1STFE

The refined 2.4 angstroms x-ray crystal structure of recombinant human stefin b in complex with the cysteine proteinase papain: a novel type of proteinase inhibitor interaction
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
212
structure length
211
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The refined 2.4 A X-ray crystal structure of recombinant human stefin B in complex with the cysteine proteinase papain: a novel type of proteinase inhibitor interaction.
pubmed rcsb
source organism Carica papaya
molecule tags Hydrolase(sulfhydryl proteinase)
molecule keywords PAPAIN
total genus 63
structure length 211
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1993-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1stfE00
3WXEA 1BY8A 2F1GA 4DMYA 1NB5A 3NHEA 1MEMA 4DMXA 1CTEA 1BGOA 4CDCB 1GECE 3IMAA 4RY2A 2DJFB 2FYEA 1KFUL 1PE6A 3K8UA 1MS6A 3KSEA 1Y08A 3KKUA 2HHNA 1TU6A 2YJ2A 1SNKA 4QH6A 1HUCB 5JA7A 3BPMA 2O6XA 4P6EA 2C0YA 1GMYA 4W5BA 3CH3X 3RVXA 1CV8A 2FQ9A 2E03A 3OVZA 3H8BA 2FO5A 1ME4A 5J94A 1X9YA 4CDFB 4OELA 4YYSA 1ZCMA 3DF0A 1KXRA 4PP1A 2DCDA 3QSDA 2R9OA 4I07A 4Q8GA 1AYUA 1NB3A 2FT2A 1ME3A 3P5XA 1EF7A 2PREA 3CH2X 3OF8A 3F75A 4YYWA 3QT4A 2FRQA 2GFOA 2PBHA 5K16A 2B1NA 3KFQA 4AXLA 2FUDA 1EWPA 3QJ3A 2DC9A 2XU3A 3H89A 3S3RA 3LFYA 2H7JA 5CVOB 2NQDB 2AVWA 3N4CA 2G6DA 1NLJA 1PIPA 3IHPA 4X6HA 2YJBA 3P5VA 4YVAA 4KLBA 3I06A 5JH3A 1CJLA 4CDDB 3IEJA 2R6NA 1PADA 1M6DA 4I05A 3K24A 1AECA 1QMYA 4K7CA 1DEUA 1KFXL 2AUZA 3HD3A 4N4ZA 3H8CA 3RVVA 1NL6A 1A6RA 3IV2A 2E00A 4WA6A 3D6SA 1PPNA 2DZYA 1MIRA 2G8JA 1AU2A 5F02A 1AU4A 1IWDA 2DCAA 3E1ZB 5A24A 1O0EA 2HH5A 4BQVA 3HHAA 4QRVA 2AYOA 3CBJA 1VJVA 3O1GA 3C9EA 1GCBA 1YT7A 2DZZA 2R9NA 1ICFA 3WXFA 2AS8A 1CS8A 3O0UA 3OF9A 3ZUAA 2DCBA 4P6GA 2XU4A 1BQIA 1VSNA 5FPWA 2PADA 2IBIA 2R9MA 1THEA 3IOQA 3K9MA 4QBBA 2VHSA 1S4VA 3KWZA 5CHVA 2FTDA 4YV8A 1F29A 3HWNA 1AYVA 3BCNA 3V6CA 3H6SA 2DJGB 3BOWA 1AYWA 2OP3A 2YJCA 4W5CA 3M99A 3KW9A 4YYRA 1CVZA 3OVXA 2BDZA 2ARYA 1TLOA 2VHFA 3MORA 4W4UA 2JQGR 1QOLA 2AUXA 1YALA 4QRGA 1PCIA 3I3TA 4G54A 1XKGA 2YJ9A 4FJCA 2GHUA 1PPOA 4YYQA 1KHPA 1PPPA 3RVWA 4PI3A 2Y5BA 1EWMA 4QRXA 5CHTA 1U5IA 1MDWA 5EF4A 4ZUXU 1MEGA 2JQFR 1U9QX 3MTNA 4HWYA 2B1MA 3H7DA 4AXMA 2BDLA 2R9FA 1POPA 2FRAA 4YYUA 2DC8A 3BC3A 3IUTA 4BS6A 2CIOA 7PCKA 3KWBX 4PADA 4CDEB 3B79A 4N8WA 1ZIVA 1NPZA 2ACTA 3GCBA 2IPPB 2NQGA 4CZWA 2E01A 4XR7A 2XU1A 2DC6A 4OEMA 3V6EA 4Q8HA 5CVNB 1JQPA 2AU1A 4I04A 4FK5A 5EGWA 1GLOA 3P5WA 2YJ8A 3LXSA 2P86A 3CBKA 1AU3A 2AYNA 9PAPA 2Y6EA 2DC7A 2P7UA 1FH0A 2XU5A 4MZOA 4BS5A 2OZ2A 1K3BB 1PBHA 3USVA 1F2BA 1NQCA 3BPFA 6PADA 1YK7A 4BSQA 3U8EA 4YYVA 1AU0A 2DCCA 2WBFX 3ERVA 5PADA 2PNSA 2NQAA 1MHWA 1F2CA 3BWKA 2HXZA 1AIMA 2G8EA 1CQDA 1F2AA 1PXVA 1YK8A 1KHQA 3WXGA 1TL9A 3OISA 2G7YA 2P0RA 2R9CA 1DF0A 1U9VA 2NQIA 4BPVA 4X6IA 1QDQA 3P5UA 3PW3A 1SP4B 4FIPA 1YVBA 1U9XA 1ITOA 1CPJA 2E02A 3PNRA 3N3KA 3F5VA 1BP4A 4N79A 1STFE 4MSXA 2CB5A 2F7DA 1CB5A 4PP2E 3S3QA 3N3GA 1EWLA 3AI8A 3MHSA 2OULA 3PBHA 8PCHA 2HD5A 1ATKA 1EWOA 1U9WA 4X6JA 3KX1A 3TNXA 1Q6KA 1QXPA 1Y4HA 1CSBB 4MZSA 3PDFA 4XUIA 3MHHA 1PPDA 2AIMA 5CVMA 3HHIA 2ATOA
chains in the Genus database with same CATH superfamily
4BOUA 3WXEA 1BY8A 2F1GA 4DMYA 3PRPA 5KO3A 1NB5A 3NHEA 2J7QA 1MEMA 4DMXA 1CTEA 1BGOA 4CDCB 1GECE 3IMAA 4BOZA 4RY2A 2DJFB 2FYEA 1KFUL 1PE6A 3K8UA 3PHWA 1MS6A 3KSEA 1Y08A 3KKUA 2HHNA 1TU6A 2YJ2A 1SNKA 4QH6A 1HUCB 5JA7A 3BPMA 2O6XA 4P6EA 2C0YA 1GMYA 4W5BA 3CH3X 3RVXA 1CV8A 2FQ9A 2E03A 3OVZA 4IP3A 3H8BA 2FO5A 1ME4A 5J94A 1X9YA 4CDFB 1UKFA 4OELA 4YYSA 1YZBA 1ZCMA 3DF0A 1KXRA 4PP1A 2DCDA 3QSDA 4RF0A 2R9OA 4I07A 4Q8GA 1AYUA 1NB3A 2FT2A 1ME3A 4MM3B 3P5XA 1EF7A 2PREA 3CH2X 3OF8A 4R3DA 3F75A 4YYWA 3QT4A 4MI7A 2FRQA 2GFOA 3MP2A 2PBHA 5K16A 2B1NA 4RF1A 3KFQA 4AXLA 3W31A 2FUDA 1EWPA 3QJ3A 2DC9A 2XU3A 3H89A 3S3RA 3LFYA 2H7JA 5CVOB 2NQDB 2AVWA 3N4CA 2G6DA 1NLJA 1PIPA 3IHPA 4X6HA 4M0WA 2YJBA 3C0RA 3P5VA 4YVAA 4KLBA 3I06A 5JH3A 5E6JA 1CJLA 4CDDB 3IEJA 2R6NA 1PADA 1M6DA 4I05A 3K24A 1AECA 1QMYA 4K7CA 3B21A 1DEUA 1KFXL 2AUZA 3HD3A 4N4ZA 3H8CA 3RVVA 1NL6A 1A6RA 3MTVA 3IV2A 2E00A 4WA6A 3D6SA 1PPNA 2DZYA 4RNAA 1MIRA 2G8JA 1AU2A 5F02A 4D8IA 3TMPA 1AU4A 1IWDA 2DCAA 3E1ZB 5A24A 1O0EA 2HH5A 4BQVA 3E9SA 3HHAA 4P16A 4QRVA 2AYOA 3CBJA 1VJVA 3O1GA 3C9EA 4OVZA 1GCBA 1YT7A 2DZZA 2R9NA 1ICFA 3WXFA 4HXDB 2DOSA 2AS8A 4XZXA 4BOSA 1CS8A 3O0UA 3OF9A 3ZUAA 2DCBA 2JRIA 4P6GA 2XU4A 1BQIA 1VSNA 5FPWA 2PADA 3OQCA 2IBIA 3BY4A 2R9MA 1THEA 3IOQA 3K9MA 3RNVA 4GUAA 4QBBA 3O65A 2VHSA 1S4VA 3KWZA 5CHVA 2FTDA 4YV8A 1F29A 2UZJA 3HWNA 1AYVA 3BCNA 3V6CA 3H6SA 2DJGB 3BOWA 1AYWA 2OP3A 2YJCA 4W5CA 3M99A 1PVJA 3KW9A 3TRKA 4YYRA 1CVZA 3OVXA 2BDZA 2ARYA 3BB7A 1TLOA 2VHFA 3MORA 4W4UA 2JQGR 1QOLA 2AUXA 1YALA 4QRGA 3PHXA 2Z84A 1PCIA 3I3TA 4G54A 1XKGA 2YJ9A 3ZNHA 2BTWB 4FJCA 2GHUA 1PPOA 4YYQA 4D8BA 1KHPA 2BTWA 1PPPA 3RVWA 4PI3A 3W30A 2Y5BA 4PT5A 1EWMA 4QRXA 5CHTA 4A5UA 1U5IA 1MDWA 5EF4A 4ZUXU 1MEGA 2JQFR 1U9QX 3MTNA 4HWYA 1DKIA 2B1MA 3H7DA 4AXMA 2BDLA 2R9FA 1POPA 2FRAA 4YYUA 4WURA 2DC8A 3BC3A 3IUTA 2J7QC 5EZSA 4BS6A 2CIOA 7PCKA 3KWBX 3PRMA 4PADA 4CDEB 3B79A 4N8WA 1ZIVA 4BOQA 1NPZA 2ACTA 3GCBA 2IPPB 2NQGA 4CZWA 2E01A 2XU1A 2DC6A 4OEMA 4XR7A 3V6EA 4BOPA 4Q8HA 5CVNB 1JQPA 2AU1A 4D8EA 4I04A 4FK5A 5EGWA 1GLOA 3P5WA 2YJ8A 3LXSA 2P86A 3PSEA 3CBKA 1AU3A 2AYNA 9PAPA 2Y6EA 2DC7A 2P7UA 1FH0A 2XU5A 4MZOA 4BS5A 2OZ2A 1K3BB 1PBHA 3IFUA 3USVA 1F2BA 3PT2A 1NQCA 3BBAA 3BPFA 6PADA 1YK7A 4BSQA 3U8EA 4YYVA 2HWKA 1AU0A 4REZA 2DCCA 2WBFX 3ERVA 5PADA 2PNSA 2NQAA 1MHWA 1F2CA 3BWKA 2HXZA 1AIMA 2G8EA 1CQDA 1F2AA 1PXVA 1YK8A 1KHQA 3WXGA 1TL9A 4IUMA 3OISA 2G7YA 2P0RA 2R9CA 1DF0A 1U9VA 2NQIA 4RKXA 4BPVA 4X6IA 1QDQA 3P5UA 3PW3A 1SP4B 4FIPA 1YVBA 1U9XA 4ZTBA 5EZQA 1ITOA 1CPJA 3PHUA 2E02A 3PNRA 3N3KA 3F5VA 1BP4A 4N79A 1STFE 4MSXA 5JZEA 2CB5A 2F7DA 1CB5A 4OVZB 4PP2E 3S3QA 3N3GA 1EWLA 2BU3A 3AI8A 2FE8A 3MHSA 2OULA 3PBHA 8PCHA 2JTCA 2HD5A 1ATKA 1EWOA 1U9WA 4X6JA 3KX1A 3TNXA 1Q6KA 3MJ5A 1QXPA 1Y4HA 1CSBB 4MZSA 4OW0A 3PDFA 4XUIA 3MHHA 1PPDA 2AIMA 5CVMA 3HHIA 2AGAA 2ATOA
chains in the Genus database with same CATH topology
3WXEA 1BY8A 2F1GA 4DMYA 1NB5A 3NHEA 1MEMA 1W6FA 4DMXA 1CTEA 1BGOA 4CDCB 1GECE 3IMAA 4RY2A 2DJFB 2FYEA 1KFUL 1PE6A 3K8UA 1MS6A 3KSEA 1Y08A 3KKUA 2HHNA 1TU6A 2YJ2A 1SNKA 4QH6A 1HUCB 5JA7A 3BPMA 2O6XA 4P6EA 2C0YA 1GMYA 4W5BA 3CH3X 3RVXA 1CV8A 2FQ9A 2E03A 3OVZA 3H8BA 2FO5A 1ME4A 5J94A 1X9YA 4CDFB 4OELA 4YYSA 1ZCMA 3DF0A 1KXRA 4PP1A 2DCDA 3QSDA 2R9OA 4I07A 4Q8GA 1AYUA 1NB3A 2FT2A 1ME3A 3P5XA 1EF7A 2PREA 3CH2X 3OF8A 3F75A 4YYWA 3QT4A 2FRQA 2GFOA 2PBHA 5K16A 2B1NA 3KFQA 4AXLA 2VFBA 2FUDA 1EWPA 3QJ3A 2DC9A 2VFCA 2XU3A 3H89A 3S3RA 3LFYA 2H7JA 5CVOB 2NQDB 2AVWA 3N4CA 2G6DA 1NLJA 1PIPA 3IHPA 4X6HA 2YJBA 3P5VA 4YVAA 4KLBA 3I06A 5JH3A 1CJLA 4CDDB 3IEJA 2R6NA 1PADA 4GUZA 1M6DA 4I05A 3K24A 1AECA 1QMYA 4K7CA 1DEUA 1KFXL 2AUZA 3HD3A 3LTWA 4N4ZA 3H8CA 3RVVA 1NL6A 1A6RA 3IV2A 2E00A 4WA6A 3D6SA 1PPNA 4C5PA 2DZYA 1MIRA 2G8JA 1AU2A 5F02A 1AU4A 1IWDA 2DCAA 3E1ZB 5A24A 1O0EA 2HH5A 4BQVA 3HHAA 4QRVA 2AYOA 3CBJA 1VJVA 3O1GA 3C9EA 1GCBA 1YT7A 2DZZA 2R9NA 1ICFA 3WXFA 2AS8A 1CS8A 3O0UA 3OF9A 3ZUAA 2DCBA 4P6GA 2XU4A 1BQIA 1VSNA 5FPWA 2PADA 2IBIA 2R9MA 1THEA 3IOQA 3K9MA 4QBBA 2VHSA 1S4VA 3KWZA 5CHVA 2FTDA 4YV8A 1F29A 3HWNA 1AYVA 3BCNA 3V6CA 3H6SA 2DJGB 3BOWA 1AYWA 2OP3A 2YJCA 4W5CA 3M99A 3KW9A 4YYRA 1CVZA 3OVXA 2BDZA 2ARYA 1TLOA 2VHFA 3MORA 4W4UA 2JQGR 1QOLA 2AUXA 2BSZA 1YALA 4QRGA 1PCIA 3I3TA 4G54A 1XKGA 2YJ9A 4FJCA 2GHUA 1PPOA 4YYQA 1KHPA 1PPPA 3RVWA 4PI3A 2Y5BA 1EWMA 4QRXA 5CHTA 1W4TA 1U5IA 1MDWA 5EF4A 4ZUXU 1MEGA 2JQFR 1U9QX 3MTNA 4HWYA 2B1MA 3H7DA 4AXMA 2BDLA 2R9FA 1POPA 2FRAA 4YYUA 2DC8A 3BC3A 3IUTA 4BS6A 2CIOA 7PCKA 3KWBX 4PADA 4CDEB 3B79A 4N8WA 1ZIVA 1NPZA 4NV7A 2ACTA 3GCBA 2IPPB 2NQGA 4CZWA 2E01A 4XR7A 2XU1A 2DC6A 4OEMA 3V6EA 4Q8HA 5CVNB 1JQPA 2AU1A 4I04A 3D9WA 4FK5A 5EGWA 1GLOA 3P5WA 2YJ8A 3LXSA 2P86A 3CBKA 1AU3A 2AYNA 9PAPA 2Y6EA 2DC7A 2P7UA 1FH0A 2XU5A 4MZOA 4BS5A 2OZ2A 1K3BB 1PBHA 3USVA 1F2BA 1NQCA 3BPFA 6PADA 1YK7A 4BSQA 3U8EA 4YYVA 4NV8A 1AU0A 2DCCA 2WBFX 3ERVA 5PADA 2PNSA 2NQAA 1MHWA 1F2CA 3BWKA 2HXZA 1W5RA 1AIMA 2G8EA 1CQDA 1F2AA 1PXVA 1YK8A 1KHQA 3WXGA 1TL9A 3OISA 1GX3A 2G7YA 2P0RA 2R9CA 1DF0A 1E2TA 1U9VA 2NQIA 4BPVA 4X6IA 1QDQA 3P5UA 4BGFA 3PW3A 1SP4B 4FIPA 1YVBA 1U9XA 1ITOA 1CPJA 2E02A 3PNRA 3N3KA 3F5VA 1BP4A 4N79A 1STFE 4MSXA 2CB5A 2F7DA 1CB5A 4PP2E 3S3QA 3N3GA 1EWLA 3AI8A 3MHSA 2OULA 3PBHA 8PCHA 2HD5A 1ATKA 1EWOA 1U9WA 4X6JA 3KX1A 3TNXA 4B55A 1Q6KA 1QXPA 1Y4HA 1CSBB 4MZSA 3PDFA 4XUIA 3MHHA 1PPDA 2AIMA 5CVMA 3HHIA 2ATOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WXE A;  1BY8 A;  2F1G A;  4DMY A;  1NB5 A;  3NHE A;  1MEM A;  4DMX A;  1CTE A;  1BGO A;  4CDC B;  1GEC E;  3IMA A;  4RY2 A;  2DJF B;  2FYE A;  1KFU L;  1PE6 A;  3K8U A;  1MS6 A;  3KSE A;  1Y08 A;  3KKU A;  2HHN A;  1TU6 A;  2YJ2 A;  1SNK A;  4QH6 A;  1HUC B;  5JA7 A;  3BPM A;  2O6X A;  4P6E A;  2C0Y A;  1GMY A;  4W5B A;  3CH3 X;  3RVX A;  1CV8 A;  2FQ9 A;  2E03 A;  3OVZ A;  3H8B A;  2FO5 A;  1ME4 A;  5J94 A;  1X9Y A;  4CDF B;  4OEL A;  4YYS A;  1ZCM A;  3DF0 A;  1KXR A;  4PP1 A;  2DCD A;  3QSD A;  2R9O A;  4I07 A;  4Q8G A;  1AYU A;  1NB3 A;  2FT2 A;  1ME3 A;  3P5X A;  1EF7 A;  2PRE A;  3CH2 X;  3OF8 A;  3F75 A;  4YYW A;  3QT4 A;  2FRQ A;  2GFO A;  2PBH A;  5K16 A;  2B1N A;  3KFQ A;  4AXL A;  2FUD A;  1EWP A;  3QJ3 A;  2DC9 A;  2XU3 A;  3H89 A;  3S3R A;  3LFY A;  2H7J A;  5CVO B;  2NQD B;  2AVW A;  3N4C A;  2G6D A;  1NLJ A;  1PIP A;  3IHP A;  4X6H A;  2YJB A;  3P5V A;  4YVA A;  4KLB A;  3I06 A;  5JH3 A;  1CJL A;  4CDD B;  3IEJ A;  2R6N A;  1PAD A;  1M6D A;  4I05 A;  3K24 A;  1AEC A;  1QMY A;  4K7C A;  1DEU A;  1KFX L;  2AUZ A;  3HD3 A;  4N4Z A;  3H8C A;  3RVV A;  1NL6 A;  1A6R A;  3IV2 A;  2E00 A;  4WA6 A;  3D6S A;  1PPN A;  2DZY A;  1MIR A;  2G8J A;  1AU2 A;  5F02 A;  1AU4 A;  1IWD A;  2DCA A;  3E1Z B;  5A24 A;  1O0E A;  2HH5 A;  4BQV A;  3HHA A;  4QRV A;  2AYO A;  3CBJ A;  1VJV A;  3O1G A;  3C9E A;  1GCB A;  1YT7 A;  2DZZ A;  2R9N A;  1ICF A;  3WXF A;  2AS8 A;  1CS8 A;  3O0U A;  3OF9 A;  3ZUA A;  2DCB A;  4P6G A;  2XU4 A;  1BQI A;  1VSN A;  5FPW A;  2PAD A;  2IBI A;  2R9M A;  1THE A;  3IOQ A;  3K9M A;  4QBB A;  2VHS A;  1S4V A;  3KWZ A;  5CHV A;  2FTD A;  4YV8 A;  1F29 A;  3HWN A;  1AYV A;  3BCN A;  3V6C A;  3H6S A;  2DJG B;  3BOW A;  1AYW A;  2OP3 A;  2YJC A;  4W5C A;  3M99 A;  3KW9 A;  4YYR A;  1CVZ A;  3OVX A;  2BDZ A;  2ARY A;  1TLO A;  2VHF A;  3MOR A;  4W4U A;  2JQG R;  1QOL A;  2AUX A;  1YAL A;  4QRG A;  1PCI A;  3I3T A;  4G54 A;  1XKG A;  2YJ9 A;  4FJC A;  2GHU A;  1PPO A;  4YYQ A;  1KHP A;  1PPP A;  3RVW A;  4PI3 A;  2Y5B A;  1EWM A;  4QRX A;  5CHT A;  1U5I A;  1MDW A;  5EF4 A;  4ZUX U;  1MEG A;  2JQF R;  1U9Q X;  3MTN A;  4HWY A;  2B1M A;  3H7D A;  4AXM A;  2BDL A;  2R9F A;  1POP A;  2FRA A;  4YYU A;  2DC8 A;  3BC3 A;  3IUT A;  4BS6 A;  2CIO A;  7PCK A;  3KWB X;  4PAD A;  4CDE B;  3B79 A;  4N8W A;  1ZIV A;  1NPZ A;  2ACT A;  3GCB A;  2IPP B;  2NQG A;  4CZW A;  2E01 A;  4XR7 A;  2XU1 A;  2DC6 A;  4OEM A;  3V6E A;  4Q8H A;  5CVN B;  1JQP A;  2AU1 A;  4I04 A;  4FK5 A;  5EGW A;  1GLO A;  3P5W A;  2YJ8 A;  3LXS A;  2P86 A;  3CBK A;  1AU3 A;  2AYN A;  9PAP A;  2Y6E A;  2DC7 A;  2P7U A;  1FH0 A;  2XU5 A;  4MZO A;  4BS5 A;  2OZ2 A;  1K3B B;  1PBH A;  3USV A;  1F2B A;  1NQC A;  3BPF A;  6PAD A;  1YK7 A;  4BSQ A;  3U8E A;  4YYV A;  1AU0 A;  2DCC A;  2WBF X;  3ERV A;  5PAD A;  2PNS A;  2NQA A;  1MHW A;  1F2C A;  3BWK A;  2HXZ A;  1AIM A;  2G8E A;  1CQD A;  1F2A A;  1PXV A;  1YK8 A;  1KHQ A;  3WXG A;  1TL9 A;  3OIS A;  2G7Y A;  2P0R A;  2R9C A;  1DF0 A;  1U9V A;  2NQI A;  4BPV A;  4X6I A;  1QDQ A;  3P5U A;  3PW3 A;  1SP4 B;  4FIP A;  1YVB A;  1U9X A;  1ITO A;  1CPJ A;  2E02 A;  3PNR A;  3N3K A;  3F5V A;  1BP4 A;  4N79 A;  1STF E;  4MSX A;  2CB5 A;  2F7D A;  1CB5 A;  4PP2 E;  3S3Q A;  3N3G A;  1EWL A;  3AI8 A;  3MHS A;  2OUL A;  3PBH A;  8PCH A;  2HD5 A;  1ATK A;  1EWO A;  1U9W A;  4X6J A;  3KX1 A;  3TNX A;  1Q6K A;  1QXP A;  1Y4H A;  1CSB B;  4MZS A;  3PDF A;  4XUI A;  3MHH A;  1PPD A;  2AIM A;  5CVM A;  3HHI A;  2ATO A; 
#chains in the Genus database with same CATH topology
 4BOU A;  3WXE A;  1BY8 A;  2F1G A;  4DMY A;  3PRP A;  5KO3 A;  1NB5 A;  3NHE A;  2J7Q A;  1MEM A;  4DMX A;  1CTE A;  1BGO A;  4CDC B;  1GEC E;  3IMA A;  4BOZ A;  4RY2 A;  2DJF B;  2FYE A;  1KFU L;  1PE6 A;  3K8U A;  3PHW A;  1MS6 A;  3KSE A;  1Y08 A;  3KKU A;  2HHN A;  1TU6 A;  2YJ2 A;  1SNK A;  4QH6 A;  1HUC B;  5JA7 A;  3BPM A;  2O6X A;  4P6E A;  2C0Y A;  1GMY A;  4W5B A;  3CH3 X;  3RVX A;  1CV8 A;  2FQ9 A;  2E03 A;  3OVZ A;  4IP3 A;  3H8B A;  2FO5 A;  1ME4 A;  5J94 A;  1X9Y A;  4CDF B;  1UKF A;  4OEL A;  4YYS A;  1YZB A;  1ZCM A;  3DF0 A;  1KXR A;  4PP1 A;  2DCD A;  3QSD A;  4RF0 A;  2R9O A;  4I07 A;  4Q8G A;  1AYU A;  1NB3 A;  2FT2 A;  1ME3 A;  4MM3 B;  3P5X A;  1EF7 A;  2PRE A;  3CH2 X;  3OF8 A;  4R3D A;  3F75 A;  4YYW A;  3QT4 A;  4MI7 A;  2FRQ A;  2GFO A;  3MP2 A;  2PBH A;  5K16 A;  2B1N A;  4RF1 A;  3KFQ A;  4AXL A;  3W31 A;  2FUD A;  1EWP A;  3QJ3 A;  2DC9 A;  2XU3 A;  3H89 A;  3S3R A;  3LFY A;  2H7J A;  5CVO B;  2NQD B;  2AVW A;  3N4C A;  2G6D A;  1NLJ A;  1PIP A;  3IHP A;  4X6H A;  4M0W A;  2YJB A;  3C0R A;  3P5V A;  4YVA A;  4KLB A;  3I06 A;  5JH3 A;  5E6J A;  1CJL A;  4CDD B;  3IEJ A;  2R6N A;  1PAD A;  1M6D A;  4I05 A;  3K24 A;  1AEC A;  1QMY A;  4K7C A;  3B21 A;  1DEU A;  1KFX L;  2AUZ A;  3HD3 A;  4N4Z A;  3H8C A;  3RVV A;  1NL6 A;  1A6R A;  3MTV A;  3IV2 A;  2E00 A;  4WA6 A;  3D6S A;  1PPN A;  2DZY A;  4RNA A;  1MIR A;  2G8J A;  1AU2 A;  5F02 A;  4D8I A;  3TMP A;  1AU4 A;  1IWD A;  2DCA A;  3E1Z B;  5A24 A;  1O0E A;  2HH5 A;  4BQV A;  3E9S A;  3HHA A;  4P16 A;  4QRV A;  2AYO A;  3CBJ A;  1VJV A;  3O1G A;  3C9E A;  4OVZ A;  1GCB A;  1YT7 A;  2DZZ A;  2R9N A;  1ICF A;  3WXF A;  4HXD B;  2DOS A;  2AS8 A;  4XZX A;  4BOS A;  1CS8 A;  3O0U A;  3OF9 A;  3ZUA A;  2DCB A;  2JRI A;  4P6G A;  2XU4 A;  1BQI A;  1VSN A;  5FPW A;  2PAD A;  3OQC A;  2IBI A;  3BY4 A;  2R9M A;  1THE A;  3IOQ A;  3K9M A;  3RNV A;  4GUA A;  4QBB A;  3O65 A;  2VHS A;  1S4V A;  3KWZ A;  5CHV A;  2FTD A;  4YV8 A;  1F29 A;  2UZJ A;  3HWN A;  1AYV A;  3BCN A;  3V6C A;  3H6S A;  2DJG B;  3BOW A;  1AYW A;  2OP3 A;  2YJC A;  4W5C A;  3M99 A;  1PVJ A;  3KW9 A;  3TRK A;  4YYR A;  1CVZ A;  3OVX A;  2BDZ A;  2ARY A;  3BB7 A;  1TLO A;  2VHF A;  3MOR A;  4W4U A;  2JQG R;  1QOL A;  2AUX A;  1YAL A;  4QRG A;  3PHX A;  2Z84 A;  1PCI A;  3I3T A;  4G54 A;  1XKG A;  2YJ9 A;  3ZNH A;  2BTW B;  4FJC A;  2GHU A;  1PPO A;  4YYQ A;  4D8B A;  1KHP A;  2BTW A;  1PPP A;  3RVW A;  4PI3 A;  3W30 A;  2Y5B A;  4PT5 A;  1EWM A;  4QRX A;  5CHT A;  4A5U A;  1U5I A;  1MDW A;  5EF4 A;  4ZUX U;  1MEG A;  2JQF R;  1U9Q X;  3MTN A;  4HWY A;  1DKI A;  2B1M A;  3H7D A;  4AXM A;  2BDL A;  2R9F A;  1POP A;  2FRA A;  4YYU A;  4WUR A;  2DC8 A;  3BC3 A;  3IUT A;  2J7Q C;  5EZS A;  4BS6 A;  2CIO A;  7PCK A;  3KWB X;  3PRM A;  4PAD A;  4CDE B;  3B79 A;  4N8W A;  1ZIV A;  4BOQ A;  1NPZ A;  2ACT A;  3GCB A;  2IPP B;  2NQG A;  4CZW A;  2E01 A;  2XU1 A;  2DC6 A;  4OEM A;  4XR7 A;  3V6E A;  4BOP A;  4Q8H A;  5CVN B;  1JQP A;  2AU1 A;  4D8E A;  4I04 A;  4FK5 A;  5EGW A;  1GLO A;  3P5W A;  2YJ8 A;  3LXS A;  2P86 A;  3PSE A;  3CBK A;  1AU3 A;  2AYN A;  9PAP A;  2Y6E A;  2DC7 A;  2P7U A;  1FH0 A;  2XU5 A;  4MZO A;  4BS5 A;  2OZ2 A;  1K3B B;  1PBH A;  3IFU A;  3USV A;  1F2B A;  3PT2 A;  1NQC A;  3BBA A;  3BPF A;  6PAD A;  1YK7 A;  4BSQ A;  3U8E A;  4YYV A;  2HWK A;  1AU0 A;  4REZ A;  2DCC A;  2WBF X;  3ERV A;  5PAD A;  2PNS A;  2NQA A;  1MHW A;  1F2C A;  3BWK A;  2HXZ A;  1AIM A;  2G8E A;  1CQD A;  1F2A A;  1PXV A;  1YK8 A;  1KHQ A;  3WXG A;  1TL9 A;  4IUM A;  3OIS A;  2G7Y A;  2P0R A;  2R9C A;  1DF0 A;  1U9V A;  2NQI A;  4RKX A;  4BPV A;  4X6I A;  1QDQ A;  3P5U A;  3PW3 A;  1SP4 B;  4FIP A;  1YVB A;  1U9X A;  4ZTB A;  5EZQ A;  1ITO A;  1CPJ A;  3PHU A;  2E02 A;  3PNR A;  3N3K A;  3F5V A;  1BP4 A;  4N79 A;  1STF E;  4MSX A;  5JZE A;  2CB5 A;  2F7D A;  1CB5 A;  4OVZ B;  4PP2 E;  3S3Q A;  3N3G A;  1EWL A;  2BU3 A;  3AI8 A;  2FE8 A;  3MHS A;  2OUL A;  3PBH A;  8PCH A;  2JTC A;  2HD5 A;  1ATK A;  1EWO A;  1U9W A;  4X6J A;  3KX1 A;  3TNX A;  1Q6K A;  3MJ5 A;  1QXP A;  1Y4H A;  1CSB B;  4MZS A;  4OW0 A;  3PDF A;  4XUI A;  3MHH A;  1PPD A;  2AIM A;  5CVM A;  3HHI A;  2AGA A;  2ATO A; 
#chains in the Genus database with same CATH homology
 3WXE A;  1BY8 A;  2F1G A;  4DMY A;  1NB5 A;  3NHE A;  1MEM A;  1W6F A;  4DMX A;  1CTE A;  1BGO A;  4CDC B;  1GEC E;  3IMA A;  4RY2 A;  2DJF B;  2FYE A;  1KFU L;  1PE6 A;  3K8U A;  1MS6 A;  3KSE A;  1Y08 A;  3KKU A;  2HHN A;  1TU6 A;  2YJ2 A;  1SNK A;  4QH6 A;  1HUC B;  5JA7 A;  3BPM A;  2O6X A;  4P6E A;  2C0Y A;  1GMY A;  4W5B A;  3CH3 X;  3RVX A;  1CV8 A;  2FQ9 A;  2E03 A;  3OVZ A;  3H8B A;  2FO5 A;  1ME4 A;  5J94 A;  1X9Y A;  4CDF B;  4OEL A;  4YYS A;  1ZCM A;  3DF0 A;  1KXR A;  4PP1 A;  2DCD A;  3QSD A;  2R9O A;  4I07 A;  4Q8G A;  1AYU A;  1NB3 A;  2FT2 A;  1ME3 A;  3P5X A;  1EF7 A;  2PRE A;  3CH2 X;  3OF8 A;  3F75 A;  4YYW A;  3QT4 A;  2FRQ A;  2GFO A;  2PBH A;  5K16 A;  2B1N A;  3KFQ A;  4AXL A;  2VFB A;  2FUD A;  1EWP A;  3QJ3 A;  2DC9 A;  2VFC A;  2XU3 A;  3H89 A;  3S3R A;  3LFY A;  2H7J A;  5CVO B;  2NQD B;  2AVW A;  3N4C A;  2G6D A;  1NLJ A;  1PIP A;  3IHP A;  4X6H A;  2YJB A;  3P5V A;  4YVA A;  4KLB A;  3I06 A;  5JH3 A;  1CJL A;  4CDD B;  3IEJ A;  2R6N A;  1PAD A;  4GUZ A;  1M6D A;  4I05 A;  3K24 A;  1AEC A;  1QMY A;  4K7C A;  1DEU A;  1KFX L;  2AUZ A;  3HD3 A;  3LTW A;  4N4Z A;  3H8C A;  3RVV A;  1NL6 A;  1A6R A;  3IV2 A;  2E00 A;  4WA6 A;  3D6S A;  1PPN A;  4C5P A;  2DZY A;  1MIR A;  2G8J A;  1AU2 A;  5F02 A;  1AU4 A;  1IWD A;  2DCA A;  3E1Z B;  5A24 A;  1O0E A;  2HH5 A;  4BQV A;  3HHA A;  4QRV A;  2AYO A;  3CBJ A;  1VJV A;  3O1G A;  3C9E A;  1GCB A;  1YT7 A;  2DZZ A;  2R9N A;  1ICF A;  3WXF A;  2AS8 A;  1CS8 A;  3O0U A;  3OF9 A;  3ZUA A;  2DCB A;  4P6G A;  2XU4 A;  1BQI A;  1VSN A;  5FPW A;  2PAD A;  2IBI A;  2R9M A;  1THE A;  3IOQ A;  3K9M A;  4QBB A;  2VHS A;  1S4V A;  3KWZ A;  5CHV A;  2FTD A;  4YV8 A;  1F29 A;  3HWN A;  1AYV A;  3BCN A;  3V6C A;  3H6S A;  2DJG B;  3BOW A;  1AYW A;  2OP3 A;  2YJC A;  4W5C A;  3M99 A;  3KW9 A;  4YYR A;  1CVZ A;  3OVX A;  2BDZ A;  2ARY A;  1TLO A;  2VHF A;  3MOR A;  4W4U A;  2JQG R;  1QOL A;  2AUX A;  2BSZ A;  1YAL A;  4QRG A;  1PCI A;  3I3T A;  4G54 A;  1XKG A;  2YJ9 A;  4FJC A;  2GHU A;  1PPO A;  4YYQ A;  1KHP A;  1PPP A;  3RVW A;  4PI3 A;  2Y5B A;  1EWM A;  4QRX A;  5CHT A;  1W4T A;  1U5I A;  1MDW A;  5EF4 A;  4ZUX U;  1MEG A;  2JQF R;  1U9Q X;  3MTN A;  4HWY A;  2B1M A;  3H7D A;  4AXM A;  2BDL A;  2R9F A;  1POP A;  2FRA A;  4YYU A;  2DC8 A;  3BC3 A;  3IUT A;  4BS6 A;  2CIO A;  7PCK A;  3KWB X;  4PAD A;  4CDE B;  3B79 A;  4N8W A;  1ZIV A;  1NPZ A;  4NV7 A;  2ACT A;  3GCB A;  2IPP B;  2NQG A;  4CZW A;  2E01 A;  4XR7 A;  2XU1 A;  2DC6 A;  4OEM A;  3V6E A;  4Q8H A;  5CVN B;  1JQP A;  2AU1 A;  4I04 A;  3D9W A;  4FK5 A;  5EGW A;  1GLO A;  3P5W A;  2YJ8 A;  3LXS A;  2P86 A;  3CBK A;  1AU3 A;  2AYN A;  9PAP A;  2Y6E A;  2DC7 A;  2P7U A;  1FH0 A;  2XU5 A;  4MZO A;  4BS5 A;  2OZ2 A;  1K3B B;  1PBH A;  3USV A;  1F2B A;  1NQC A;  3BPF A;  6PAD A;  1YK7 A;  4BSQ A;  3U8E A;  4YYV A;  4NV8 A;  1AU0 A;  2DCC A;  2WBF X;  3ERV A;  5PAD A;  2PNS A;  2NQA A;  1MHW A;  1F2C A;  3BWK A;  2HXZ A;  1W5R A;  1AIM A;  2G8E A;  1CQD A;  1F2A A;  1PXV A;  1YK8 A;  1KHQ A;  3WXG A;  1TL9 A;  3OIS A;  1GX3 A;  2G7Y A;  2P0R A;  2R9C A;  1DF0 A;  1E2T A;  1U9V A;  2NQI A;  4BPV A;  4X6I A;  1QDQ A;  3P5U A;  4BGF A;  3PW3 A;  1SP4 B;  4FIP A;  1YVB A;  1U9X A;  1ITO A;  1CPJ A;  2E02 A;  3PNR A;  3N3K A;  3F5V A;  1BP4 A;  4N79 A;  1STF E;  4MSX A;  2CB5 A;  2F7D A;  1CB5 A;  4PP2 E;  3S3Q A;  3N3G A;  1EWL A;  3AI8 A;  3MHS A;  2OUL A;  3PBH A;  8PCH A;  2HD5 A;  1ATK A;  1EWO A;  1U9W A;  4X6J A;  3KX1 A;  3TNX A;  4B55 A;  1Q6K A;  1QXP A;  1Y4H A;  1CSB B;  4MZS A;  3PDF A;  4XUI A;  3MHH A;  1PPD A;  2AIM A;  5CVM A;  3HHI A;  2ATO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...