4W5BA

Crystal structure analysis of cruzain with fragment 1 (n-(1h-benzimidazol-2-yl)-1,3-dimethyl-pyrazole-4-carboxamide)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSSWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cruzipain
publication title Applying Fragments Based- Drug Design to identify multiple binding modes on cysteine protease.
rcsb
source organism Trypanosoma cruzi
total genus 72
structure length 215
sequence length 215
chains with identical sequence B, C
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2014-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4w5bA00
3P5WA 2P0RA 1POPA 1AU3A 2F7DA 4X6JA 3S3QA 2R9MA 3K8UA 2FYEA 2XU4A 1ME3A 2AYNA 2PADA 2Y5BA 1IWDA 1DF0A 3BPMA 2JQGR 1PCIA 4MSXA 2F1GA 2YJCA 4FJCA 4X6IA 4MZSA 3KFQA 2R9NA 3IUTA 3PW3A 2ACTA 8PCHA 2FT2A 3H6SA 7PCKA 4YYVA 5EF4A 3MHSA 1MEGA 2R9FA 3RVVA 2AYOA 3M99A 2C0YA 3CBKA 4FIPA 3IOQA 3BCNA 4MZOA 1CSBB 1AECA 4P6EA 1AIMA 2AUXA 1MIRA 2FUDA 3BPFA 3U8EA 4OEMA 1ITOA 1AYVA 4CDFB 1PIPA 2VHSA 1CQDA 1NL6A 3WXGA 2Y6EA 3B79A 1PADA 4BSQA 2NQGA 1JQPA 4YYUA 2XU1A 5CVMA 1PPOA 4CZWA 3N3GA 1KXRA 1U9XA 3MHHA 1BP4A 1MHWA 3GCBA 1AU2A 3OF9A 1QOLA 1EWMA 2CIOA 1ZCMA 1U5IA 3PDFA 1F2AA 3PNRA 4KLBA 4I07A 3LXSA 2G8JA 1VSNA 2DC6A 3NHEA 3P5UA 5CHTA 2E02A 3MORA 5A24A 3CBJA 5JH3A 2DCBA 4PP1A 1TL9A 1PPNA 1AYUA 4W5CA 1ATKA 4YYRA 1Y4HA 4YV8A 3V6EA 1U9VA 2PBHA 1EWLA 1NB3A 4BS5A 2VHFA 2GHUA 3V6CA 1GCBA 5FPWA 1NB5A 2G7YA 2NQAA 3BWKA 2DC8A 2FTDA 2HD5A 1M6DA 1PBHA 1BY8A 9PAPA 1YVBA 2AS8A 3CH3X 1EWOA 1VJVA 1CPJA 2AVWA 1THEA 1Y08A 2GFOA 4QH6A 1F2BA 3I06A 2P7UA 2DCDA 3WXFA 4Q8HA 1O0EA 3MTNA 2FO5A 2NQDB 5CVNB 3PBHA 3F5VA 1YK7A 4YVAA 3D6SA 1CB5A 2OULA 2DZYA 4PADA 3HWNA 5J94A 3OVXA 3KSEA 2PREA 2FRQA 3H8BA 1QDQA 1PPDA 1TLOA 4XR7A 3RVWA 4XUIA 1MS6A 4ZUXU 5PADA 1CTEA 4QRGA 3RVXA 3HHAA 2YJ8A 4N79A 3K9MA 3IMAA 4N8WA 1STFE 3I3TA 1PPPA 3E1ZB 2BDLA 2B1NA 3S3RA 6PADA 4N4ZA 2ATOA 4RY2A 2HHNA 1MDWA 2AIMA 2CB5A 4OELA 1KFXL 1A6RA 1YK8A 1U9WA 1FH0A 3BC3A 3KX1A 3TNXA 1S4VA 4PP2E 3AI8A 2FQ9A 3O0UA 4X6HA 1YALA 2O6XA 4CDEB 4CDCB 2R9OA 1U9QX 3CH2X 1AYWA 4DMXA 3C9EA 4BS6A 3OVZA 1TU6A 3DF0A 2WBFX 3H7DA 3KWZA 2B1MA 4K7CA 4WA6A 1BGOA 1NPZA 4W5BA 3P5XA 3H8CA 2OZ2A 2DCAA 1AU0A 3WXEA 1BQIA 1ICFA 2ARYA 3ERVA 2NQIA 3F75A 1ME4A 4YYSA 4CDDB 5EGWA 2YJ9A 1PE6A 1NLJA 2H7JA 3O1GA 3KW9A 2DZZA 2E00A 2P86A 4HWYA 1QMYA 1EF7A 4PI3A 2YJ2A 2R6NA 4I04A 4BQVA 2AU1A 2G8EA 3QJ3A 3OISA 5K16A 3USVA 1CVZA 2R9CA 3H89A 2YJBA 1YT7A 3LFYA 3IHPA 4QRXA 1XKGA 3P5VA 2BDZA 3QSDA 2AUZA 4QBBA 2DC9A 4AXMA 1NQCA 1GLOA 4DMYA 2IPPB 3OF8A 2HH5A 1CV8A 1PXVA 3IEJA 2E01A 4YYQA 3HD3A 2JQFR 2DCCA 2G6DA 4P6GA 5JA7A 3K24A 2FRAA 2IBIA 3KWBX 2DJGB 1MEMA 1GECE 1F29A 3QT4A 3BOWA 1SNKA 3N3KA 1CJLA 2DJFB 3IV2A 2HXZA 2PNSA 1CS8A 4QRVA 5CVOB 1HUCB 5F02A 4I05A 1Q6KA 3N4CA 4YYWA 2XU5A 4G54A 4Q8GA 3HHIA 1KFUL 3KKUA 4FK5A 4W4UA 1GMYA 2E03A 4AXLA 1ZIVA 4BPVA 5CHVA 1F2CA 1X9YA 1KHQA 2DC7A 1DEUA 1EWPA 1QXPA 1K3BB 1KHPA 3ZUAA 1SP4B 2OP3A 1AU4A 2XU3A
chains in the Genus database with same CATH superfamily
4OVZA 3P5WA 2P0RA 1POPA 1AU3A 2F7DA 4X6JA 3S3QA 2R9MA 2UZJA 3K8UA 2FYEA 2XU4A 1ME3A 2AYNA 2PADA 2Y5BA 1IWDA 4BOZA 1DF0A 3BPMA 4D8EA 2JQGR 1PCIA 4MSXA 2F1GA 2YJCA 4FJCA 4X6IA 4MZSA 3KFQA 2R9NA 3IUTA 4BOSA 3PW3A 2J7QC 2ACTA 8PCHA 2FT2A 3H6SA 7PCKA 2JTCA 4YYVA 5EF4A 3MHSA 1MEGA 2R9FA 3RVVA 2AYOA 4R3DA 3M99A 2C0YA 3CBKA 4FIPA 3RNVA 3IOQA 3BCNA 4MZOA 1CSBB 1AECA 3B21A 4P6EA 1AIMA 2AUXA 1MIRA 2FUDA 3BPFA 3U8EA 4PT5A 4OEMA 1ITOA 1AYVA 4CDFB 1PIPA 2VHSA 3ZNHA 1CQDA 4HXDB 1NL6A 3WXGA 2Y6EA 3B79A 1UKFA 1PADA 3PSEA 4BSQA 2NQGA 1JQPA 4YYUA 2XU1A 5CVMA 1PPOA 4CZWA 3N3GA 3W30A 1KXRA 1U9XA 3MHHA 1BP4A 1MHWA 3GCBA 4XZXA 1AU2A 2DOSA 3OF9A 1QOLA 1EWMA 3MJ5A 5KO3A 4A5UA 4MM3B 2CIOA 1DKIA 1ZCMA 1U5IA 3PDFA 1F2AA 3PNRA 4KLBA 4I07A 4RF1A 4OVZB 3LXSA 2G8JA 1VSNA 2DC6A 3NHEA 3P5UA 5CHTA 2E02A 3MORA 5A24A 3CBJA 5JH3A 2DCBA 4PP1A 1TL9A 1PPNA 1AYUA 4BOPA 4W5CA 1ATKA 5JZEA 4YYRA 1Y4HA 4YV8A 4M0WA 3V6EA 1U9VA 2PBHA 1EWLA 1NB3A 4BOUA 2VHFA 2GHUA 4BS5A 3V6CA 1GCBA 5FPWA 3PRMA 1NB5A 2G7YA 2NQAA 3BWKA 2DC8A 2FTDA 2HD5A 1M6DA 1PBHA 1BY8A 4RNAA 2J7QA 3MTVA 9PAPA 1YVBA 2AS8A 3CH3X 1EWOA 1VJVA 1CPJA 2AVWA 1THEA 1Y08A 2GFOA 4QH6A 1F2BA 3I06A 4REZA 2P7UA 2DCDA 3IFUA 3WXFA 4Q8HA 1O0EA 3MTNA 2FO5A 2NQDB 5CVNB 3PBHA 3F5VA 4WURA 1YK7A 4YVAA 3D6SA 1CB5A 2OULA 2DZYA 4PADA 3HWNA 5J94A 3OVXA 3KSEA 2PREA 2FRQA 3H8BA 1QDQA 1PPDA 1TLOA 4XR7A 3RVWA 4XUIA 1MS6A 2FE8A 4ZUXU 5PADA 1CTEA 4QRGA 3RVXA 3HHAA 2YJ8A 4N79A 5EZSA 3K9MA 3IMAA 4N8WA 1STFE 3I3TA 1PPPA 3E1ZB 2BDLA 2B1NA 3BB7A 3S3RA 6PADA 4N4ZA 3PHUA 2ATOA 4GUAA 2JRIA 4RY2A 2HHNA 1MDWA 2AIMA 2CB5A 4OELA 5EZQA 1KFXL 3PHWA 1A6RA 1YK8A 1YZBA 1U9WA 1FH0A 3BC3A 3KX1A 3TNXA 1S4VA 4PP2E 3AI8A 2FQ9A 3O0UA 4X6HA 1YALA 4BOQA 4P16A 2O6XA 2BTWA 4CDEB 4CDCB 2R9OA 1U9QX 3CH2X 1AYWA 4DMXA 3C0RA 3C9EA 4BS6A 3OVZA 1TU6A 3DF0A 4D8BA 2WBFX 3H7DA 3PT2A 3KWZA 2B1MA 4K7CA 4WA6A 1BGOA 1NPZA 4W5BA 3P5XA 3H8CA 5E6JA 2OZ2A 2BU3A 2DCAA 1AU0A 3WXEA 1BQIA 3BBAA 3TMPA 2HWKA 1ICFA 2ARYA 3ERVA 3O65A 2NQIA 3F75A 1PVJA 1ME4A 4YYSA 4CDDB 5EGWA 2YJ9A 1PE6A 1NLJA 2H7JA 3O1GA 3KW9A 2DZZA 2E00A 2P86A 4HWYA 1QMYA 1EF7A 4PI3A 2YJ2A 2R6NA 4I04A 4RF0A 4BQVA 2AU1A 2G8EA 3QJ3A 3OISA 3OQCA 3E9SA 5K16A 3USVA 1CVZA 4RKXA 2R9CA 3H89A 2YJBA 1YT7A 4MI7A 3LFYA 3IHPA 4QRXA 1XKGA 3P5VA 2BDZA 3QSDA 2AUZA 4QBBA 2DC9A 3PRPA 4AXMA 1NQCA 1GLOA 4DMYA 2IPPB 3OF8A 2HH5A 1CV8A 1PXVA 3IEJA 2E01A 4YYQA 3HD3A 2JQFR 2DCCA 2G6DA 4P6GA 5JA7A 4IP3A 3PHXA 4ZTBA 3K24A 2FRAA 2Z84A 3BY4A 2IBIA 3KWBX 2DJGB 1MEMA 1GECE 1F29A 3QT4A 3BOWA 1SNKA 4IUMA 2BTWB 3N3KA 1CJLA 2DJFB 3IV2A 2AGAA 2HXZA 2PNSA 4OW0A 4D8IA 1CS8A 4QRVA 5CVOB 1HUCB 5F02A 4I05A 1Q6KA 3N4CA 4YYWA 2XU5A 4G54A 4Q8GA 3HHIA 1KFUL 3KKUA 4FK5A 4W4UA 1GMYA 2E03A 4AXLA 1ZIVA 3MP2A 3W31A 4BPVA 5CHVA 1F2CA 1X9YA 1KHQA 2DC7A 1DEUA 1EWPA 1QXPA 1K3BB 3TRKA 1KHPA 3ZUAA 1SP4B 2OP3A 1AU4A 2XU3A
chains in the Genus database with same CATH topology
3P5WA 2P0RA 1POPA 1AU3A 2F7DA 4X6JA 3S3QA 4BGFA 2R9MA 3K8UA 2FYEA 2XU4A 1ME3A 2AYNA 2PADA 2Y5BA 4GUZA 1IWDA 1DF0A 3BPMA 2JQGR 1PCIA 4MSXA 2F1GA 2YJCA 4FJCA 4X6IA 4MZSA 3KFQA 2R9NA 3IUTA 3PW3A 2ACTA 8PCHA 2FT2A 3H6SA 7PCKA 4YYVA 5EF4A 3MHSA 1MEGA 2R9FA 3RVVA 2AYOA 3M99A 2C0YA 3CBKA 4NV8A 4FIPA 3IOQA 3BCNA 4MZOA 1CSBB 1AECA 4P6EA 1AIMA 2AUXA 1MIRA 2FUDA 3BPFA 3U8EA 4OEMA 1ITOA 2VFCA 1AYVA 4CDFB 1PIPA 2VHSA 1CQDA 1NL6A 3WXGA 2Y6EA 3B79A 1PADA 4BSQA 2NQGA 1JQPA 4YYUA 2XU1A 5CVMA 1PPOA 4CZWA 3N3GA 1KXRA 1U9XA 3MHHA 1BP4A 1MHWA 1W6FA 3GCBA 4C5PA 1AU2A 3OF9A 2BSZA 1QOLA 1EWMA 2CIOA 1ZCMA 1U5IA 1W4TA 3PDFA 1F2AA 3PNRA 4KLBA 4I07A 3LXSA 2G8JA 1VSNA 2DC6A 3NHEA 3P5UA 5CHTA 2E02A 3MORA 5A24A 3CBJA 5JH3A 2DCBA 4PP1A 1TL9A 1PPNA 1AYUA 4W5CA 1ATKA 4YYRA 1Y4HA 4YV8A 3V6EA 1U9VA 2PBHA 1EWLA 1NB3A 4BS5A 2VHFA 2GHUA 3V6CA 1GCBA 5FPWA 1NB5A 2G7YA 2NQAA 3BWKA 2DC8A 2FTDA 2HD5A 1M6DA 1PBHA 1BY8A 9PAPA 1YVBA 2AS8A 3CH3X 1EWOA 1VJVA 1CPJA 2AVWA 1THEA 1Y08A 2GFOA 4QH6A 1F2BA 3I06A 2P7UA 2DCDA 3WXFA 4Q8HA 1O0EA 3MTNA 2FO5A 2NQDB 5CVNB 3PBHA 3F5VA 1YK7A 4YVAA 3D6SA 1CB5A 2OULA 2DZYA 4PADA 3HWNA 5J94A 3OVXA 3KSEA 2PREA 2FRQA 3H8BA 1QDQA 1PPDA 1TLOA 4XR7A 3RVWA 4XUIA 1MS6A 4ZUXU 5PADA 1CTEA 4QRGA 3RVXA 3HHAA 2YJ8A 4N79A 3K9MA 3IMAA 4N8WA 1STFE 3I3TA 1PPPA 3E1ZB 2BDLA 2B1NA 3S3RA 6PADA 4N4ZA 2ATOA 4RY2A 2HHNA 1MDWA 2AIMA 2CB5A 1W5RA 4OELA 1GX3A 1KFXL 1A6RA 1YK8A 1U9WA 1FH0A 3BC3A 3KX1A 3TNXA 1E2TA 1S4VA 4PP2E 3AI8A 2FQ9A 3O0UA 4X6HA 1YALA 2O6XA 4CDEB 4CDCB 2R9OA 1U9QX 3CH2X 1AYWA 3LTWA 4DMXA 3C9EA 4BS6A 3OVZA 1TU6A 3DF0A 2WBFX 3H7DA 3KWZA 2B1MA 4K7CA 4WA6A 1BGOA 1NPZA 4W5BA 3P5XA 3H8CA 2OZ2A 2DCAA 1AU0A 3WXEA 2VFBA 1BQIA 1ICFA 2ARYA 3ERVA 2NQIA 3F75A 1ME4A 4YYSA 4CDDB 5EGWA 2YJ9A 1PE6A 1NLJA 2H7JA 3O1GA 3KW9A 2DZZA 2E00A 2P86A 4HWYA 1QMYA 1EF7A 4PI3A 2YJ2A 2R6NA 4I04A 4BQVA 2AU1A 2G8EA 3QJ3A 3OISA 5K16A 3USVA 1CVZA 4B55A 2R9CA 3H89A 2YJBA 1YT7A 3LFYA 3IHPA 4QRXA 1XKGA 3P5VA 2BDZA 3QSDA 2AUZA 4QBBA 4NV7A 2DC9A 4AXMA 1NQCA 1GLOA 4DMYA 2IPPB 3OF8A 2HH5A 1CV8A 1PXVA 3IEJA 2E01A 4YYQA 3HD3A 2JQFR 2DCCA 2G6DA 4P6GA 5JA7A 3K24A 2FRAA 2IBIA 3KWBX 2DJGB 1MEMA 1GECE 1F29A 3QT4A 3BOWA 1SNKA 3N3KA 1CJLA 2DJFB 3IV2A 2HXZA 2PNSA 1CS8A 4QRVA 5CVOB 1HUCB 5F02A 4I05A 1Q6KA 3N4CA 4YYWA 2XU5A 4G54A 4Q8GA 3HHIA 1KFUL 3KKUA 4FK5A 4W4UA 1GMYA 2E03A 4AXLA 1ZIVA 4BPVA 5CHVA 1F2CA 1X9YA 1KHQA 2DC7A 1DEUA 1EWPA 3D9WA 1QXPA 1K3BB 1KHPA 3ZUAA 1SP4B 2OP3A 1AU4A 2XU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P5W A;  2P0R A;  1POP A;  1AU3 A;  2F7D A;  4X6J A;  3S3Q A;  2R9M A;  3K8U A;  2FYE A;  2XU4 A;  1ME3 A;  2AYN A;  2PAD A;  2Y5B A;  1IWD A;  1DF0 A;  3BPM A;  2JQG R;  1PCI A;  4MSX A;  2F1G A;  2YJC A;  4FJC A;  4X6I A;  4MZS A;  3KFQ A;  2R9N A;  3IUT A;  3PW3 A;  2ACT A;  8PCH A;  2FT2 A;  3H6S A;  7PCK A;  4YYV A;  5EF4 A;  3MHS A;  1MEG A;  2R9F A;  3RVV A;  2AYO A;  3M99 A;  2C0Y A;  3CBK A;  4FIP A;  3IOQ A;  3BCN A;  4MZO A;  1CSB B;  1AEC A;  4P6E A;  1AIM A;  2AUX A;  1MIR A;  2FUD A;  3BPF A;  3U8E A;  4OEM A;  1ITO A;  1AYV A;  4CDF B;  1PIP A;  2VHS A;  1CQD A;  1NL6 A;  3WXG A;  2Y6E A;  3B79 A;  1PAD A;  4BSQ A;  2NQG A;  1JQP A;  4YYU A;  2XU1 A;  5CVM A;  1PPO A;  4CZW A;  3N3G A;  1KXR A;  1U9X A;  3MHH A;  1BP4 A;  1MHW A;  3GCB A;  1AU2 A;  3OF9 A;  1QOL A;  1EWM A;  2CIO A;  1ZCM A;  1U5I A;  3PDF A;  1F2A A;  3PNR A;  4KLB A;  4I07 A;  3LXS A;  2G8J A;  1VSN A;  2DC6 A;  3NHE A;  3P5U A;  5CHT A;  2E02 A;  3MOR A;  5A24 A;  3CBJ A;  5JH3 A;  2DCB A;  4PP1 A;  1TL9 A;  1PPN A;  1AYU A;  4W5C A;  1ATK A;  4YYR A;  1Y4H A;  4YV8 A;  3V6E A;  1U9V A;  2PBH A;  1EWL A;  1NB3 A;  4BS5 A;  2VHF A;  2GHU A;  3V6C A;  1GCB A;  5FPW A;  1NB5 A;  2G7Y A;  2NQA A;  3BWK A;  2DC8 A;  2FTD A;  2HD5 A;  1M6D A;  1PBH A;  1BY8 A;  9PAP A;  1YVB A;  2AS8 A;  3CH3 X;  1EWO A;  1VJV A;  1CPJ A;  2AVW A;  1THE A;  1Y08 A;  2GFO A;  4QH6 A;  1F2B A;  3I06 A;  2P7U A;  2DCD A;  3WXF A;  4Q8H A;  1O0E A;  3MTN A;  2FO5 A;  2NQD B;  5CVN B;  3PBH A;  3F5V A;  1YK7 A;  4YVA A;  3D6S A;  1CB5 A;  2OUL A;  2DZY A;  4PAD A;  3HWN A;  5J94 A;  3OVX A;  3KSE A;  2PRE A;  2FRQ A;  3H8B A;  1QDQ A;  1PPD A;  1TLO A;  4XR7 A;  3RVW A;  4XUI A;  1MS6 A;  4ZUX U;  5PAD A;  1CTE A;  4QRG A;  3RVX A;  3HHA A;  2YJ8 A;  4N79 A;  3K9M A;  3IMA A;  4N8W A;  1STF E;  3I3T A;  1PPP A;  3E1Z B;  2BDL A;  2B1N A;  3S3R A;  6PAD A;  4N4Z A;  2ATO A;  4RY2 A;  2HHN A;  1MDW A;  2AIM A;  2CB5 A;  4OEL A;  1KFX L;  1A6R A;  1YK8 A;  1U9W A;  1FH0 A;  3BC3 A;  3KX1 A;  3TNX A;  1S4V A;  4PP2 E;  3AI8 A;  2FQ9 A;  3O0U A;  4X6H A;  1YAL A;  2O6X A;  4CDE B;  4CDC B;  2R9O A;  1U9Q X;  3CH2 X;  1AYW A;  4DMX A;  3C9E A;  4BS6 A;  3OVZ A;  1TU6 A;  3DF0 A;  2WBF X;  3H7D A;  3KWZ A;  2B1M A;  4K7C A;  4WA6 A;  1BGO A;  1NPZ A;  4W5B A;  3P5X A;  3H8C A;  2OZ2 A;  2DCA A;  1AU0 A;  3WXE A;  1BQI A;  1ICF A;  2ARY A;  3ERV A;  2NQI A;  3F75 A;  1ME4 A;  4YYS A;  4CDD B;  5EGW A;  2YJ9 A;  1PE6 A;  1NLJ A;  2H7J A;  3O1G A;  3KW9 A;  2DZZ A;  2E00 A;  2P86 A;  4HWY A;  1QMY A;  1EF7 A;  4PI3 A;  2YJ2 A;  2R6N A;  4I04 A;  4BQV A;  2AU1 A;  2G8E A;  3QJ3 A;  3OIS A;  5K16 A;  3USV A;  1CVZ A;  2R9C A;  3H89 A;  2YJB A;  1YT7 A;  3LFY A;  3IHP A;  4QRX A;  1XKG A;  3P5V A;  2BDZ A;  3QSD A;  2AUZ A;  4QBB A;  2DC9 A;  4AXM A;  1NQC A;  1GLO A;  4DMY A;  2IPP B;  3OF8 A;  2HH5 A;  1CV8 A;  1PXV A;  3IEJ A;  2E01 A;  4YYQ A;  3HD3 A;  2JQF R;  2DCC A;  2G6D A;  4P6G A;  5JA7 A;  3K24 A;  2FRA A;  2IBI A;  3KWB X;  2DJG B;  1MEM A;  1GEC E;  1F29 A;  3QT4 A;  3BOW A;  1SNK A;  3N3K A;  1CJL A;  2DJF B;  3IV2 A;  2HXZ A;  2PNS A;  1CS8 A;  4QRV A;  5CVO B;  1HUC B;  5F02 A;  4I05 A;  1Q6K A;  3N4C A;  4YYW A;  2XU5 A;  4G54 A;  4Q8G A;  3HHI A;  1KFU L;  3KKU A;  4FK5 A;  4W4U A;  1GMY A;  2E03 A;  4AXL A;  1ZIV A;  4BPV A;  5CHV A;  1F2C A;  1X9Y A;  1KHQ A;  2DC7 A;  1DEU A;  1EWP A;  1QXP A;  1K3B B;  1KHP A;  3ZUA A;  1SP4 B;  2OP3 A;  1AU4 A;  2XU3 A; 
#chains in the Genus database with same CATH topology
 4OVZ A;  3P5W A;  2P0R A;  1POP A;  1AU3 A;  2F7D A;  4X6J A;  3S3Q A;  2R9M A;  2UZJ A;  3K8U A;  2FYE A;  2XU4 A;  1ME3 A;  2AYN A;  2PAD A;  2Y5B A;  1IWD A;  4BOZ A;  1DF0 A;  3BPM A;  4D8E A;  2JQG R;  1PCI A;  4MSX A;  2F1G A;  2YJC A;  4FJC A;  4X6I A;  4MZS A;  3KFQ A;  2R9N A;  3IUT A;  4BOS A;  3PW3 A;  2J7Q C;  2ACT A;  8PCH A;  2FT2 A;  3H6S A;  7PCK A;  2JTC A;  4YYV A;  5EF4 A;  3MHS A;  1MEG A;  2R9F A;  3RVV A;  2AYO A;  4R3D A;  3M99 A;  2C0Y A;  3CBK A;  4FIP A;  3RNV A;  3IOQ A;  3BCN A;  4MZO A;  1CSB B;  1AEC A;  3B21 A;  4P6E A;  1AIM A;  2AUX A;  1MIR A;  2FUD A;  3BPF A;  3U8E A;  4PT5 A;  4OEM A;  1ITO A;  1AYV A;  4CDF B;  1PIP A;  2VHS A;  3ZNH A;  1CQD A;  4HXD B;  1NL6 A;  3WXG A;  2Y6E A;  3B79 A;  1UKF A;  1PAD A;  3PSE A;  4BSQ A;  2NQG A;  1JQP A;  4YYU A;  2XU1 A;  5CVM A;  1PPO A;  4CZW A;  3N3G A;  3W30 A;  1KXR A;  1U9X A;  3MHH A;  1BP4 A;  1MHW A;  3GCB A;  4XZX A;  1AU2 A;  2DOS A;  3OF9 A;  1QOL A;  1EWM A;  3MJ5 A;  5KO3 A;  4A5U A;  4MM3 B;  2CIO A;  1DKI A;  1ZCM A;  1U5I A;  3PDF A;  1F2A A;  3PNR A;  4KLB A;  4I07 A;  4RF1 A;  4OVZ B;  3LXS A;  2G8J A;  1VSN A;  2DC6 A;  3NHE A;  3P5U A;  5CHT A;  2E02 A;  3MOR A;  5A24 A;  3CBJ A;  5JH3 A;  2DCB A;  4PP1 A;  1TL9 A;  1PPN A;  1AYU A;  4BOP A;  4W5C A;  1ATK A;  5JZE A;  4YYR A;  1Y4H A;  4YV8 A;  4M0W A;  3V6E A;  1U9V A;  2PBH A;  1EWL A;  1NB3 A;  4BOU A;  2VHF A;  2GHU A;  4BS5 A;  3V6C A;  1GCB A;  5FPW A;  3PRM A;  1NB5 A;  2G7Y A;  2NQA A;  3BWK A;  2DC8 A;  2FTD A;  2HD5 A;  1M6D A;  1PBH A;  1BY8 A;  4RNA A;  2J7Q A;  3MTV A;  9PAP A;  1YVB A;  2AS8 A;  3CH3 X;  1EWO A;  1VJV A;  1CPJ A;  2AVW A;  1THE A;  1Y08 A;  2GFO A;  4QH6 A;  1F2B A;  3I06 A;  4REZ A;  2P7U A;  2DCD A;  3IFU A;  3WXF A;  4Q8H A;  1O0E A;  3MTN A;  2FO5 A;  2NQD B;  5CVN B;  3PBH A;  3F5V A;  4WUR A;  1YK7 A;  4YVA A;  3D6S A;  1CB5 A;  2OUL A;  2DZY A;  4PAD A;  3HWN A;  5J94 A;  3OVX A;  3KSE A;  2PRE A;  2FRQ A;  3H8B A;  1QDQ A;  1PPD A;  1TLO A;  4XR7 A;  3RVW A;  4XUI A;  1MS6 A;  2FE8 A;  4ZUX U;  5PAD A;  1CTE A;  4QRG A;  3RVX A;  3HHA A;  2YJ8 A;  4N79 A;  5EZS A;  3K9M A;  3IMA A;  4N8W A;  1STF E;  3I3T A;  1PPP A;  3E1Z B;  2BDL A;  2B1N A;  3BB7 A;  3S3R A;  6PAD A;  4N4Z A;  3PHU A;  2ATO A;  4GUA A;  2JRI A;  4RY2 A;  2HHN A;  1MDW A;  2AIM A;  2CB5 A;  4OEL A;  5EZQ A;  1KFX L;  3PHW A;  1A6R A;  1YK8 A;  1YZB A;  1U9W A;  1FH0 A;  3BC3 A;  3KX1 A;  3TNX A;  1S4V A;  4PP2 E;  3AI8 A;  2FQ9 A;  3O0U A;  4X6H A;  1YAL A;  4BOQ A;  4P16 A;  2O6X A;  2BTW A;  4CDE B;  4CDC B;  2R9O A;  1U9Q X;  3CH2 X;  1AYW A;  4DMX A;  3C0R A;  3C9E A;  4BS6 A;  3OVZ A;  1TU6 A;  3DF0 A;  4D8B A;  2WBF X;  3H7D A;  3PT2 A;  3KWZ A;  2B1M A;  4K7C A;  4WA6 A;  1BGO A;  1NPZ A;  4W5B A;  3P5X A;  3H8C A;  5E6J A;  2OZ2 A;  2BU3 A;  2DCA A;  1AU0 A;  3WXE A;  1BQI A;  3BBA A;  3TMP A;  2HWK A;  1ICF A;  2ARY A;  3ERV A;  3O65 A;  2NQI A;  3F75 A;  1PVJ A;  1ME4 A;  4YYS A;  4CDD B;  5EGW A;  2YJ9 A;  1PE6 A;  1NLJ A;  2H7J A;  3O1G A;  3KW9 A;  2DZZ A;  2E00 A;  2P86 A;  4HWY A;  1QMY A;  1EF7 A;  4PI3 A;  2YJ2 A;  2R6N A;  4I04 A;  4RF0 A;  4BQV A;  2AU1 A;  2G8E A;  3QJ3 A;  3OIS A;  3OQC A;  3E9S A;  5K16 A;  3USV A;  1CVZ A;  4RKX A;  2R9C A;  3H89 A;  2YJB A;  1YT7 A;  4MI7 A;  3LFY A;  3IHP A;  4QRX A;  1XKG A;  3P5V A;  2BDZ A;  3QSD A;  2AUZ A;  4QBB A;  2DC9 A;  3PRP A;  4AXM A;  1NQC A;  1GLO A;  4DMY A;  2IPP B;  3OF8 A;  2HH5 A;  1CV8 A;  1PXV A;  3IEJ A;  2E01 A;  4YYQ A;  3HD3 A;  2JQF R;  2DCC A;  2G6D A;  4P6G A;  5JA7 A;  4IP3 A;  3PHX A;  4ZTB A;  3K24 A;  2FRA A;  2Z84 A;  3BY4 A;  2IBI A;  3KWB X;  2DJG B;  1MEM A;  1GEC E;  1F29 A;  3QT4 A;  3BOW A;  1SNK A;  4IUM A;  2BTW B;  3N3K A;  1CJL A;  2DJF B;  3IV2 A;  2AGA A;  2HXZ A;  2PNS A;  4OW0 A;  4D8I A;  1CS8 A;  4QRV A;  5CVO B;  1HUC B;  5F02 A;  4I05 A;  1Q6K A;  3N4C A;  4YYW A;  2XU5 A;  4G54 A;  4Q8G A;  3HHI A;  1KFU L;  3KKU A;  4FK5 A;  4W4U A;  1GMY A;  2E03 A;  4AXL A;  1ZIV A;  3MP2 A;  3W31 A;  4BPV A;  5CHV A;  1F2C A;  1X9Y A;  1KHQ A;  2DC7 A;  1DEU A;  1EWP A;  1QXP A;  1K3B B;  3TRK A;  1KHP A;  3ZUA A;  1SP4 B;  2OP3 A;  1AU4 A;  2XU3 A; 
#chains in the Genus database with same CATH homology
 3P5W A;  2P0R A;  1POP A;  1AU3 A;  2F7D A;  4X6J A;  3S3Q A;  4BGF A;  2R9M A;  3K8U A;  2FYE A;  2XU4 A;  1ME3 A;  2AYN A;  2PAD A;  2Y5B A;  4GUZ A;  1IWD A;  1DF0 A;  3BPM A;  2JQG R;  1PCI A;  4MSX A;  2F1G A;  2YJC A;  4FJC A;  4X6I A;  4MZS A;  3KFQ A;  2R9N A;  3IUT A;  3PW3 A;  2ACT A;  8PCH A;  2FT2 A;  3H6S A;  7PCK A;  4YYV A;  5EF4 A;  3MHS A;  1MEG A;  2R9F A;  3RVV A;  2AYO A;  3M99 A;  2C0Y A;  3CBK A;  4NV8 A;  4FIP A;  3IOQ A;  3BCN A;  4MZO A;  1CSB B;  1AEC A;  4P6E A;  1AIM A;  2AUX A;  1MIR A;  2FUD A;  3BPF A;  3U8E A;  4OEM A;  1ITO A;  2VFC A;  1AYV A;  4CDF B;  1PIP A;  2VHS A;  1CQD A;  1NL6 A;  3WXG A;  2Y6E A;  3B79 A;  1PAD A;  4BSQ A;  2NQG A;  1JQP A;  4YYU A;  2XU1 A;  5CVM A;  1PPO A;  4CZW A;  3N3G A;  1KXR A;  1U9X A;  3MHH A;  1BP4 A;  1MHW A;  1W6F A;  3GCB A;  4C5P A;  1AU2 A;  3OF9 A;  2BSZ A;  1QOL A;  1EWM A;  2CIO A;  1ZCM A;  1U5I A;  1W4T A;  3PDF A;  1F2A A;  3PNR A;  4KLB A;  4I07 A;  3LXS A;  2G8J A;  1VSN A;  2DC6 A;  3NHE A;  3P5U A;  5CHT A;  2E02 A;  3MOR A;  5A24 A;  3CBJ A;  5JH3 A;  2DCB A;  4PP1 A;  1TL9 A;  1PPN A;  1AYU A;  4W5C A;  1ATK A;  4YYR A;  1Y4H A;  4YV8 A;  3V6E A;  1U9V A;  2PBH A;  1EWL A;  1NB3 A;  4BS5 A;  2VHF A;  2GHU A;  3V6C A;  1GCB A;  5FPW A;  1NB5 A;  2G7Y A;  2NQA A;  3BWK A;  2DC8 A;  2FTD A;  2HD5 A;  1M6D A;  1PBH A;  1BY8 A;  9PAP A;  1YVB A;  2AS8 A;  3CH3 X;  1EWO A;  1VJV A;  1CPJ A;  2AVW A;  1THE A;  1Y08 A;  2GFO A;  4QH6 A;  1F2B A;  3I06 A;  2P7U A;  2DCD A;  3WXF A;  4Q8H A;  1O0E A;  3MTN A;  2FO5 A;  2NQD B;  5CVN B;  3PBH A;  3F5V A;  1YK7 A;  4YVA A;  3D6S A;  1CB5 A;  2OUL A;  2DZY A;  4PAD A;  3HWN A;  5J94 A;  3OVX A;  3KSE A;  2PRE A;  2FRQ A;  3H8B A;  1QDQ A;  1PPD A;  1TLO A;  4XR7 A;  3RVW A;  4XUI A;  1MS6 A;  4ZUX U;  5PAD A;  1CTE A;  4QRG A;  3RVX A;  3HHA A;  2YJ8 A;  4N79 A;  3K9M A;  3IMA A;  4N8W A;  1STF E;  3I3T A;  1PPP A;  3E1Z B;  2BDL A;  2B1N A;  3S3R A;  6PAD A;  4N4Z A;  2ATO A;  4RY2 A;  2HHN A;  1MDW A;  2AIM A;  2CB5 A;  1W5R A;  4OEL A;  1GX3 A;  1KFX L;  1A6R A;  1YK8 A;  1U9W A;  1FH0 A;  3BC3 A;  3KX1 A;  3TNX A;  1E2T A;  1S4V A;  4PP2 E;  3AI8 A;  2FQ9 A;  3O0U A;  4X6H A;  1YAL A;  2O6X A;  4CDE B;  4CDC B;  2R9O A;  1U9Q X;  3CH2 X;  1AYW A;  3LTW A;  4DMX A;  3C9E A;  4BS6 A;  3OVZ A;  1TU6 A;  3DF0 A;  2WBF X;  3H7D A;  3KWZ A;  2B1M A;  4K7C A;  4WA6 A;  1BGO A;  1NPZ A;  4W5B A;  3P5X A;  3H8C A;  2OZ2 A;  2DCA A;  1AU0 A;  3WXE A;  2VFB A;  1BQI A;  1ICF A;  2ARY A;  3ERV A;  2NQI A;  3F75 A;  1ME4 A;  4YYS A;  4CDD B;  5EGW A;  2YJ9 A;  1PE6 A;  1NLJ A;  2H7J A;  3O1G A;  3KW9 A;  2DZZ A;  2E00 A;  2P86 A;  4HWY A;  1QMY A;  1EF7 A;  4PI3 A;  2YJ2 A;  2R6N A;  4I04 A;  4BQV A;  2AU1 A;  2G8E A;  3QJ3 A;  3OIS A;  5K16 A;  3USV A;  1CVZ A;  4B55 A;  2R9C A;  3H89 A;  2YJB A;  1YT7 A;  3LFY A;  3IHP A;  4QRX A;  1XKG A;  3P5V A;  2BDZ A;  3QSD A;  2AUZ A;  4QBB A;  4NV7 A;  2DC9 A;  4AXM A;  1NQC A;  1GLO A;  4DMY A;  2IPP B;  3OF8 A;  2HH5 A;  1CV8 A;  1PXV A;  3IEJ A;  2E01 A;  4YYQ A;  3HD3 A;  2JQF R;  2DCC A;  2G6D A;  4P6G A;  5JA7 A;  3K24 A;  2FRA A;  2IBI A;  3KWB X;  2DJG B;  1MEM A;  1GEC E;  1F29 A;  3QT4 A;  3BOW A;  1SNK A;  3N3K A;  1CJL A;  2DJF B;  3IV2 A;  2HXZ A;  2PNS A;  1CS8 A;  4QRV A;  5CVO B;  1HUC B;  5F02 A;  4I05 A;  1Q6K A;  3N4C A;  4YYW A;  2XU5 A;  4G54 A;  4Q8G A;  3HHI A;  1KFU L;  3KKU A;  4FK5 A;  4W4U A;  1GMY A;  2E03 A;  4AXL A;  1ZIV A;  4BPV A;  5CHV A;  1F2C A;  1X9Y A;  1KHQ A;  2DC7 A;  1DEU A;  1EWP A;  3D9W A;  1QXP A;  1K3B B;  1KHP A;  3ZUA A;  1SP4 B;  2OP3 A;  1AU4 A;  2XU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...