1STFE

The refined 2.4 angstroms x-ray crystal structure of recombinant human stefin b in complex with the cysteine proteinase papain: a novel type of proteinase inhibitor interaction
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
212
structure length
211
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(sulfhydryl proteinase)
molecule keywords PAPAIN
publication title The refined 2.4 A X-ray crystal structure of recombinant human stefin B in complex with the cysteine proteinase papain: a novel type of proteinase inhibitor interaction.
pubmed rcsb
source organism Carica papaya
total genus 63
structure length 211
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1993-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1stfE00
1NQCA 1VJVA 2VHSA 3KWZA 4I07A 2R9FA 1KFUL 8PCHA 3IEJA 4PP1A 5CHVA 1EF7A 1CQDA 1KFXL 2DC7A 1PCIA 4PP2E 4CDCB 2DCDA 2AU1A 2XU4A 1AU4A 1ATKA 1Y08A 2E01A 1KXRA 4N8WA 1EWLA 2R6NA 3P5UA 3RVXA 2PADA 3O0UA 3BPMA 2G6DA 2PNSA 4BQVA 4K7CA 2AS8A 2DCBA 3F5VA 4QBBA 1SNKA 1TLOA 1YVBA 5JA7A 1Q6KA 2DJFB 3KKUA 2B1MA 2FYEA 2PREA 2YJ8A 1DEUA 4HWYA 3ERVA 3OVXA 1NL6A 4DMXA 1PIPA 3CBJA 3K8UA 3HD3A 2OZ2A 1U9XA 1AU0A 2G8EA 4X6JA 1ITOA 4Q8GA 2R9MA 3H8BA 1F29A 4PI3A 1ME4A 2FO5A 1THEA 4MSXA 2H7JA 1U9QX 2FRAA 1BY8A 3K9MA 4BPVA 4XR7A 1QDQA 4YV8A 1MS6A 1ZIVA 2YJBA 4YYUA 1PADA 2F1GA 1QMYA 2DJGB 3OISA 5K16A 1AYVA 2AIMA 2O6XA 3B79A 2P86A 2G7YA 3ZUAA 4I04A 1PPNA 3S3RA 3H89A 1BQIA 4X6HA 5F02A 3IV2A 2FT2A 3HWNA 3OVZA 3N4CA 1CVZA 2C0YA 1M6DA 1CTEA 3LFYA 5CVNB 3MTNA 4CZWA 1GCBA 1KHPA 4YYWA 4BS6A 2P0RA 2IBIA 4AXMA 2DCAA 2NQDB 3RVVA 4DMYA 4XUIA 3DF0A 1O0EA 4OEMA 4CDFB 1X9YA 4N4ZA 2ACTA 3KFQA 2HHNA 2XU5A 3RVWA 4Q8HA 3KX1A 1FH0A 1GLOA 1HUCB 1A6RA 6PADA 2Y5BA 3HHAA 3BCNA 3IUTA 3KW9A 3CH2X 2DZZA 3I3TA 2NQAA 1AIMA 2JQGR 2E02A 3KSEA 1YT7A 2FRQA 3PBHA 3GCBA 4QRGA 1ICFA 4I05A 1U5IA 2R9CA 2HD5A 2B1NA 3IOQA 3QSDA 4W5BA 2FQ9A 1Y4HA 7PCKA 3MHHA 3D6SA 1AYWA 1CSBB 4QH6A 2BDLA 4P6GA 1F2BA 1EWMA 2GFOA 3IHPA 1CV8A 3CBKA 2NQGA 3TNXA 4YYQA 1PXVA 1AU3A 1EWOA 1PPOA 3U8EA 1IWDA 5JH3A 2AUZA 2DCCA 4QRXA 1NPZA 4MZSA 2OULA 4ZUXU 1AECA 5J94A 2IPPB 3QT4A 2R9NA 3QJ3A 2CB5A 3OF8A 4YYRA 1SP4B 4AXLA 1K3BB 3H6SA 4PADA 2OP3A 5CHTA 1CJLA 5EF4A 3HHIA 1MHWA 1F2CA 3BPFA 1KHQA 3N3GA 2NQIA 3F75A 3V6EA 5A24A 1BGOA 5FPWA 3S3QA 2DZYA 1YK8A 4YVAA 4FJCA 1NLJA 3N3KA 1TU6A 1U9WA 1JQPA 2HXZA 4YYSA 5PADA 1YALA 1DF0A 2ARYA 1BP4A 9PAPA 2R9OA 4BSQA 3CH3X 1MDWA 4YYVA 2YJCA 3BOWA 4CDEB 2JQFR 1PPPA 3P5VA 3H8CA 2DC8A 3PNRA 2G8JA 2E03A 1U9VA 2XU3A 3BWKA 3WXGA 2F7DA 1MEGA 1STFE 3I06A 3NHEA 1GECE 4N79A 4OELA 3USVA 2YJ9A 5CVOB 1PBHA 4BS5A 3WXFA 3E1ZB 2YJ2A 1CB5A 1NB3A 4KLBA 2AUXA 4MZOA 5EGWA 4W4UA 3C9EA 4X6IA 1ZCMA 1CPJA 3KWBX 2BDZA 2CIOA 2DC6A 3OF9A 4FIPA 3K24A 3AI8A 2ATOA 3IMAA 4W5CA 1EWPA 1S4VA 1ME3A 3P5XA 1PPDA 4QRVA 1QXPA 3PW3A 1XKGA 4WA6A 4G54A 4P6EA 2DC9A 1MIRA 1POPA 1YK7A 1GMYA 2GHUA 2E00A 2HH5A 4CDDB 3H7DA 3LXSA 2AYOA 1AYUA 2FTDA 2AVWA 1VSNA 3M99A 2PBHA 3BC3A 2Y6EA 4RY2A 1PE6A 3P5WA 2P7UA 2VHFA 1MEMA 1F2AA 2XU1A 3O1GA 3V6CA 3MHSA 1QOLA 1NB5A 1TL9A 3WXEA 2FUDA 2WBFX 3MORA 3PDFA 2AYNA 1AU2A 1CS8A 4FK5A 5CVMA
chains in the Genus database with same CATH superfamily
3PRMA 1NQCA 1VJVA 2VHSA 3KWZA 4I07A 2R9FA 4BOUA 1KFUL 8PCHA 3PHXA 2Z84A 3IEJA 4PP1A 5CHVA 1EF7A 1CQDA 1KFXL 2DC7A 1PCIA 4PP2E 4CDCB 2DCDA 2AU1A 2XU4A 1AU4A 1ATKA 1Y08A 3PSEA 2JRIA 2E01A 1KXRA 4N8WA 1EWLA 4D8EA 2R6NA 3P5UA 3RVXA 2PADA 3O0UA 3BPMA 2G6DA 2PNSA 4BQVA 3C0RA 4K7CA 2AS8A 2DCBA 4OVZB 4XZXA 3PRPA 3F5VA 4QBBA 1SNKA 1TLOA 1YVBA 4PT5A 5JA7A 1Q6KA 2DJFB 3KKUA 2B1MA 2FYEA 2PREA 2YJ8A 1DEUA 4A5UA 4HWYA 4HXDB 3ERVA 3OVXA 1NL6A 3MTVA 4DMXA 1PIPA 4BOQA 3CBJA 3K8UA 3HD3A 3TMPA 2OZ2A 1U9XA 1AU0A 2G8EA 4X6JA 1ITOA 4BOPA 4Q8GA 2R9MA 3H8BA 1F29A 4PI3A 4RNAA 1ME4A 2FO5A 1THEA 4MSXA 4RF1A 2H7JA 1U9QX 5EZSA 2FRAA 1BY8A 3K9MA 4BPVA 4OVZA 4XR7A 1QDQA 1UKFA 4YV8A 1MS6A 1ZIVA 5E6JA 2YJBA 4YYUA 1PADA 2F1GA 1QMYA 2DJGB 3OISA 5K16A 4D8BA 1AYVA 2AIMA 2O6XA 3B79A 2P86A 2G7YA 3TRKA 3ZUAA 4I04A 1PPNA 3S3RA 4GUAA 3H89A 1BQIA 4X6HA 5F02A 3IV2A 2FT2A 3HWNA 3OVZA 3N4CA 1CVZA 2C0YA 1M6DA 1CTEA 3LFYA 3PHWA 5CVNB 3MTNA 3W30A 4CZWA 1GCBA 1KHPA 4OW0A 4YYWA 4BS6A 2P0RA 2IBIA 4AXMA 2DCAA 2NQDB 3RVVA 4DMYA 4XUIA 3DF0A 1O0EA 4OEMA 4CDFB 1X9YA 4N4ZA 2ACTA 3KFQA 2HHNA 2XU5A 3RVWA 4Q8HA 4R3DA 3IFUA 3KX1A 2UZJA 1FH0A 1GLOA 2DOSA 1HUCB 3BB7A 1A6RA 3MP2A 6PADA 2Y5BA 4D8IA 3HHAA 4ZTBA 3BCNA 3IUTA 3KW9A 3CH2X 3MJ5A 4MI7A 2DZZA 3I3TA 2NQAA 3B21A 2BTWA 1AIMA 2JQGR 2E02A 3KSEA 1YT7A 2FRQA 3PBHA 4BOSA 3GCBA 4QRGA 1ICFA 4I05A 1U5IA 1DKIA 2R9CA 2HD5A 2B1NA 3IOQA 3QSDA 4MM3B 4W5BA 2FQ9A 1Y4HA 7PCKA 3MHHA 3D6SA 1AYWA 1CSBB 4QH6A 2BDLA 4P6GA 1F2BA 1EWMA 2GFOA 3IHPA 1CV8A 3CBKA 2NQGA 3TNXA 3OQCA 1PXVA 1AU3A 4YYQA 1EWOA 1PPOA 3ZNHA 3U8EA 1IWDA 5JH3A 2AUZA 2DCCA 4QRXA 4P16A 1NPZA 4MZSA 2OULA 4ZUXU 1AECA 5J94A 2IPPB 3QT4A 4RKXA 2R9NA 3QJ3A 2CB5A 3OF8A 4YYRA 3O65A 1SP4B 4AXLA 1K3BB 3H6SA 4PADA 2OP3A 2JTCA 5CHTA 1CJLA 5EF4A 3BY4A 3HHIA 3PT2A 1MHWA 1F2CA 3BPFA 1KHQA 3N3GA 2NQIA 3F75A 3V6EA 5A24A 1BGOA 5FPWA 3S3QA 2BTWB 2DZYA 1YK8A 4YVAA 4FJCA 1NLJA 3N3KA 1TU6A 2HWKA 1U9WA 1JQPA 2HXZA 4YYSA 5PADA 1YALA 1DF0A 4IUMA 2ARYA 1BP4A 9PAPA 2R9OA 3PHUA 4BSQA 3CH3X 1PVJA 1MDWA 4YYVA 2YJCA 3BOWA 4CDEB 2JQFR 1PPPA 3P5VA 3H8CA 2DC8A 3PNRA 2G8JA 2J7QA 3BBAA 2E03A 1U9VA 3W31A 2XU3A 3BWKA 3WXGA 2F7DA 2AGAA 1MEGA 1STFE 3I06A 3NHEA 1GECE 3E9SA 4N79A 4OELA 1YZBA 3USVA 2YJ9A 5CVOB 1PBHA 4BS5A 3WXFA 3E1ZB 2YJ2A 1CB5A 1NB3A 4WURA 4KLBA 2AUXA 4IP3A 2FE8A 4MZOA 5EGWA 4W4UA 3C9EA 4X6IA 1ZCMA 1CPJA 3KWBX 2BDZA 2CIOA 2DC6A 3OF9A 4RF0A 4FIPA 3K24A 3AI8A 4REZA 2ATOA 3IMAA 4W5CA 1EWPA 1S4VA 1ME3A 5EZQA 3P5XA 2BU3A 1PPDA 4QRVA 1QXPA 3PW3A 1XKGA 4WA6A 4G54A 4P6EA 2DC9A 1MIRA 3RNVA 1POPA 1YK7A 5KO3A 1GMYA 2GHUA 2E00A 2HH5A 4CDDB 3H7DA 3LXSA 2AYOA 1AYUA 2FTDA 2AVWA 1VSNA 3M99A 2PBHA 3BC3A 2Y6EA 4RY2A 1PE6A 3P5WA 2P7UA 2VHFA 1MEMA 1F2AA 2XU1A 3O1GA 4BOZA 3V6CA 3MHSA 1QOLA 1NB5A 1TL9A 3WXEA 2FUDA 2WBFX 3MORA 3PDFA 2AYNA 5JZEA 2J7QC 1AU2A 1CS8A 4FK5A 4M0WA 5CVMA
chains in the Genus database with same CATH topology
1NQCA 1VJVA 2VHSA 3KWZA 4I07A 2R9FA 1KFUL 8PCHA 3IEJA 4PP1A 5CHVA 1EF7A 1CQDA 1KFXL 2DC7A 1PCIA 4PP2E 4CDCB 2DCDA 2AU1A 2XU4A 4C5PA 1AU4A 1ATKA 1Y08A 2E01A 1KXRA 4N8WA 1EWLA 2R6NA 3P5UA 3RVXA 2PADA 3O0UA 3BPMA 2G6DA 2PNSA 4BQVA 4K7CA 2AS8A 2DCBA 3F5VA 4QBBA 1SNKA 1TLOA 1YVBA 5JA7A 1Q6KA 2DJFB 3KKUA 2B1MA 2FYEA 2PREA 2YJ8A 1DEUA 4HWYA 3ERVA 3OVXA 1NL6A 4DMXA 1PIPA 3CBJA 3K8UA 3HD3A 2OZ2A 1U9XA 1AU0A 2G8EA 4X6JA 1ITOA 4Q8GA 2R9MA 3H8BA 1F29A 4PI3A 1ME4A 2FO5A 1THEA 4MSXA 2H7JA 1U9QX 2FRAA 1BY8A 3K9MA 4BPVA 1W5RA 4XR7A 1QDQA 4YV8A 1MS6A 1ZIVA 2YJBA 2VFCA 4YYUA 1E2TA 1PADA 2F1GA 1QMYA 2DJGB 3OISA 5K16A 1AYVA 2AIMA 2O6XA 3B79A 2P86A 2G7YA 3ZUAA 4I04A 1PPNA 3S3RA 3H89A 1BQIA 4X6HA 5F02A 3IV2A 2FT2A 3HWNA 3OVZA 3N4CA 1CVZA 2C0YA 1M6DA 1CTEA 3LFYA 5CVNB 3MTNA 4NV7A 4CZWA 1GCBA 1KHPA 4YYWA 4BS6A 2P0RA 2IBIA 4AXMA 2DCAA 2NQDB 3RVVA 4DMYA 4XUIA 3DF0A 1O0EA 4OEMA 4CDFB 1X9YA 4N4ZA 2ACTA 3KFQA 2HHNA 2XU5A 3RVWA 4Q8HA 3KX1A 1FH0A 1GLOA 1W4TA 1HUCB 1A6RA 6PADA 2Y5BA 3HHAA 3BCNA 3IUTA 3KW9A 3CH2X 2DZZA 3I3TA 2NQAA 4B55A 1AIMA 2JQGR 2E02A 3KSEA 1YT7A 2FRQA 3PBHA 3GCBA 4QRGA 1ICFA 4I05A 1U5IA 2R9CA 2HD5A 2B1NA 3D9WA 3IOQA 3QSDA 4W5BA 2FQ9A 1Y4HA 7PCKA 3MHHA 3D6SA 1AYWA 1CSBB 3LTWA 4QH6A 2BDLA 4P6GA 1F2BA 1EWMA 2GFOA 3IHPA 1CV8A 3CBKA 2NQGA 3TNXA 4YYQA 1PXVA 1AU3A 2BSZA 1EWOA 1PPOA 3U8EA 1IWDA 5JH3A 2AUZA 2DCCA 4QRXA 1NPZA 4MZSA 2OULA 4ZUXU 1AECA 5J94A 2IPPB 3QT4A 2R9NA 3QJ3A 2CB5A 3OF8A 4YYRA 1SP4B 4AXLA 1K3BB 3H6SA 4PADA 2OP3A 5CHTA 1CJLA 5EF4A 3HHIA 1MHWA 1F2CA 3BPFA 1KHQA 3N3GA 2NQIA 3F75A 3V6EA 5A24A 1BGOA 5FPWA 3S3QA 2DZYA 1YK8A 4YVAA 4FJCA 1NLJA 3N3KA 1TU6A 1U9WA 1JQPA 2HXZA 4YYSA 5PADA 1YALA 1DF0A 2ARYA 1BP4A 9PAPA 2R9OA 4BSQA 3CH3X 4GUZA 1MDWA 4YYVA 2YJCA 3BOWA 4CDEB 1W6FA 2JQFR 1PPPA 3P5VA 3H8CA 2DC8A 3PNRA 2G8JA 2E03A 1U9VA 2XU3A 3BWKA 3WXGA 2F7DA 1MEGA 1STFE 3I06A 4NV8A 3NHEA 1GECE 4N79A 4OELA 3USVA 2YJ9A 5CVOB 1PBHA 4BS5A 3WXFA 3E1ZB 2YJ2A 1CB5A 1NB3A 4KLBA 2AUXA 4MZOA 5EGWA 4W4UA 3C9EA 4X6IA 1ZCMA 1CPJA 3KWBX 2BDZA 2CIOA 2DC6A 3OF9A 4FIPA 3K24A 3AI8A 2ATOA 3IMAA 4W5CA 1EWPA 1S4VA 1ME3A 3P5XA 1PPDA 1GX3A 4QRVA 1QXPA 3PW3A 1XKGA 4WA6A 4G54A 4P6EA 2DC9A 1MIRA 1POPA 1YK7A 1GMYA 2GHUA 2E00A 2HH5A 4CDDB 3H7DA 3LXSA 2AYOA 1AYUA 2FTDA 2AVWA 1VSNA 3M99A 2PBHA 3BC3A 2Y6EA 4RY2A 1PE6A 3P5WA 2P7UA 2VHFA 1MEMA 1F2AA 2XU1A 3O1GA 4BGFA 3V6CA 3MHSA 1QOLA 1NB5A 1TL9A 3WXEA 2FUDA 2WBFX 3MORA 3PDFA 2AYNA 1AU2A 1CS8A 4FK5A 2VFBA 5CVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NQC A;  1VJV A;  2VHS A;  3KWZ A;  4I07 A;  2R9F A;  1KFU L;  8PCH A;  3IEJ A;  4PP1 A;  5CHV A;  1EF7 A;  1CQD A;  1KFX L;  2DC7 A;  1PCI A;  4PP2 E;  4CDC B;  2DCD A;  2AU1 A;  2XU4 A;  1AU4 A;  1ATK A;  1Y08 A;  2E01 A;  1KXR A;  4N8W A;  1EWL A;  2R6N A;  3P5U A;  3RVX A;  2PAD A;  3O0U A;  3BPM A;  2G6D A;  2PNS A;  4BQV A;  4K7C A;  2AS8 A;  2DCB A;  3F5V A;  4QBB A;  1SNK A;  1TLO A;  1YVB A;  5JA7 A;  1Q6K A;  2DJF B;  3KKU A;  2B1M A;  2FYE A;  2PRE A;  2YJ8 A;  1DEU A;  4HWY A;  3ERV A;  3OVX A;  1NL6 A;  4DMX A;  1PIP A;  3CBJ A;  3K8U A;  3HD3 A;  2OZ2 A;  1U9X A;  1AU0 A;  2G8E A;  4X6J A;  1ITO A;  4Q8G A;  2R9M A;  3H8B A;  1F29 A;  4PI3 A;  1ME4 A;  2FO5 A;  1THE A;  4MSX A;  2H7J A;  1U9Q X;  2FRA A;  1BY8 A;  3K9M A;  4BPV A;  4XR7 A;  1QDQ A;  4YV8 A;  1MS6 A;  1ZIV A;  2YJB A;  4YYU A;  1PAD A;  2F1G A;  1QMY A;  2DJG B;  3OIS A;  5K16 A;  1AYV A;  2AIM A;  2O6X A;  3B79 A;  2P86 A;  2G7Y A;  3ZUA A;  4I04 A;  1PPN A;  3S3R A;  3H89 A;  1BQI A;  4X6H A;  5F02 A;  3IV2 A;  2FT2 A;  3HWN A;  3OVZ A;  3N4C A;  1CVZ A;  2C0Y A;  1M6D A;  1CTE A;  3LFY A;  5CVN B;  3MTN A;  4CZW A;  1GCB A;  1KHP A;  4YYW A;  4BS6 A;  2P0R A;  2IBI A;  4AXM A;  2DCA A;  2NQD B;  3RVV A;  4DMY A;  4XUI A;  3DF0 A;  1O0E A;  4OEM A;  4CDF B;  1X9Y A;  4N4Z A;  2ACT A;  3KFQ A;  2HHN A;  2XU5 A;  3RVW A;  4Q8H A;  3KX1 A;  1FH0 A;  1GLO A;  1HUC B;  1A6R A;  6PAD A;  2Y5B A;  3HHA A;  3BCN A;  3IUT A;  3KW9 A;  3CH2 X;  2DZZ A;  3I3T A;  2NQA A;  1AIM A;  2JQG R;  2E02 A;  3KSE A;  1YT7 A;  2FRQ A;  3PBH A;  3GCB A;  4QRG A;  1ICF A;  4I05 A;  1U5I A;  2R9C A;  2HD5 A;  2B1N A;  3IOQ A;  3QSD A;  4W5B A;  2FQ9 A;  1Y4H A;  7PCK A;  3MHH A;  3D6S A;  1AYW A;  1CSB B;  4QH6 A;  2BDL A;  4P6G A;  1F2B A;  1EWM A;  2GFO A;  3IHP A;  1CV8 A;  3CBK A;  2NQG A;  3TNX A;  4YYQ A;  1PXV A;  1AU3 A;  1EWO A;  1PPO A;  3U8E A;  1IWD A;  5JH3 A;  2AUZ A;  2DCC A;  4QRX A;  1NPZ A;  4MZS A;  2OUL A;  4ZUX U;  1AEC A;  5J94 A;  2IPP B;  3QT4 A;  2R9N A;  3QJ3 A;  2CB5 A;  3OF8 A;  4YYR A;  1SP4 B;  4AXL A;  1K3B B;  3H6S A;  4PAD A;  2OP3 A;  5CHT A;  1CJL A;  5EF4 A;  3HHI A;  1MHW A;  1F2C A;  3BPF A;  1KHQ A;  3N3G A;  2NQI A;  3F75 A;  3V6E A;  5A24 A;  1BGO A;  5FPW A;  3S3Q A;  2DZY A;  1YK8 A;  4YVA A;  4FJC A;  1NLJ A;  3N3K A;  1TU6 A;  1U9W A;  1JQP A;  2HXZ A;  4YYS A;  5PAD A;  1YAL A;  1DF0 A;  2ARY A;  1BP4 A;  9PAP A;  2R9O A;  4BSQ A;  3CH3 X;  1MDW A;  4YYV A;  2YJC A;  3BOW A;  4CDE B;  2JQF R;  1PPP A;  3P5V A;  3H8C A;  2DC8 A;  3PNR A;  2G8J A;  2E03 A;  1U9V A;  2XU3 A;  3BWK A;  3WXG A;  2F7D A;  1MEG A;  1STF E;  3I06 A;  3NHE A;  1GEC E;  4N79 A;  4OEL A;  3USV A;  2YJ9 A;  5CVO B;  1PBH A;  4BS5 A;  3WXF A;  3E1Z B;  2YJ2 A;  1CB5 A;  1NB3 A;  4KLB A;  2AUX A;  4MZO A;  5EGW A;  4W4U A;  3C9E A;  4X6I A;  1ZCM A;  1CPJ A;  3KWB X;  2BDZ A;  2CIO A;  2DC6 A;  3OF9 A;  4FIP A;  3K24 A;  3AI8 A;  2ATO A;  3IMA A;  4W5C A;  1EWP A;  1S4V A;  1ME3 A;  3P5X A;  1PPD A;  4QRV A;  1QXP A;  3PW3 A;  1XKG A;  4WA6 A;  4G54 A;  4P6E A;  2DC9 A;  1MIR A;  1POP A;  1YK7 A;  1GMY A;  2GHU A;  2E00 A;  2HH5 A;  4CDD B;  3H7D A;  3LXS A;  2AYO A;  1AYU A;  2FTD A;  2AVW A;  1VSN A;  3M99 A;  2PBH A;  3BC3 A;  2Y6E A;  4RY2 A;  1PE6 A;  3P5W A;  2P7U A;  2VHF A;  1MEM A;  1F2A A;  2XU1 A;  3O1G A;  3V6C A;  3MHS A;  1QOL A;  1NB5 A;  1TL9 A;  3WXE A;  2FUD A;  2WBF X;  3MOR A;  3PDF A;  2AYN A;  1AU2 A;  1CS8 A;  4FK5 A;  5CVM A; 
#chains in the Genus database with same CATH topology
 3PRM A;  1NQC A;  1VJV A;  2VHS A;  3KWZ A;  4I07 A;  2R9F A;  4BOU A;  1KFU L;  8PCH A;  3PHX A;  2Z84 A;  3IEJ A;  4PP1 A;  5CHV A;  1EF7 A;  1CQD A;  1KFX L;  2DC7 A;  1PCI A;  4PP2 E;  4CDC B;  2DCD A;  2AU1 A;  2XU4 A;  1AU4 A;  1ATK A;  1Y08 A;  3PSE A;  2JRI A;  2E01 A;  1KXR A;  4N8W A;  1EWL A;  4D8E A;  2R6N A;  3P5U A;  3RVX A;  2PAD A;  3O0U A;  3BPM A;  2G6D A;  2PNS A;  4BQV A;  3C0R A;  4K7C A;  2AS8 A;  2DCB A;  4OVZ B;  4XZX A;  3PRP A;  3F5V A;  4QBB A;  1SNK A;  1TLO A;  1YVB A;  4PT5 A;  5JA7 A;  1Q6K A;  2DJF B;  3KKU A;  2B1M A;  2FYE A;  2PRE A;  2YJ8 A;  1DEU A;  4A5U A;  4HWY A;  4HXD B;  3ERV A;  3OVX A;  1NL6 A;  3MTV A;  4DMX A;  1PIP A;  4BOQ A;  3CBJ A;  3K8U A;  3HD3 A;  3TMP A;  2OZ2 A;  1U9X A;  1AU0 A;  2G8E A;  4X6J A;  1ITO A;  4BOP A;  4Q8G A;  2R9M A;  3H8B A;  1F29 A;  4PI3 A;  4RNA A;  1ME4 A;  2FO5 A;  1THE A;  4MSX A;  4RF1 A;  2H7J A;  1U9Q X;  5EZS A;  2FRA A;  1BY8 A;  3K9M A;  4BPV A;  4OVZ A;  4XR7 A;  1QDQ A;  1UKF A;  4YV8 A;  1MS6 A;  1ZIV A;  5E6J A;  2YJB A;  4YYU A;  1PAD A;  2F1G A;  1QMY A;  2DJG B;  3OIS A;  5K16 A;  4D8B A;  1AYV A;  2AIM A;  2O6X A;  3B79 A;  2P86 A;  2G7Y A;  3TRK A;  3ZUA A;  4I04 A;  1PPN A;  3S3R A;  4GUA A;  3H89 A;  1BQI A;  4X6H A;  5F02 A;  3IV2 A;  2FT2 A;  3HWN A;  3OVZ A;  3N4C A;  1CVZ A;  2C0Y A;  1M6D A;  1CTE A;  3LFY A;  3PHW A;  5CVN B;  3MTN A;  3W30 A;  4CZW A;  1GCB A;  1KHP A;  4OW0 A;  4YYW A;  4BS6 A;  2P0R A;  2IBI A;  4AXM A;  2DCA A;  2NQD B;  3RVV A;  4DMY A;  4XUI A;  3DF0 A;  1O0E A;  4OEM A;  4CDF B;  1X9Y A;  4N4Z A;  2ACT A;  3KFQ A;  2HHN A;  2XU5 A;  3RVW A;  4Q8H A;  4R3D A;  3IFU A;  3KX1 A;  2UZJ A;  1FH0 A;  1GLO A;  2DOS A;  1HUC B;  3BB7 A;  1A6R A;  3MP2 A;  6PAD A;  2Y5B A;  4D8I A;  3HHA A;  4ZTB A;  3BCN A;  3IUT A;  3KW9 A;  3CH2 X;  3MJ5 A;  4MI7 A;  2DZZ A;  3I3T A;  2NQA A;  3B21 A;  2BTW A;  1AIM A;  2JQG R;  2E02 A;  3KSE A;  1YT7 A;  2FRQ A;  3PBH A;  4BOS A;  3GCB A;  4QRG A;  1ICF A;  4I05 A;  1U5I A;  1DKI A;  2R9C A;  2HD5 A;  2B1N A;  3IOQ A;  3QSD A;  4MM3 B;  4W5B A;  2FQ9 A;  1Y4H A;  7PCK A;  3MHH A;  3D6S A;  1AYW A;  1CSB B;  4QH6 A;  2BDL A;  4P6G A;  1F2B A;  1EWM A;  2GFO A;  3IHP A;  1CV8 A;  3CBK A;  2NQG A;  3TNX A;  3OQC A;  1PXV A;  1AU3 A;  4YYQ A;  1EWO A;  1PPO A;  3ZNH A;  3U8E A;  1IWD A;  5JH3 A;  2AUZ A;  2DCC A;  4QRX A;  4P16 A;  1NPZ A;  4MZS A;  2OUL A;  4ZUX U;  1AEC A;  5J94 A;  2IPP B;  3QT4 A;  4RKX A;  2R9N A;  3QJ3 A;  2CB5 A;  3OF8 A;  4YYR A;  3O65 A;  1SP4 B;  4AXL A;  1K3B B;  3H6S A;  4PAD A;  2OP3 A;  2JTC A;  5CHT A;  1CJL A;  5EF4 A;  3BY4 A;  3HHI A;  3PT2 A;  1MHW A;  1F2C A;  3BPF A;  1KHQ A;  3N3G A;  2NQI A;  3F75 A;  3V6E A;  5A24 A;  1BGO A;  5FPW A;  3S3Q A;  2BTW B;  2DZY A;  1YK8 A;  4YVA A;  4FJC A;  1NLJ A;  3N3K A;  1TU6 A;  2HWK A;  1U9W A;  1JQP A;  2HXZ A;  4YYS A;  5PAD A;  1YAL A;  1DF0 A;  4IUM A;  2ARY A;  1BP4 A;  9PAP A;  2R9O A;  3PHU A;  4BSQ A;  3CH3 X;  1PVJ A;  1MDW A;  4YYV A;  2YJC A;  3BOW A;  4CDE B;  2JQF R;  1PPP A;  3P5V A;  3H8C A;  2DC8 A;  3PNR A;  2G8J A;  2J7Q A;  3BBA A;  2E03 A;  1U9V A;  3W31 A;  2XU3 A;  3BWK A;  3WXG A;  2F7D A;  2AGA A;  1MEG A;  1STF E;  3I06 A;  3NHE A;  1GEC E;  3E9S A;  4N79 A;  4OEL A;  1YZB A;  3USV A;  2YJ9 A;  5CVO B;  1PBH A;  4BS5 A;  3WXF A;  3E1Z B;  2YJ2 A;  1CB5 A;  1NB3 A;  4WUR A;  4KLB A;  2AUX A;  4IP3 A;  2FE8 A;  4MZO A;  5EGW A;  4W4U A;  3C9E A;  4X6I A;  1ZCM A;  1CPJ A;  3KWB X;  2BDZ A;  2CIO A;  2DC6 A;  3OF9 A;  4RF0 A;  4FIP A;  3K24 A;  3AI8 A;  4REZ A;  2ATO A;  3IMA A;  4W5C A;  1EWP A;  1S4V A;  1ME3 A;  5EZQ A;  3P5X A;  2BU3 A;  1PPD A;  4QRV A;  1QXP A;  3PW3 A;  1XKG A;  4WA6 A;  4G54 A;  4P6E A;  2DC9 A;  1MIR A;  3RNV A;  1POP A;  1YK7 A;  5KO3 A;  1GMY A;  2GHU A;  2E00 A;  2HH5 A;  4CDD B;  3H7D A;  3LXS A;  2AYO A;  1AYU A;  2FTD A;  2AVW A;  1VSN A;  3M99 A;  2PBH A;  3BC3 A;  2Y6E A;  4RY2 A;  1PE6 A;  3P5W A;  2P7U A;  2VHF A;  1MEM A;  1F2A A;  2XU1 A;  3O1G A;  4BOZ A;  3V6C A;  3MHS A;  1QOL A;  1NB5 A;  1TL9 A;  3WXE A;  2FUD A;  2WBF X;  3MOR A;  3PDF A;  2AYN A;  5JZE A;  2J7Q C;  1AU2 A;  1CS8 A;  4FK5 A;  4M0W A;  5CVM A; 
#chains in the Genus database with same CATH homology
 1NQC A;  1VJV A;  2VHS A;  3KWZ A;  4I07 A;  2R9F A;  1KFU L;  8PCH A;  3IEJ A;  4PP1 A;  5CHV A;  1EF7 A;  1CQD A;  1KFX L;  2DC7 A;  1PCI A;  4PP2 E;  4CDC B;  2DCD A;  2AU1 A;  2XU4 A;  4C5P A;  1AU4 A;  1ATK A;  1Y08 A;  2E01 A;  1KXR A;  4N8W A;  1EWL A;  2R6N A;  3P5U A;  3RVX A;  2PAD A;  3O0U A;  3BPM A;  2G6D A;  2PNS A;  4BQV A;  4K7C A;  2AS8 A;  2DCB A;  3F5V A;  4QBB A;  1SNK A;  1TLO A;  1YVB A;  5JA7 A;  1Q6K A;  2DJF B;  3KKU A;  2B1M A;  2FYE A;  2PRE A;  2YJ8 A;  1DEU A;  4HWY A;  3ERV A;  3OVX A;  1NL6 A;  4DMX A;  1PIP A;  3CBJ A;  3K8U A;  3HD3 A;  2OZ2 A;  1U9X A;  1AU0 A;  2G8E A;  4X6J A;  1ITO A;  4Q8G A;  2R9M A;  3H8B A;  1F29 A;  4PI3 A;  1ME4 A;  2FO5 A;  1THE A;  4MSX A;  2H7J A;  1U9Q X;  2FRA A;  1BY8 A;  3K9M A;  4BPV A;  1W5R A;  4XR7 A;  1QDQ A;  4YV8 A;  1MS6 A;  1ZIV A;  2YJB A;  2VFC A;  4YYU A;  1E2T A;  1PAD A;  2F1G A;  1QMY A;  2DJG B;  3OIS A;  5K16 A;  1AYV A;  2AIM A;  2O6X A;  3B79 A;  2P86 A;  2G7Y A;  3ZUA A;  4I04 A;  1PPN A;  3S3R A;  3H89 A;  1BQI A;  4X6H A;  5F02 A;  3IV2 A;  2FT2 A;  3HWN A;  3OVZ A;  3N4C A;  1CVZ A;  2C0Y A;  1M6D A;  1CTE A;  3LFY A;  5CVN B;  3MTN A;  4NV7 A;  4CZW A;  1GCB A;  1KHP A;  4YYW A;  4BS6 A;  2P0R A;  2IBI A;  4AXM A;  2DCA A;  2NQD B;  3RVV A;  4DMY A;  4XUI A;  3DF0 A;  1O0E A;  4OEM A;  4CDF B;  1X9Y A;  4N4Z A;  2ACT A;  3KFQ A;  2HHN A;  2XU5 A;  3RVW A;  4Q8H A;  3KX1 A;  1FH0 A;  1GLO A;  1W4T A;  1HUC B;  1A6R A;  6PAD A;  2Y5B A;  3HHA A;  3BCN A;  3IUT A;  3KW9 A;  3CH2 X;  2DZZ A;  3I3T A;  2NQA A;  4B55 A;  1AIM A;  2JQG R;  2E02 A;  3KSE A;  1YT7 A;  2FRQ A;  3PBH A;  3GCB A;  4QRG A;  1ICF A;  4I05 A;  1U5I A;  2R9C A;  2HD5 A;  2B1N A;  3D9W A;  3IOQ A;  3QSD A;  4W5B A;  2FQ9 A;  1Y4H A;  7PCK A;  3MHH A;  3D6S A;  1AYW A;  1CSB B;  3LTW A;  4QH6 A;  2BDL A;  4P6G A;  1F2B A;  1EWM A;  2GFO A;  3IHP A;  1CV8 A;  3CBK A;  2NQG A;  3TNX A;  4YYQ A;  1PXV A;  1AU3 A;  2BSZ A;  1EWO A;  1PPO A;  3U8E A;  1IWD A;  5JH3 A;  2AUZ A;  2DCC A;  4QRX A;  1NPZ A;  4MZS A;  2OUL A;  4ZUX U;  1AEC A;  5J94 A;  2IPP B;  3QT4 A;  2R9N A;  3QJ3 A;  2CB5 A;  3OF8 A;  4YYR A;  1SP4 B;  4AXL A;  1K3B B;  3H6S A;  4PAD A;  2OP3 A;  5CHT A;  1CJL A;  5EF4 A;  3HHI A;  1MHW A;  1F2C A;  3BPF A;  1KHQ A;  3N3G A;  2NQI A;  3F75 A;  3V6E A;  5A24 A;  1BGO A;  5FPW A;  3S3Q A;  2DZY A;  1YK8 A;  4YVA A;  4FJC A;  1NLJ A;  3N3K A;  1TU6 A;  1U9W A;  1JQP A;  2HXZ A;  4YYS A;  5PAD A;  1YAL A;  1DF0 A;  2ARY A;  1BP4 A;  9PAP A;  2R9O A;  4BSQ A;  3CH3 X;  4GUZ A;  1MDW A;  4YYV A;  2YJC A;  3BOW A;  4CDE B;  1W6F A;  2JQF R;  1PPP A;  3P5V A;  3H8C A;  2DC8 A;  3PNR A;  2G8J A;  2E03 A;  1U9V A;  2XU3 A;  3BWK A;  3WXG A;  2F7D A;  1MEG A;  1STF E;  3I06 A;  4NV8 A;  3NHE A;  1GEC E;  4N79 A;  4OEL A;  3USV A;  2YJ9 A;  5CVO B;  1PBH A;  4BS5 A;  3WXF A;  3E1Z B;  2YJ2 A;  1CB5 A;  1NB3 A;  4KLB A;  2AUX A;  4MZO A;  5EGW A;  4W4U A;  3C9E A;  4X6I A;  1ZCM A;  1CPJ A;  3KWB X;  2BDZ A;  2CIO A;  2DC6 A;  3OF9 A;  4FIP A;  3K24 A;  3AI8 A;  2ATO A;  3IMA A;  4W5C A;  1EWP A;  1S4V A;  1ME3 A;  3P5X A;  1PPD A;  1GX3 A;  4QRV A;  1QXP A;  3PW3 A;  1XKG A;  4WA6 A;  4G54 A;  4P6E A;  2DC9 A;  1MIR A;  1POP A;  1YK7 A;  1GMY A;  2GHU A;  2E00 A;  2HH5 A;  4CDD B;  3H7D A;  3LXS A;  2AYO A;  1AYU A;  2FTD A;  2AVW A;  1VSN A;  3M99 A;  2PBH A;  3BC3 A;  2Y6E A;  4RY2 A;  1PE6 A;  3P5W A;  2P7U A;  2VHF A;  1MEM A;  1F2A A;  2XU1 A;  3O1G A;  4BGF A;  3V6C A;  3MHS A;  1QOL A;  1NB5 A;  1TL9 A;  3WXE A;  2FUD A;  2WBF X;  3MOR A;  3PDF A;  2AYN A;  1AU2 A;  1CS8 A;  4FK5 A;  2VFB A;  5CVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...