05A 3ZNHA 1CVZA 4BQVA 1AU2A 1UKFA 2DJGB 3U8EA 4YVAA 2Z84A 3MHHA 3W31A 1CS8A 2Y6EA 4MZOA 1CTEA 2B1NA 2HHNA 3OQCA 3KWZA 2DZYA 1BP4A 4N4ZA 1PPOA 4HXDB 1MEGA 4M0WA 4P6EA 1M6DA 2FUDA 2BDZA 2FQ9A 1IWDA 5J94A 2YJ8A 4IP3A 5JH3A 5EZSA 1YZBA 2OP3A 1YK8A 4CZWA 4X6IA 1DEUA 3GCBA 3CH3X 3N4CA 3HHIA 1GMYA 4YYVA 1PVJA 3V6CA 3B79A 1DF0A 1ICFA 3PHUA 4RY2A 3BPMA 2AUZA 4Q8GA 1TLOA 3S3QA 5F02A 1MS6A 2CIOA 3IUTA 3MTNA 2DJFB 1S4VA 1TL9A 1U9VA 4YYWA 1MDWA 3BB7A 3I06A 2ATOA 3OF8A 3K8UA 3HHAA 4IUMA 4MM3B 1CJLA 2CB5A 2XU5A 3P5VA 1Y4HA 3TNXA 1CSBB 4GUAA 3N3GA 2AIMA 4OVZB 2FTDA 8PCHA 4I04A 3RVVA 1EWPA 4OVZA 3H7DA 2R6NA 2GHUA 4XUIA 4WA6A 2JRIA 3PHWA 4BS6A 1F2CA 3OVZA 1EWLA 2NQIA 2JQFR 1NB3A 4OW0A 1KFUL 1NPZA 1AU3A 3E1ZB 3KSEA 3I3TA 4OELA 4PP2E 1NLJA 1FH0A 2DCAA 3HWNA 2ACTA 4D8IA 2FYEA 3PHXA 2XU3A 4XZXA 2NQAA 2PNSA 3C9EA 4P16A 3S3RA 1F2AA 1U9WA 1PXVA 2Y5BA 1NL6A 1U5IA 2IBIA 3O0UA 1GCBA 2FRQA 3KWBX 3MJ5A 4BOZA 2B1MA 2G8EA 2E03A 4BS5A 2NQGA 4AXMA 1AU0A 2E00A 3IHPA 4HWYA 3BY4A 2OULA 3AI8A 1YALA 1EF7A 2G8JA 3BBAA 3F75A 3C0RA 3QSDA 3P5XA 4CDFB 1ZIVA 1PPNA 2GFOA 1VSNA 1ME3A 1YK7A 3MORA 3PRPA 2AU1A 1MIRA 2C0YA 2WBFX 2IPPB 3WXFA 1QDQA 1AIMA 4BOUA 2DCDA 2E01A 4I07A 1QXPA 3H6SA 1ATKA 3MTVA 2DZZA 1X9YA 2BTWB 2FT2A 3M99A 1SNKA 1KFXL 3LFYA 4DMXA 4W5BA 2HWKA 3NHEA 2R9CA 2AS8A 3N3KA 1AYVA 2PBHA 4CDEB 3MHSA 1EWOA 2VHFA 1YT7A 2JQGR 4N8WA 3BPFA 1AECA 1ITOA 2XU4A 5A24A 2BDLA 3OF9A 2G6DA 4PP1A 1MEMA 1GLOA 4PT5A 2J7QA 1Y08A 4FJCA 4D8BA 2OZ2A 2ARYA 1AYWA 1PCIA 3PT2A 4MZSA 4DMYA 4N79A 2AUXA 5EZQA 3D6SA 3OISA 3HD3A 3IV2A 4RF1A 3PNRA 4ZTBA 2R9OA 1POPA 2AYNA 4BOPA 2FE8A 5EF4A 3O65A 1NQCA 5CVOB 3P5WA 2DC6A 1THEA 2DC7A 3RVXA 2VHSA 1O0EA 2PREA 1HUCB 1GECE 2P86A 2DOSA 3PBHA 4ZUXU 3WXGA 2P7UA 4MI7A 1PBHA 4X6JA 3K24A 2P0RA 3RVWA 1EWMA 3CH2X 3KFQA 3PDFA 1U9QX 3PW3A 5JA7A 2HD5A 1JQPA 2DC9A 4REZA 4XR7A 9PAPA 2DC8A 4FIPA 3KW9A 2AGAA 2NQDB 3ERVA 4W4UA 1BQIA 1PE6A 1KHQA 3CBKA 3RNVA 1PIPA 1KHPA 2FO5A 5CHVA 3KX1A 1PADA 2G7YA 3DF0A 1STFE 1PPDA 3CBJA 3IEJA 5FPWA 2HH5A 1QMYA 6PADA 4RKXA 4AXLA 4QRVA 1F2BA 1BY8A 4CDDB 4R3DA 4RF0A 2YJBA 3TMPA 3K9MA 3MP2A 1CPJA 2R9MA 1BGOA 1DKIA 1SP4B 1VJVA 2AYOA 7PCKA 4A5UA 5EGWA 3BCNA 4WURA 3ZUAA 3BC3A 3OVXA 5JZEA 3W30A 1K3BB 3H8CA 2PADA 2YJ9A 4BOQA 4QBBA 4FK5A 4W5CA 3IMAA 2DCBA 3H8BA 4YYRA 2O6XA 2AVWA 4QRXA 3IFUA 3P5UA 5CHTA 1CV8A 3B21A 1KXRA 4RNAA 5K16A 2HXZA 1ME4A 2R9NA 2BU3A 3BOWA 4X6HA 1TU6A 3LXSA 4YYUA 2E02A 2XU1A 5KO3A 1U9XA 2UZJA 4CDCB 4QH6A 4YYQA 4MSXA 4PADA 4PI3A 1CQDA 4Q8HA 1YVBA 4BPVA 3PRMA 2H7JA 2JTCA 3E9SA 1NB5A 4G54A 3TRKA 1CB5A 3IOQA 5CVMA 4BOSA 1PPPA 5E6JA 2F7DA 1XKGA 1Q6KA 4YV8A 1QOLA 2YJ2A 2DCCA
chains in the Genus database with same CATH topology
3USVA 3BWKA 3KKUA 1A6RA 4P6GA 3V6EA 2R9FA 3QT4A 4K7CA 3O1GA 1MHWA 1F29A 1ZCMA 2F1GA 3QJ3A 2FRAA 3F5VA 2YJCA 3H89A 4BSQA 4OEMA 1AU4A 4QRGA 5CVNB 4KLBA 1AYUA 4YYSA 3WXEA 5PADA 4I05A 1CVZA 4BQVA 1AU2A 1W4TA 2DJGB 3U8EA 4YVAA 3MHHA 1CS8A 2Y6EA 4MZOA 1CTEA 2B1NA 2HHNA 3KWZA 2DZYA 1BP4A 4N4ZA 1PPOA 1MEGA 4P6EA 1M6DA 2FUDA 2BDZA 2FQ9A 1IWDA 5J94A 2YJ8A 5JH3A 1GX3A 2OP3A 1YK8A 4CZWA 4X6IA 1DEUA 3GCBA 3CH3X 3N4CA 3HHIA 1GMYA 4YYVA 3V6CA 3B79A 1DF0A 1ICFA 4RY2A 3BPMA 2AUZA 4Q8GA 1TLOA 3S3QA 5F02A 4BGFA 1MS6A 2CIOA 3IUTA 3MTNA 2DJFB 1S4VA 1TL9A 1U9VA 4YYWA 1MDWA 3I06A 2ATOA 3OF8A 3K8UA 3HHAA 1CJLA 2CB5A 2XU5A 3P5VA 1Y4HA 3TNXA 1CSBB 3N3GA 2AIMA 2FTDA 8PCHA 4I04A 3RVVA 1EWPA 4NV8A 3H7DA 2R6NA 2GHUA 4XUIA 4WA6A 4BS6A 1F2CA 3LTWA 3OVZA 1EWLA 2NQIA 2JQFR 1NB3A 1KFUL 1NPZA 1AU3A 3E1ZB 3KSEA 3I3TA 4OELA 4PP2E 4NV7A 1NLJA 1FH0A 2DCAA 3HWNA 4C5PA 2ACTA 2FYEA 2XU3A 2NQAA 2PNSA 3C9EA 3S3RA 1F2AA 2BSZA 1U9WA 1PXVA 2Y5BA 1NL6A 1U5IA 2IBIA 3O0UA 1GCBA 2FRQA 3KWBX 2B1MA 2G8EA 2E03A 4BS5A 2NQGA 4AXMA 1AU0A 2E00A 3IHPA 4HWYA 2OULA 3AI8A 1YALA 1EF7A 2G8JA 3F75A 3QSDA 3P5XA 4CDFB 1ZIVA 1PPNA 2GFOA 3D9WA 1VSNA 1ME3A 1YK7A 3MORA 2AU1A 1MIRA 2C0YA 2WBFX 2IPPB 3WXFA 1QDQA 1AIMA 2DCDA 2E01A 4GUZA 4I07A 1W6FA 1QXPA 3H6SA 1ATKA 2DZZA 1X9YA 2FT2A 3M99A 1SNKA 1KFXL 3LFYA 1W5RA 4DMXA 4W5BA 3NHEA 2R9CA 2AS8A 3N3KA 1AYVA 2PBHA 4CDEB 3MHSA 1EWOA 2VHFA 1YT7A 2JQGR 4N8WA 3BPFA 1AECA 1ITOA 2XU4A 1E2TA 5A24A 2BDLA 3OF9A 2G6DA 4PP1A 1MEMA 1GLOA 1Y08A 4FJCA 2OZ2A 2ARYA 1AYWA 1PCIA 4MZSA 4DMYA 4N79A 2AUXA 3D6SA 3OISA 3HD3A 3IV2A 3PNRA 2R9OA 1POPA 2AYNA 5EF4A 1NQCA 5CVOB 3P5WA 2DC6A 1THEA 2DC7A 3RVXA 2VHSA 1O0EA 2PREA 1HUCB 1GECE 2P86A 3PBHA 4ZUXU 3WXGA 2P7UA 1PBHA 4X6JA 3K24A 2P0RA 3RVWA 1EWMA 3CH2X 3KFQA 3PDFA 1U9QX 3PW3A 5JA7A 2VFBA 2HD5A 1JQPA 2DC9A 4XR7A 9PAPA 2DC8A 4FIPA 3KW9A 2NQDB 4W4UA 3ERVA 1BQIA 1PE6A 1KHQA 3CBKA 1PIPA 1KHPA 2FO5A 5CHVA 3KX1A 1PADA 2G7YA 3DF0A 1STFE 1PPDA 3CBJA 3IEJA 5FPWA 2HH5A 1QMYA 6PADA 4AXLA 4QRVA 1F2BA 1BY8A 4CDDB 2YJBA 3K9MA 1CPJA 2R9MA 1BGOA 1SP4B 2AYOA 1VJVA 7PCKA 5EGWA 3BCNA 3ZUAA 3BC3A 3OVXA 1K3BB 3H8CA 2PADA 2YJ9A 4QBBA 4FK5A 4W5CA 3IMAA 2DCBA 3H8BA 4YYRA 2O6XA 2AVWA 4QRXA 3P5UA 5CHTA 1CV8A 1KXRA 5K16A 2HXZA 1ME4A 2R9NA 3BOWA 4X6HA 1TU6A 3LXSA 4YYUA 2E02A 2XU1A 1U9XA 4CDCB 4QH6A 4YYQA 2VFCA 4MSXA 4PADA 4PI3A 1CQDA 4Q8HA 1YVBA 4BPVA 2H7JA 1NB5A 4G54A 1CB5A 3IOQA 5CVMA 1PPPA 2F7DA 1XKGA 1Q6KA 4B55A 4YV8A 1QOLA 2YJ2A 2DCCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3USV A;  3BWK A;  3KKU A;  1A6R A;  4P6G A;  3V6E A;  2R9F A;  3QT4 A;  4K7C A;  3O1G A;  1MHW A;  1F29 A;  1ZCM A;  2F1G A;  3QJ3 A;  2FRA A;  3F5V A;  2YJC A;  3H89 A;  4BSQ A;  4OEM A;  1AU4 A;  4QRG A;  5CVN B;  4KLB A;  1AYU A;  4YYS A;  3WXE A;  5PAD A;  4I05 A;  1CVZ A;  4BQV A;  1AU2 A;  2DJG B;  3U8E A;  4YVA A;  3MHH A;  1CS8 A;  2Y6E A;  4MZO A;  1CTE A;  2B1N A;  2HHN A;  3KWZ A;  2DZY A;  1BP4 A;  4N4Z A;  1PPO A;  1MEG A;  4P6E A;  1M6D A;  2FUD A;  2BDZ A;  2FQ9 A;  1IWD A;  5J94 A;  2YJ8 A;  5JH3 A;  2OP3 A;  1YK8 A;  4CZW A;  4X6I A;  1DEU A;  3GCB A;  3CH3 X;  3N4C A;  3HHI A;  1GMY A;  4YYV A;  3V6C A;  3B79 A;  1DF0 A;  1ICF A;  4RY2 A;  3BPM A;  2AUZ A;  4Q8G A;  1TLO A;  3S3Q A;  5F02 A;  1MS6 A;  2CIO A;  3IUT A;  3MTN A;  2DJF B;  1S4V A;  1TL9 A;  1U9V A;  4YYW A;  1MDW A;  3I06 A;  2ATO A;  3OF8 A;  3K8U A;  3HHA A;  1CJL A;  2CB5 A;  2XU5 A;  3P5V A;  1Y4H A;  3TNX A;  1CSB B;  3N3G A;  2AIM A;  2FTD A;  8PCH A;  4I04 A;  3RVV A;  1EWP A;  3H7D A;  2R6N A;  2GHU A;  4XUI A;  4WA6 A;  4BS6 A;  1F2C A;  3OVZ A;  1EWL A;  2NQI A;  2JQF R;  1NB3 A;  1KFU L;  1NPZ A;  1AU3 A;  3E1Z B;  3KSE A;  3I3T A;  4OEL A;  4PP2 E;  1NLJ A;  1FH0 A;  2DCA A;  3HWN A;  2ACT A;  2FYE A;  2XU3 A;  2NQA A;  2PNS A;  3C9E A;  3S3R A;  1F2A A;  1U9W A;  1PXV A;  2Y5B A;  1NL6 A;  1U5I A;  2IBI A;  3O0U A;  1GCB A;  2FRQ A;  3KWB X;  2B1M A;  2G8E A;  2E03 A;  4BS5 A;  2NQG A;  4AXM A;  1AU0 A;  2E00 A;  3IHP A;  4HWY A;  2OUL A;  3AI8 A;  1YAL A;  1EF7 A;  2G8J A;  3F75 A;  3QSD A;  3P5X A;  4CDF B;  1ZIV A;  1PPN A;  2GFO A;  1VSN A;  1ME3 A;  1YK7 A;  3MOR A;  2AU1 A;  1MIR A;  2C0Y A;  2WBF X;  2IPP B;  3WXF A;  1QDQ A;  1AIM A;  2DCD A;  2E01 A;  4I07 A;  1QXP A;  3H6S A;  1ATK A;  2DZZ A;  1X9Y A;  2FT2 A;  3M99 A;  1SNK A;  1KFX L;  3LFY A;  4DMX A;  4W5B A;  3NHE A;  2R9C A;  2AS8 A;  3N3K A;  1AYV A;  2PBH A;  4CDE B;  3MHS A;  1EWO A;  2VHF A;  1YT7 A;  2JQG R;  4N8W A;  3BPF A;  1AEC A;  1ITO A;  2XU4 A;  5A24 A;  2BDL A;  3OF9 A;  2G6D A;  4PP1 A;  1MEM A;  1GLO A;  1Y08 A;  4FJC A;  2OZ2 A;  2ARY A;  1AYW A;  1PCI A;  4MZS A;  4DMY A;  4N79 A;  2AUX A;  3D6S A;  3OIS A;  3HD3 A;  3IV2 A;  3PNR A;  2R9O A;  1POP A;  2AYN A;  5EF4 A;  1NQC A;  5CVO B;  3P5W A;  2DC6 A;  1THE A;  2DC7 A;  3RVX A;  2VHS A;  1O0E A;  2PRE A;  1HUC B;  1GEC E;  2P86 A;  3PBH A;  4ZUX U;  3WXG A;  2P7U A;  1PBH A;  4X6J A;  3K24 A;  2P0R A;  3RVW A;  1EWM A;  3CH2 X;  3KFQ A;  3PDF A;  1U9Q X;  3PW3 A;  5JA7 A;  2HD5 A;  1JQP A;  2DC9 A;  4XR7 A;  9PAP A;  2DC8 A;  4FIP A;  3KW9 A;  2NQD B;  4W4U A;  3ERV A;  1BQI A;  1PE6 A;  1KHQ A;  3CBK A;  1PIP A;  1KHP A;  2FO5 A;  5CHV A;  3KX1 A;  1PAD A;  2G7Y A;  3DF0 A;  1STF E;  1PPD A;  3CBJ A;  3IEJ A;  5FPW A;  2HH5 A;  1QMY A;  6PAD A;  4AXL A;  4QRV A;  1F2B A;  1BY8 A;  4CDD B;  2YJB A;  3K9M A;  1CPJ A;  2R9M A;  1BGO A;  1SP4 B;  2AYO A;  1VJV A;  7PCK A;  5EGW A;  3BCN A;  3ZUA A;  3BC3 A;  3OVX A;  1K3B B;  3H8C A;  2PAD A;  2YJ9 A;  4QBB A;  4FK5 A;  4W5C A;  3IMA A;  2DCB A;  3H8B A;  4YYR A;  2O6X A;  2AVW A;  4QRX A;  3P5U A;  5CHT A;  1CV8 A;  1KXR A;  5K16 A;  2HXZ A;  1ME4 A;  2R9N A;  3BOW A;  4X6H A;  1TU6 A;  3LXS A;  4YYU A;  2E02 A;  2XU1 A;  1U9X A;  4CDC B;  4QH6 A;  4YYQ A;  4MSX A;  4PAD A;  4PI3 A;  1CQD A;  4Q8H A;  1YVB A;  4BPV A;  2H7J A;  1NB5 A;  4G54 A;  1CB5 A;  3IOQ A;  5CVM A;  1PPP A;  2F7D A;  1XKG A;  1Q6K A;  4YV8 A;  1QOL A;  2YJ2 A;  2DCC A; 
#chains in the Genus database with same CATH topology
 3USV A;  3BWK A;  4D8E A;  3KKU A;  1A6R A;  4P6G A;  3V6E A;  2R9F A;  3QT4 A;  4K7C A;  3O1G A;  1MHW A;  1F29 A;  1ZCM A;  2F1G A;  3QJ3 A;  3PSE A;  2BTW A;  2FRA A;  3F5V A;  2YJC A;  3H89 A;  4BSQ A;  4OEM A;  1AU4 A;  4QRG A;  5CVN B;  4KLB A;  1AYU A;  4YYS A;  3WXE A;  2J7Q C;  5PAD A;  4I05 A;  3ZNH A;  1CVZ A;  4BQV A;  1AU2 A;  1UKF A;  2DJG B;  3U8E A;  4YVA A;  2Z84 A;  3MHH A;  3W31 A;  1CS8 A;  2Y6E A;  4MZO A;  1CTE A;  2B1N A;  2HHN A;  3OQC A;  3KWZ A;  2DZY A;  1BP4 A;  4N4Z A;  1PPO A;  4HXD B;  1MEG A;  4M0W A;  4P6E A;  1M6D A;  2FUD A;  2BDZ A;  2FQ9 A;  1IWD A;  5J94 A;  2YJ8 A;  4IP3 A;  5JH3 A;  5EZS A;  1YZB A;  2OP3 A;  1YK8 A;  4CZW A;  4X6I A;  1DEU A;  3GCB A;  3CH3 X;  3N4C A;  3HHI A;  1GMY A;  4YYV A;  1PVJ A;  3V6C A;  3B79 A;  1DF0 A;  1ICF A;  3PHU A;  4RY2 A;  3BPM A;  2AUZ A;  4Q8G A;  1TLO A;  3S3Q A;  5F02 A;  1MS6 A;  2CIO A;  3IUT A;  3MTN A;  2DJF B;  1S4V A;  1TL9 A;  1U9V A;  4YYW A;  1MDW A;  3BB7 A;  3I06 A;  2ATO A;  3OF8 A;  3K8U A;  3HHA A;  4IUM A;  4MM3 B;  1CJL A;  2CB5 A;  2XU5 A;  3P5V A;  1Y4H A;  3TNX A;  1CSB B;  4GUA A;  3N3G A;  2AIM A;  4OVZ B;  2FTD A;  8PCH A;  4I04 A;  3RVV A;  1EWP A;  4OVZ A;  3H7D A;  2R6N A;  2GHU A;  4XUI A;  4WA6 A;  2JRI A;  3PHW A;  4BS6 A;  1F2C A;  3OVZ A;  1EWL A;  2NQI A;  2JQF R;  1NB3 A;  4OW0 A;  1KFU L;  1NPZ A;  1AU3 A;  3E1Z B;  3KSE A;  3I3T A;  4OEL A;  4PP2 E;  1NLJ A;  1FH0 A;  2DCA A;  3HWN A;  2ACT A;  4D8I A;  2FYE A;  3PHX A;  2XU3 A;  4XZX A;  2NQA A;  2PNS A;  3C9E A;  4P16 A;  3S3R A;  1F2A A;  1U9W A;  1PXV A;  2Y5B A;  1NL6 A;  1U5I A;  2IBI A;  3O0U A;  1GCB A;  2FRQ A;  3KWB X;  3MJ5 A;  4BOZ A;  2B1M A;  2G8E A;  2E03 A;  4BS5 A;  2NQG A;  4AXM A;  1AU0 A;  2E00 A;  3IHP A;  4HWY A;  3BY4 A;  2OUL A;  3AI8 A;  1YAL A;  1EF7 A;  2G8J A;  3BBA A;  3F75 A;  3C0R A;  3QSD A;  3P5X A;  4CDF B;  1ZIV A;  1PPN A;  2GFO A;  1VSN A;  1ME3 A;  1YK7 A;  3MOR A;  3PRP A;  2AU1 A;  1MIR A;  2C0Y A;  2WBF X;  2IPP B;  3WXF A;  1QDQ A;  1AIM A;  4BOU A;  2DCD A;  2E01 A;  4I07 A;  1QXP A;  3H6S A;  1ATK A;  3MTV A;  2DZZ A;  1X9Y A;  2BTW B;  2FT2 A;  3M99 A;  1SNK A;  1KFX L;  3LFY A;  4DMX A;  4W5B A;  2HWK A;  3NHE A;  2R9C A;  2AS8 A;  3N3K A;  1AYV A;  2PBH A;  4CDE B;  3MHS A;  1EWO A;  2VHF A;  1YT7 A;  2JQG R;  4N8W A;  3BPF A;  1AEC A;  1ITO A;  2XU4 A;  5A24 A;  2BDL A;  3OF9 A;  2G6D A;  4PP1 A;  1MEM A;  1GLO A;  4PT5 A;  2J7Q A;  1Y08 A;  4FJC A;  4D8B A;  2OZ2 A;  2ARY A;  1AYW A;  1PCI A;  3PT2 A;  4MZS A;  4DMY A;  4N79 A;  2AUX A;  5EZQ A;  3D6S A;  3OIS A;  3HD3 A;  3IV2 A;  4RF1 A;  3PNR A;  4ZTB A;  2R9O A;  1POP A;  2AYN A;  4BOP A;  2FE8 A;  5EF4 A;  3O65 A;  1NQC A;  5CVO B;  3P5W A;  2DC6 A;  1THE A;  2DC7 A;  3RVX A;  2VHS A;  1O0E A;  2PRE A;  1HUC B;  1GEC E;  2P86 A;  2DOS A;  3PBH A;  4ZUX U;  3WXG A;  2P7U A;  4MI7 A;  1PBH A;  4X6J A;  3K24 A;  2P0R A;  3RVW A;  1EWM A;  3CH2 X;  3KFQ A;  3PDF A;  1U9Q X;  3PW3 A;  5JA7 A;  2HD5 A;  1JQP A;  2DC9 A;  4REZ A;  4XR7 A;  9PAP A;  2DC8 A;  4FIP A;  3KW9 A;  2AGA A;  2NQD B;  3ERV A;  4W4U A;  1BQI A;  1PE6 A;  1KHQ A;  3CBK A;  3RNV A;  1PIP A;  1KHP A;  2FO5 A;  5CHV A;  3KX1 A;  1PAD A;  2G7Y A;  3DF0 A;  1STF E;  1PPD A;  3CBJ A;  3IEJ A;  5FPW A;  2HH5 A;  1QMY A;  6PAD A;  4RKX A;  4AXL A;  4QRV A;  1F2B A;  1BY8 A;  4CDD B;  4R3D A;  4RF0 A;  2YJB A;  3TMP A;  3K9M A;  3MP2 A;  1CPJ A;  2R9M A;  1BGO A;  1DKI A;  1SP4 B;  1VJV A;  2AYO A;  7PCK A;  4A5U A;  5EGW A;  3BCN A;  4WUR A;  3ZUA A;  3BC3 A;  3OVX A;  5JZE A;  3W30 A;  1K3B B;  3H8C A;  2PAD A;  2YJ9 A;  4BOQ A;  4QBB A;  4FK5 A;  4W5C A;  3IMA A;  2DCB A;  3H8B A;  4YYR A;  2O6X A;  2AVW A;  4QRX A;  3IFU A;  3P5U A;  5CHT A;  1CV8 A;  3B21 A;  1KXR A;  4RNA A;  5K16 A;  2HXZ A;  1ME4 A;  2R9N A;  2BU3 A;  3BOW A;  4X6H A;  1TU6 A;  3LXS A;  4YYU A;  2E02 A;  2XU1 A;  5KO3 A;  1U9X A;  2UZJ A;  4CDC B;  4QH6 A;  4YYQ A;  4MSX A;  4PAD A;  4PI3 A;  1CQD A;  4Q8H A;  1YVB A;  4BPV A;  3PRM A;  2H7J A;  2JTC A;  3E9S A;  1NB5 A;  4G54 A;  3TRK A;  1CB5 A;  3IOQ A;  5CVM A;  4BOS A;  1PPP A;  5E6J A;  2F7D A;  1XKG A;  1Q6K A;  4YV8 A;  1QOL A;  2YJ2 A;  2DCC A; 
#chains in the Genus database with same CATH homology
 3USV A;  3BWK A;  3KKU A;  1A6R A;  4P6G A;  3V6E A;  2R9F A;  3QT4 A;  4K7C A;  3O1G A;  1MHW A;  1F29 A;  1ZCM A;  2F1G A;  3QJ3 A;  2FRA A;  3F5V A;  2YJC A;  3H89 A;  4BSQ A;  4OEM A;  1AU4 A;  4QRG A;  5CVN B;  4KLB A;  1AYU A;  4YYS A;  3WXE A;  5PAD A;  4I05 A;  1CVZ A;  4BQV A;  1AU2 A;  1W4T A;  2DJG B;  3U8E A;  4YVA A;  3MHH A;  1CS8 A;  2Y6E A;  4MZO A;  1CTE A;  2B1N A;  2HHN A;  3KWZ A;  2DZY A;  1BP4 A;  4N4Z A;  1PPO A;  1MEG A;  4P6E A;  1M6D A;  2FUD A;  2BDZ A;  2FQ9 A;  1IWD A;  5J94 A;  2YJ8 A;  5JH3 A;  1GX3 A;  2OP3 A;  1YK8 A;  4CZW A;  4X6I A;  1DEU A;  3GCB A;  3CH3 X;  3N4C A;  3HHI A;  1GMY A;  4YYV A;  3V6C A;  3B79 A;  1DF0 A;  1ICF A;  4RY2 A;  3BPM A;  2AUZ A;  4Q8G A;  1TLO A;  3S3Q A;  5F02 A;  4BGF A;  1MS6 A;  2CIO A;  3IUT A;  3MTN A;  2DJF B;  1S4V A;  1TL9 A;  1U9V A;  4YYW A;  1MDW A;  3I06 A;  2ATO A;  3OF8 A;  3K8U A;  3HHA A;  1CJL A;  2CB5 A;  2XU5 A;  3P5V A;  1Y4H A;  3TNX A;  1CSB B;  3N3G A;  2AIM A;  2FTD A;  8PCH A;  4I04 A;  3RVV A;  1EWP A;  4NV8 A;  3H7D A;  2R6N A;  2GHU A;  4XUI A;  4WA6 A;  4BS6 A;  1F2C A;  3LTW A;  3OVZ A;  1EWL A;  2NQI A;  2JQF R;  1NB3 A;  1KFU L;  1NPZ A;  1AU3 A;  3E1Z B;  3KSE A;  3I3T A;  4OEL A;  4PP2 E;  4NV7 A;  1NLJ A;  1FH0 A;  2DCA A;  3HWN A;  4C5P A;  2ACT A;  2FYE A;  2XU3 A;  2NQA A;  2PNS A;  3C9E A;  3S3R A;  1F2A A;  2BSZ A;  1U9W A;  1PXV A;  2Y5B A;  1NL6 A;  1U5I A;  2IBI A;  3O0U A;  1GCB A;  2FRQ A;  3KWB X;  2B1M A;  2G8E A;  2E03 A;  4BS5 A;  2NQG A;  4AXM A;  1AU0 A;  2E00 A;  3IHP A;  4HWY A;  2OUL A;  3AI8 A;  1YAL A;  1EF7 A;  2G8J A;  3F75 A;  3QSD A;  3P5X A;  4CDF B;  1ZIV A;  1PPN A;  2GFO A;  3D9W A;  1VSN A;  1ME3 A;  1YK7 A;  3MOR A;  2AU1 A;  1MIR A;  2C0Y A;  2WBF X;  2IPP B;  3WXF A;  1QDQ A;  1AIM A;  2DCD A;  2E01 A;  4GUZ A;  4I07 A;  1W6F A;  1QXP A;  3H6S A;  1ATK A;  2DZZ A;  1X9Y A;  2FT2 A;  3M99 A;  1SNK A;  1KFX L;  3LFY A;  1W5R A;  4DMX A;  4W5B A;  3NHE A;  2R9C A;  2AS8 A;  3N3K A;  1AYV A;  2PBH A;  4CDE B;  3MHS A;  1EWO A;  2VHF A;  1YT7 A;  2JQG R;  4N8W A;  3BPF A;  1AEC A;  1ITO A;  2XU4 A;  1E2T A;  5A24 A;  2BDL A;  3OF9 A;  2G6D A;  4PP1 A;  1MEM A;  1GLO A;  1Y08 A;  4FJC A;  2OZ2 A;  2ARY A;  1AYW A;  1PCI A;  4MZS A;  4DMY A;  4N79 A;  2AUX A;  3D6S A;  3OIS A;  3HD3 A;  3IV2 A;  3PNR A;  2R9O A;  1POP A;  2AYN A;  5EF4 A;  1NQC A;  5CVO B;  3P5W A;  2DC6 A;  1THE A;  2DC7 A;  3RVX A;  2VHS A;  1O0E A;  2PRE A;  1HUC B;  1GEC E;  2P86 A;  3PBH A;  4ZUX U;  3WXG A;  2P7U A;  1PBH A;  4X6J A;  3K24 A;  2P0R A;  3RVW A;  1EWM A;  3CH2 X;  3KFQ A;  3PDF A;  1U9Q X;  3PW3 A;  5JA7 A;  2VFB A;  2HD5 A;  1JQP A;  2DC9 A;  4XR7 A;  9PAP A;  2DC8 A;  4FIP A;  3KW9 A;  2NQD B;  4W4U A;  3ERV A;  1BQI A;  1PE6 A;  1KHQ A;  3CBK A;  1PIP A;  1KHP A;  2FO5 A;  5CHV A;  3KX1 A;  1PAD A;  2G7Y A;  3DF0 A;  1STF E;  1PPD A;  3CBJ A;  3IEJ A;  5FPW A;  2HH5 A;  1QMY A;  6PAD A;  4AXL A;  4QRV A;  1F2B A;  1BY8 A;  4CDD B;  2YJB A;  3K9M A;  1CPJ A;  2R9M A;  1BGO A;  1SP4 B;  2AYO A;  1VJV A;  7PCK A;  5EGW A;  3BCN A;  3ZUA A;  3BC3 A;  3OVX A;  1K3B B;  3H8C A;  2PAD A;  2YJ9 A;  4QBB A;  4FK5 A;  4W5C A;  3IMA A;  2DCB A;  3H8B A;  4YYR A;  2O6X A;  2AVW A;  4QRX A;  3P5U A;  5CHT A;  1CV8 A;  1KXR A;  5K16 A;  2HXZ A;  1ME4 A;  2R9N A;  3BOW A;  4X6H A;  1TU6 A;  3LXS A;  4YYU A;  2E02 A;  2XU1 A;  1U9X A;  4CDC B;  4QH6 A;  4YYQ A;  2VFC A;  4MSX A;  4PAD A;  4PI3 A;  1CQD A;  4Q8H A;  1YVB A;  4BPV A;  2H7J A;  1NB5 A;  4G54 A;  1CB5 A;  3IOQ A;  5CVM A;  1PPP A;  2F7D A;  1XKG A;  1Q6K A;  4B55 A;  4YV8 A;  1QOL A;  2YJ2 A;  2DCC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...