1STFE

The refined 2.4 angstroms x-ray crystal structure of recombinant human stefin b in complex with the cysteine proteinase papain: a novel type of proteinase inhibitor interaction
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
212
structure length
211
Chain Sequence
b'IPEYVDWRQKGAVTPVKNQGSCGSWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAPAIN
publication title The refined 2.4 A X-ray crystal structure of recombinant human stefin B in complex with the cysteine proteinase papain: a novel type of proteinase inhibitor interaction.
pubmed rcsb
source organism Carica papaya
molecule tags Hydrolase(sulfhydryl proteinase)
total genus 63
structure length 211
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1993-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1stfE00
2P86A 5CVMA 1M6DA 3KSEA 4QH6A 3HHIA 3KWZA 2FUDA 1F2BA 1QDQA 2OULA 1MDWA 4FK5A 3OF9A 4P6EA 3PDFA 3S3RA 2E03A 3MHSA 3N4CA 4QRXA 5CVOB 1VJVA 2O6XA 2G7YA 3O1GA 2DCBA 2ATOA 1F29A 2YJ9A 2DC9A 1CB5A 4WA6A 1CSBB 1BY8A 4N4ZA 2E02A 3N3GA 1SNKA 1Y4HA 3QT4A 3HWNA 3TNXA 1THEA 1Y08A 5K16A 2JQGR 3IUTA 3IMAA 4OELA 3P5XA 2G8EA 2DC7A 1XKGA 4YYVA 1ME3A 3MORA 5CHVA 1ME4A 1EWLA 1YK8A 3P5UA 4BQVA 5JA7A 2R6NA 1PBHA 5F02A 2DZZA 1PPPA 4YYUA 1FH0A 1MEMA 2VHFA 5FPWA 4CDCB 1STFE 1GCBA 4YV8A 4CDEB 4N79A 3IEJA 1ICFA 1CPJA 4Q8GA 2ARYA 2AVWA 3DF0A 4AXLA 2P7UA 3P5VA 2FYEA 3BCNA 1ATKA 1GMYA 1K3BB 2R9NA 2G8JA 3F75A 4HWYA 1CTEA 3I3TA 3H8CA 2YJ8A 1AIMA 2AUXA 3ZUAA 4X6IA 5EF4A 4BPVA 1ZIVA 3OVZA 3H89A 2DJFB 4FIPA 2FTDA 1PIPA 1F2CA 1QXPA 2CB5A 2XU1A 2R9OA 2IPPB 1NL6A 4N8WA 4YYSA 2XU5A 3PW3A 2DC6A 2YJ2A 1PE6A 2FRAA 3HD3A 1AU4A 2ACTA 1EWOA 4W5CA 2HXZA 1AU3A 4DMYA 1AYVA 1YT7A 3RVWA 2NQGA 4YVAA 3BPFA 3S3QA 3D6SA 1MIRA 1EWMA 3K9MA 4Q8HA 1KXRA 2WBFX 2R9CA 1ZCMA 1POPA 2JQFR 4MSXA 1MHWA 3V6EA 3QSDA 4X6HA 3K24A 4BS6A 1NPZA 1KFXL 3NHEA 3WXEA 3OF8A 4MZSA 3V6CA 4W4UA 4CZWA 3H6SA 3CH3X 8PCHA 2FT2A 4RY2A 3WXFA 3USVA 3MTNA 4FJCA 3IOQA 2DCDA 2G6DA 2DCAA 1U9XA 4MZOA 3KKUA 1CS8A 3ERVA 2BDZA 3HHAA 4KLBA 2BDLA 3GCBA 3M99A 1PPOA 2R9FA 3BWKA 2HH5A 1CJLA 2Y5BA 7PCKA 2PNSA 2YJBA 3KX1A 5J94A 3RVXA 3IV2A 2HD5A 3BOWA 2DZYA 1JQPA 2PREA 1PXVA 1S4VA 1PADA 1U9WA 2VHSA 4QRGA 4K7CA 2B1MA 1PCIA 2DC8A 3KWBX 2DCCA 1IWDA 3BC3A 3H7DA 1TL9A 1MEGA 1CVZA 4XUIA 4QBBA 3LFYA 1SP4B 3KFQA 1CV8A 1A6RA 3U8EA 4YYRA 4BS5A 1BQIA 1PPNA 2E01A 2IBIA 2R9MA 1U5IA 3B79A 3F5VA 3AI8A 1KHPA 1BGOA 3E1ZB 4OEMA 1NQCA 2AS8A 2AIMA 3MHHA 2C0YA 4BSQA 2FO5A 5JH3A 3RVVA 2DJGB 3H8BA 3WXGA 4QRVA 9PAPA 4I07A 1X9YA 1NB3A 4AXMA 1DF0A 6PADA 1YALA 2AU1A 2HHNA 1ITOA 4PP1A 2OZ2A 1KHQA 4W5BA 3IHPA 4G54A 3QJ3A 2GHUA 4CDFB 1U9VA 4DMXA 5A24A 4P6GA 2XU3A 4XR7A 3KW9A 1GECE 2H7JA 2PBHA 2FRQA 4CDDB 4PP2E 4X6JA 2NQAA 5PADA 3K8UA 4PI3A 3PBHA 3LXSA 2AYOA 2F1GA 1DEUA 3I06A 2F7DA 1QOLA 3BPMA 1AYUA 1TU6A 3N3KA 4I04A 1NLJA 1F2AA 3OISA 1AU2A 5EGWA 1EF7A 4YYWA 4YYQA 2NQDB 2CIOA 3CH2X 3CBJA 1O0EA 2PADA 3C9EA 2E00A 2NQIA 1KFUL 5CVNB 2FQ9A 3OVXA 3CBKA 2GFOA 1AYWA 1AU0A 1Q6KA 3P5WA 1PPDA 2OP3A 3PNRA 1YK7A 1EWPA 1TLOA 1NB5A 1U9QX 1QMYA 2AYNA 1AECA 3O0UA 4I05A 5CHTA 2Y6EA 4PADA 2P0RA 1MS6A 2XU4A 2B1NA 1GLOA 1VSNA 2AUZA 1CQDA 4ZUXU 1YVBA 2YJCA 1HUCB 1BP4A
chains in the Genus database with same CATH superfamily
2P86A 5CVMA 1M6DA 3KSEA 4QH6A 3HHIA 3OQCA 3KWZA 2FUDA 4M0WA 5E6JA 1F2BA 1QDQA 4RF1A 2OULA 1MDWA 4FK5A 3OF9A 4P6EA 3PDFA 3S3RA 2E03A 3MHSA 2J7QC 3N4CA 4QRXA 5CVOB 1VJVA 2O6XA 2G7YA 3O1GA 2DCBA 2ATOA 1F29A 2YJ9A 2DC9A 1CB5A 4WA6A 4BOUA 1CSBB 1BY8A 4N4ZA 2E02A 3N3GA 1SNKA 1Y4HA 3QT4A 3HWNA 3TNXA 1THEA 1Y08A 4BOSA 5K16A 2JQGR 3IUTA 3IMAA 4OELA 3P5XA 2G8EA 2DC7A 1XKGA 4YYVA 1ME3A 3MORA 5CHVA 1ME4A 1EWLA 1YK8A 3P5UA 4BQVA 5JA7A 2R6NA 3TMPA 5KO3A 1PBHA 5F02A 2DZZA 1PPPA 4YYUA 1FH0A 1MEMA 2VHFA 5FPWA 4CDCB 3B21A 1STFE 1GCBA 4YV8A 4CDEB 4N79A 2BTWB 1DKIA 3IEJA 1ICFA 1CPJA 4Q8GA 2ARYA 2AVWA 3DF0A 4AXLA 2P7UA 3P5VA 2FYEA 3BCNA 1ATKA 1GMYA 1K3BB 3TRKA 2R9NA 2G8JA 3F75A 4HWYA 1CTEA 3I3TA 3H8CA 2YJ8A 3MTVA 1AIMA 2AUXA 3ZUAA 4X6IA 5EF4A 4BPVA 1ZIVA 3OVZA 3H89A 2DJFB 4FIPA 2FTDA 4WURA 1PIPA 1F2CA 4D8IA 1QXPA 2BTWA 2CB5A 2XU1A 2R9OA 2IPPB 1NL6A 4IP3A 4N8WA 4YYSA 2XU5A 3PW3A 2DC6A 2YJ2A 1PE6A 2FRAA 3HD3A 1AU4A 4BOZA 2ACTA 1EWOA 4W5CA 3PT2A 2HXZA 1AU3A 4DMYA 3PHUA 1AYVA 1YT7A 3RVWA 2NQGA 2HWKA 3ZNHA 3BPFA 4YVAA 3S3QA 4D8EA 3D6SA 1MIRA 1EWMA 3K9MA 4Q8HA 4P16A 1KXRA 2WBFX 2R9CA 4ZTBA 1ZCMA 1POPA 2JQFR 4MSXA 1MHWA 3V6EA 3QSDA 4X6HA 2JTCA 3K24A 4BS6A 1NPZA 1KFXL 3NHEA 3WXEA 4RKXA 3OF8A 4MZSA 3V6CA 4W4UA 4CZWA 3H6SA 3CH3X 2FE8A 8PCHA 2FT2A 4RY2A 3WXFA 3USVA 3MTNA 4FJCA 3IOQA 2DCDA 2G6DA 2DCAA 5JZEA 1U9XA 3C0RA 3PRMA 4MZOA 3KKUA 1CS8A 3ERVA 2BDZA 3HHAA 4KLBA 2BDLA 3GCBA 3M99A 1PPOA 2R9FA 3BWKA 2HH5A 3MJ5A 4RF0A 1CJLA 2Y5BA 7PCKA 2PNSA 2YJBA 4HXDB 3KX1A 5J94A 3RVXA 3IV2A 2HD5A 3BOWA 2DZYA 1JQPA 2PREA 1PXVA 1S4VA 4MI7A 1UKFA 1PADA 3BBAA 1U9WA 2VHSA 4GUAA 4QRGA 4K7CA 2B1MA 1PCIA 4BOPA 2DC8A 3KWBX 2DCCA 1IWDA 3BC3A 3H7DA 1TL9A 1MEGA 1CVZA 4RNAA 4XUIA 3W31A 4QBBA 3IFUA 3LFYA 1SP4B 3KFQA 1CV8A 3PHXA 4OVZB 1A6RA 3U8EA 4YYRA 3W30A 4BS5A 1BQIA 1PPNA 2E01A 2IBIA 2R9MA 2Z84A 1U5IA 3B79A 3F5VA 3AI8A 1KHPA 1BGOA 3E1ZB 4OEMA 1NQCA 2AS8A 2AIMA 3MHHA 2C0YA 4BSQA 2FO5A 5EZSA 5JH3A 4XZXA 3MP2A 4REZA 3RVVA 2DJGB 3H8BA 5EZQA 3WXGA 4A5UA 4OVZA 4QRVA 9PAPA 4I07A 1X9YA 1NB3A 4MM3B 4AXMA 1PVJA 2BU3A 1DF0A 6PADA 3PRPA 1YALA 2AU1A 2HHNA 1ITOA 4PP1A 2OZ2A 1KHQA 4W5BA 3IHPA 4G54A 3QJ3A 3BB7A 2GHUA 4CDFB 1U9VA 4DMXA 5A24A 4P6GA 2XU3A 4XR7A 3KW9A 1GECE 2H7JA 2PBHA 2FRQA 4CDDB 2UZJA 4PP2E 4X6JA 3O65A 2NQAA 5PADA 3RNVA 3K8UA 4PI3A 3PBHA 3LXSA 2AYOA 2F1GA 1DEUA 3I06A 2F7DA 1QOLA 2JRIA 3BPMA 1AYUA 1TU6A 3N3KA 4PT5A 4I04A 1NLJA 1F2AA 3E9SA 3OISA 1AU2A 5EGWA 1EF7A 4YYWA 2DOSA 4YYQA 4IUMA 2NQDB 2CIOA 3CH2X 3CBJA 1O0EA 2PADA 3C9EA 2E00A 2NQIA 4BOQA 1KFUL 4OW0A 5CVNB 2FQ9A 3OVXA 3CBKA 2GFOA 1AYWA 1AU0A 1Q6KA 3P5WA 1PPDA 2OP3A 3PNRA 1YK7A 1YZBA 1EWPA 1TLOA 1NB5A 1U9QX 1QMYA 2AYNA 1AECA 3O0UA 4I05A 5CHTA 2Y6EA 4D8BA 4PADA 2P0RA 1MS6A 2XU4A 2AGAA 2B1NA 1GLOA 2J7QA 3BY4A 3PSEA 1VSNA 2AUZA 4R3DA 1CQDA 4ZUXU 1YVBA 3PHWA 2YJCA 1HUCB 1BP4A
chains in the Genus database with same CATH topology
2P86A 5CVMA 1M6DA 3KSEA 4QH6A 3HHIA 3KWZA 2FUDA 1F2BA 1QDQA 2OULA 1MDWA 4FK5A 3OF9A 4P6EA 3PDFA 3S3RA 2E03A 3MHSA 3N4CA 4QRXA 5CVOB 1VJVA 2O6XA 2G7YA 3O1GA 2DCBA 2ATOA 1F29A 2YJ9A 2DC9A 1W4TA 1CB5A 4WA6A 1CSBB 1BY8A 4N4ZA 2E02A 3N3GA 1SNKA 1Y4HA 3QT4A 3HWNA 3TNXA 1THEA 1Y08A 5K16A 2JQGR 3IUTA 3IMAA 4OELA 3P5XA 2G8EA 2DC7A 1XKGA 4YYVA 1ME3A 3MORA 5CHVA 1ME4A 1EWLA 1YK8A 3P5UA 4BQVA 5JA7A 2R6NA 1PBHA 5F02A 2DZZA 1PPPA 4NV7A 4YYUA 1FH0A 1MEMA 2VHFA 5FPWA 4CDCB 1STFE 1GCBA 4YV8A 4CDEB 4N79A 3IEJA 1ICFA 1CPJA 4Q8GA 2ARYA 2AVWA 3DF0A 4AXLA 2P7UA 3P5VA 2FYEA 3BCNA 1ATKA 1GMYA 1K3BB 2R9NA 2G8JA 3F75A 4HWYA 1CTEA 3I3TA 3H8CA 2YJ8A 1AIMA 2AUXA 3ZUAA 4X6IA 5EF4A 4BPVA 1ZIVA 3OVZA 3H89A 2DJFB 4FIPA 2FTDA 1PIPA 1F2CA 1QXPA 2CB5A 1W5RA 2XU1A 1E2TA 2R9OA 2IPPB 1NL6A 4N8WA 4YYSA 2XU5A 3PW3A 2DC6A 2YJ2A 1PE6A 2FRAA 3HD3A 1AU4A 2ACTA 1EWOA 4W5CA 2HXZA 1AU3A 4DMYA 1AYVA 1YT7A 3RVWA 2NQGA 4YVAA 3BPFA 3S3QA 3D6SA 1MIRA 1EWMA 3K9MA 4Q8HA 1KXRA 2WBFX 2R9CA 1ZCMA 1POPA 2JQFR 4MSXA 1MHWA 3V6EA 3QSDA 4X6HA 3K24A 4NV8A 4BS6A 4GUZA 1NPZA 1KFXL 3NHEA 3WXEA 3OF8A 4MZSA 3V6CA 4BGFA 4W4UA 4CZWA 3H6SA 3CH3X 8PCHA 2FT2A 4RY2A 3WXFA 3USVA 3MTNA 4FJCA 3IOQA 2DCDA 2G6DA 2DCAA 1U9XA 4MZOA 3KKUA 1CS8A 3ERVA 2BSZA 2BDZA 3HHAA 4KLBA 2BDLA 3GCBA 3M99A 1PPOA 2R9FA 3BWKA 2HH5A 1CJLA 2Y5BA 7PCKA 2PNSA 2YJBA 3KX1A 5J94A 3RVXA 3IV2A 2HD5A 3BOWA 2DZYA 1JQPA 2PREA 1PXVA 1S4VA 1PADA 1U9WA 2VHSA 4QRGA 4K7CA 2B1MA 1PCIA 2DC8A 3KWBX 2DCCA 3LTWA 1IWDA 3BC3A 3H7DA 1TL9A 1MEGA 1CVZA 4XUIA 4QBBA 3LFYA 1SP4B 3KFQA 1CV8A 1A6RA 3U8EA 4YYRA 4BS5A 1BQIA 1PPNA 2E01A 2IBIA 2R9MA 1U5IA 3B79A 3F5VA 3AI8A 4B55A 1KHPA 1BGOA 3E1ZB 4OEMA 1NQCA 2AS8A 2AIMA 3MHHA 2C0YA 4BSQA 2FO5A 5JH3A 3RVVA 2DJGB 3H8BA 3WXGA 4QRVA 9PAPA 4I07A 1X9YA 1NB3A 4AXMA 1DF0A 6PADA 1YALA 2AU1A 2HHNA 1ITOA 4PP1A 2OZ2A 1KHQA 4W5BA 3IHPA 4G54A 3QJ3A 2GHUA 4CDFB 1U9VA 4DMXA 5A24A 4P6GA 1W6FA 2XU3A 2VFBA 4XR7A 4C5PA 3KW9A 1GECE 2H7JA 2PBHA 2FRQA 4CDDB 4PP2E 4X6JA 2NQAA 5PADA 3K8UA 4PI3A 3PBHA 3LXSA 2AYOA 2F1GA 1DEUA 3I06A 2F7DA 1QOLA 3BPMA 1AYUA 1TU6A 3N3KA 4I04A 1NLJA 1F2AA 3OISA 1AU2A 5EGWA 1EF7A 4YYWA 4YYQA 2NQDB 2CIOA 3CH2X 3CBJA 1O0EA 2PADA 3C9EA 2E00A 2NQIA 1KFUL 5CVNB 2FQ9A 3OVXA 3CBKA 2GFOA 1AYWA 1AU0A 1Q6KA 3P5WA 1PPDA 2OP3A 3PNRA 1YK7A 1EWPA 1TLOA 1NB5A 1U9QX 1QMYA 2AYNA 1AECA 3O0UA 4I05A 5CHTA 2Y6EA 4PADA 3D9WA 2P0RA 1MS6A 2XU4A 1GX3A 2B1NA 1GLOA 2VFCA 1VSNA 2AUZA 1CQDA 4ZUXU 1YVBA 2YJCA 1HUCB 1BP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P86 A;  5CVM A;  1M6D A;  3KSE A;  4QH6 A;  3HHI A;  3KWZ A;  2FUD A;  1F2B A;  1QDQ A;  2OUL A;  1MDW A;  4FK5 A;  3OF9 A;  4P6E A;  3PDF A;  3S3R A;  2E03 A;  3MHS A;  3N4C A;  4QRX A;  5CVO B;  1VJV A;  2O6X A;  2G7Y A;  3O1G A;  2DCB A;  2ATO A;  1F29 A;  2YJ9 A;  2DC9 A;  1CB5 A;  4WA6 A;  1CSB B;  1BY8 A;  4N4Z A;  2E02 A;  3N3G A;  1SNK A;  1Y4H A;  3QT4 A;  3HWN A;  3TNX A;  1THE A;  1Y08 A;  5K16 A;  2JQG R;  3IUT A;  3IMA A;  4OEL A;  3P5X A;  2G8E A;  2DC7 A;  1XKG A;  4YYV A;  1ME3 A;  3MOR A;  5CHV A;  1ME4 A;  1EWL A;  1YK8 A;  3P5U A;  4BQV A;  5JA7 A;  2R6N A;  1PBH A;  5F02 A;  2DZZ A;  1PPP A;  4YYU A;  1FH0 A;  1MEM A;  2VHF A;  5FPW A;  4CDC B;  1STF E;  1GCB A;  4YV8 A;  4CDE B;  4N79 A;  3IEJ A;  1ICF A;  1CPJ A;  4Q8G A;  2ARY A;  2AVW A;  3DF0 A;  4AXL A;  2P7U A;  3P5V A;  2FYE A;  3BCN A;  1ATK A;  1GMY A;  1K3B B;  2R9N A;  2G8J A;  3F75 A;  4HWY A;  1CTE A;  3I3T A;  3H8C A;  2YJ8 A;  1AIM A;  2AUX A;  3ZUA A;  4X6I A;  5EF4 A;  4BPV A;  1ZIV A;  3OVZ A;  3H89 A;  2DJF B;  4FIP A;  2FTD A;  1PIP A;  1F2C A;  1QXP A;  2CB5 A;  2XU1 A;  2R9O A;  2IPP B;  1NL6 A;  4N8W A;  4YYS A;  2XU5 A;  3PW3 A;  2DC6 A;  2YJ2 A;  1PE6 A;  2FRA A;  3HD3 A;  1AU4 A;  2ACT A;  1EWO A;  4W5C A;  2HXZ A;  1AU3 A;  4DMY A;  1AYV A;  1YT7 A;  3RVW A;  2NQG A;  4YVA A;  3BPF A;  3S3Q A;  3D6S A;  1MIR A;  1EWM A;  3K9M A;  4Q8H A;  1KXR A;  2WBF X;  2R9C A;  1ZCM A;  1POP A;  2JQF R;  4MSX A;  1MHW A;  3V6E A;  3QSD A;  4X6H A;  3K24 A;  4BS6 A;  1NPZ A;  1KFX L;  3NHE A;  3WXE A;  3OF8 A;  4MZS A;  3V6C A;  4W4U A;  4CZW A;  3H6S A;  3CH3 X;  8PCH A;  2FT2 A;  4RY2 A;  3WXF A;  3USV A;  3MTN A;  4FJC A;  3IOQ A;  2DCD A;  2G6D A;  2DCA A;  1U9X A;  4MZO A;  3KKU A;  1CS8 A;  3ERV A;  2BDZ A;  3HHA A;  4KLB A;  2BDL A;  3GCB A;  3M99 A;  1PPO A;  2R9F A;  3BWK A;  2HH5 A;  1CJL A;  2Y5B A;  7PCK A;  2PNS A;  2YJB A;  3KX1 A;  5J94 A;  3RVX A;  3IV2 A;  2HD5 A;  3BOW A;  2DZY A;  1JQP A;  2PRE A;  1PXV A;  1S4V A;  1PAD A;  1U9W A;  2VHS A;  4QRG A;  4K7C A;  2B1M A;  1PCI A;  2DC8 A;  3KWB X;  2DCC A;  1IWD A;  3BC3 A;  3H7D A;  1TL9 A;  1MEG A;  1CVZ A;  4XUI A;  4QBB A;  3LFY A;  1SP4 B;  3KFQ A;  1CV8 A;  1A6R A;  3U8E A;  4YYR A;  4BS5 A;  1BQI A;  1PPN A;  2E01 A;  2IBI A;  2R9M A;  1U5I A;  3B79 A;  3F5V A;  3AI8 A;  1KHP A;  1BGO A;  3E1Z B;  4OEM A;  1NQC A;  2AS8 A;  2AIM A;  3MHH A;  2C0Y A;  4BSQ A;  2FO5 A;  5JH3 A;  3RVV A;  2DJG B;  3H8B A;  3WXG A;  4QRV A;  9PAP A;  4I07 A;  1X9Y A;  1NB3 A;  4AXM A;  1DF0 A;  6PAD A;  1YAL A;  2AU1 A;  2HHN A;  1ITO A;  4PP1 A;  2OZ2 A;  1KHQ A;  4W5B A;  3IHP A;  4G54 A;  3QJ3 A;  2GHU A;  4CDF B;  1U9V A;  4DMX A;  5A24 A;  4P6G A;  2XU3 A;  4XR7 A;  3KW9 A;  1GEC E;  2H7J A;  2PBH A;  2FRQ A;  4CDD B;  4PP2 E;  4X6J A;  2NQA A;  5PAD A;  3K8U A;  4PI3 A;  3PBH A;  3LXS A;  2AYO A;  2F1G A;  1DEU A;  3I06 A;  2F7D A;  1QOL A;  3BPM A;  1AYU A;  1TU6 A;  3N3K A;  4I04 A;  1NLJ A;  1F2A A;  3OIS A;  1AU2 A;  5EGW A;  1EF7 A;  4YYW A;  4YYQ A;  2NQD B;  2CIO A;  3CH2 X;  3CBJ A;  1O0E A;  2PAD A;  3C9E A;  2E00 A;  2NQI A;  1KFU L;  5CVN B;  2FQ9 A;  3OVX A;  3CBK A;  2GFO A;  1AYW A;  1AU0 A;  1Q6K A;  3P5W A;  1PPD A;  2OP3 A;  3PNR A;  1YK7 A;  1EWP A;  1TLO A;  1NB5 A;  1U9Q X;  1QMY A;  2AYN A;  1AEC A;  3O0U A;  4I05 A;  5CHT A;  2Y6E A;  4PAD A;  2P0R A;  1MS6 A;  2XU4 A;  2B1N A;  1GLO A;  1VSN A;  2AUZ A;  1CQD A;  4ZUX U;  1YVB A;  2YJC A;  1HUC B;  1BP4 A; 
#chains in the Genus database with same CATH topology
 2P86 A;  5CVM A;  1M6D A;  3KSE A;  4QH6 A;  3HHI A;  3OQC A;  3KWZ A;  2FUD A;  4M0W A;  5E6J A;  1F2B A;  1QDQ A;  4RF1 A;  2OUL A;  1MDW A;  4FK5 A;  3OF9 A;  4P6E A;  3PDF A;  3S3R A;  2E03 A;  3MHS A;  2J7Q C;  3N4C A;  4QRX A;  5CVO B;  1VJV A;  2O6X A;  2G7Y A;  3O1G A;  2DCB A;  2ATO A;  1F29 A;  2YJ9 A;  2DC9 A;  1CB5 A;  4WA6 A;  4BOU A;  1CSB B;  1BY8 A;  4N4Z A;  2E02 A;  3N3G A;  1SNK A;  1Y4H A;  3QT4 A;  3HWN A;  3TNX A;  1THE A;  1Y08 A;  4BOS A;  5K16 A;  2JQG R;  3IUT A;  3IMA A;  4OEL A;  3P5X A;  2G8E A;  2DC7 A;  1XKG A;  4YYV A;  1ME3 A;  3MOR A;  5CHV A;  1ME4 A;  1EWL A;  1YK8 A;  3P5U A;  4BQV A;  5JA7 A;  2R6N A;  3TMP A;  5KO3 A;  1PBH A;  5F02 A;  2DZZ A;  1PPP A;  4YYU A;  1FH0 A;  1MEM A;  2VHF A;  5FPW A;  4CDC B;  3B21 A;  1STF E;  1GCB A;  4YV8 A;  4CDE B;  4N79 A;  2BTW B;  1DKI A;  3IEJ A;  1ICF A;  1CPJ A;  4Q8G A;  2ARY A;  2AVW A;  3DF0 A;  4AXL A;  2P7U A;  3P5V A;  2FYE A;  3BCN A;  1ATK A;  1GMY A;  1K3B B;  3TRK A;  2R9N A;  2G8J A;  3F75 A;  4HWY A;  1CTE A;  3I3T A;  3H8C A;  2YJ8 A;  3MTV A;  1AIM A;  2AUX A;  3ZUA A;  4X6I A;  5EF4 A;  4BPV A;  1ZIV A;  3OVZ A;  3H89 A;  2DJF B;  4FIP A;  2FTD A;  4WUR A;  1PIP A;  1F2C A;  4D8I A;  1QXP A;  2BTW A;  2CB5 A;  2XU1 A;  2R9O A;  2IPP B;  1NL6 A;  4IP3 A;  4N8W A;  4YYS A;  2XU5 A;  3PW3 A;  2DC6 A;  2YJ2 A;  1PE6 A;  2FRA A;  3HD3 A;  1AU4 A;  4BOZ A;  2ACT A;  1EWO A;  4W5C A;  3PT2 A;  2HXZ A;  1AU3 A;  4DMY A;  3PHU A;  1AYV A;  1YT7 A;  3RVW A;  2NQG A;  2HWK A;  3ZNH A;  3BPF A;  4YVA A;  3S3Q A;  4D8E A;  3D6S A;  1MIR A;  1EWM A;  3K9M A;  4Q8H A;  4P16 A;  1KXR A;  2WBF X;  2R9C A;  4ZTB A;  1ZCM A;  1POP A;  2JQF R;  4MSX A;  1MHW A;  3V6E A;  3QSD A;  4X6H A;  2JTC A;  3K24 A;  4BS6 A;  1NPZ A;  1KFX L;  3NHE A;  3WXE A;  4RKX A;  3OF8 A;  4MZS A;  3V6C A;  4W4U A;  4CZW A;  3H6S A;  3CH3 X;  2FE8 A;  8PCH A;  2FT2 A;  4RY2 A;  3WXF A;  3USV A;  3MTN A;  4FJC A;  3IOQ A;  2DCD A;  2G6D A;  2DCA A;  5JZE A;  1U9X A;  3C0R A;  3PRM A;  4MZO A;  3KKU A;  1CS8 A;  3ERV A;  2BDZ A;  3HHA A;  4KLB A;  2BDL A;  3GCB A;  3M99 A;  1PPO A;  2R9F A;  3BWK A;  2HH5 A;  3MJ5 A;  4RF0 A;  1CJL A;  2Y5B A;  7PCK A;  2PNS A;  2YJB A;  4HXD B;  3KX1 A;  5J94 A;  3RVX A;  3IV2 A;  2HD5 A;  3BOW A;  2DZY A;  1JQP A;  2PRE A;  1PXV A;  1S4V A;  4MI7 A;  1UKF A;  1PAD A;  3BBA A;  1U9W A;  2VHS A;  4GUA A;  4QRG A;  4K7C A;  2B1M A;  1PCI A;  4BOP A;  2DC8 A;  3KWB X;  2DCC A;  1IWD A;  3BC3 A;  3H7D A;  1TL9 A;  1MEG A;  1CVZ A;  4RNA A;  4XUI A;  3W31 A;  4QBB A;  3IFU A;  3LFY A;  1SP4 B;  3KFQ A;  1CV8 A;  3PHX A;  4OVZ B;  1A6R A;  3U8E A;  4YYR A;  3W30 A;  4BS5 A;  1BQI A;  1PPN A;  2E01 A;  2IBI A;  2R9M A;  2Z84 A;  1U5I A;  3B79 A;  3F5V A;  3AI8 A;  1KHP A;  1BGO A;  3E1Z B;  4OEM A;  1NQC A;  2AS8 A;  2AIM A;  3MHH A;  2C0Y A;  4BSQ A;  2FO5 A;  5EZS A;  5JH3 A;  4XZX A;  3MP2 A;  4REZ A;  3RVV A;  2DJG B;  3H8B A;  5EZQ A;  3WXG A;  4A5U A;  4OVZ A;  4QRV A;  9PAP A;  4I07 A;  1X9Y A;  1NB3 A;  4MM3 B;  4AXM A;  1PVJ A;  2BU3 A;  1DF0 A;  6PAD A;  3PRP A;  1YAL A;  2AU1 A;  2HHN A;  1ITO A;  4PP1 A;  2OZ2 A;  1KHQ A;  4W5B A;  3IHP A;  4G54 A;  3QJ3 A;  3BB7 A;  2GHU A;  4CDF B;  1U9V A;  4DMX A;  5A24 A;  4P6G A;  2XU3 A;  4XR7 A;  3KW9 A;  1GEC E;  2H7J A;  2PBH A;  2FRQ A;  4CDD B;  2UZJ A;  4PP2 E;  4X6J A;  3O65 A;  2NQA A;  5PAD A;  3RNV A;  3K8U A;  4PI3 A;  3PBH A;  3LXS A;  2AYO A;  2F1G A;  1DEU A;  3I06 A;  2F7D A;  1QOL A;  2JRI A;  3BPM A;  1AYU A;  1TU6 A;  3N3K A;  4PT5 A;  4I04 A;  1NLJ A;  1F2A A;  3E9S A;  3OIS A;  1AU2 A;  5EGW A;  1EF7 A;  4YYW A;  2DOS A;  4YYQ A;  4IUM A;  2NQD B;  2CIO A;  3CH2 X;  3CBJ A;  1O0E A;  2PAD A;  3C9E A;  2E00 A;  2NQI A;  4BOQ A;  1KFU L;  4OW0 A;  5CVN B;  2FQ9 A;  3OVX A;  3CBK A;  2GFO A;  1AYW A;  1AU0 A;  1Q6K A;  3P5W A;  1PPD A;  2OP3 A;  3PNR A;  1YK7 A;  1YZB A;  1EWP A;  1TLO A;  1NB5 A;  1U9Q X;  1QMY A;  2AYN A;  1AEC A;  3O0U A;  4I05 A;  5CHT A;  2Y6E A;  4D8B A;  4PAD A;  2P0R A;  1MS6 A;  2XU4 A;  2AGA A;  2B1N A;  1GLO A;  2J7Q A;  3BY4 A;  3PSE A;  1VSN A;  2AUZ A;  4R3D A;  1CQD A;  4ZUX U;  1YVB A;  3PHW A;  2YJC A;  1HUC B;  1BP4 A; 
#chains in the Genus database with same CATH homology
 2P86 A;  5CVM A;  1M6D A;  3KSE A;  4QH6 A;  3HHI A;  3KWZ A;  2FUD A;  1F2B A;  1QDQ A;  2OUL A;  1MDW A;  4FK5 A;  3OF9 A;  4P6E A;  3PDF A;  3S3R A;  2E03 A;  3MHS A;  3N4C A;  4QRX A;  5CVO B;  1VJV A;  2O6X A;  2G7Y A;  3O1G A;  2DCB A;  2ATO A;  1F29 A;  2YJ9 A;  2DC9 A;  1W4T A;  1CB5 A;  4WA6 A;  1CSB B;  1BY8 A;  4N4Z A;  2E02 A;  3N3G A;  1SNK A;  1Y4H A;  3QT4 A;  3HWN A;  3TNX A;  1THE A;  1Y08 A;  5K16 A;  2JQG R;  3IUT A;  3IMA A;  4OEL A;  3P5X A;  2G8E A;  2DC7 A;  1XKG A;  4YYV A;  1ME3 A;  3MOR A;  5CHV A;  1ME4 A;  1EWL A;  1YK8 A;  3P5U A;  4BQV A;  5JA7 A;  2R6N A;  1PBH A;  5F02 A;  2DZZ A;  1PPP A;  4NV7 A;  4YYU A;  1FH0 A;  1MEM A;  2VHF A;  5FPW A;  4CDC B;  1STF E;  1GCB A;  4YV8 A;  4CDE B;  4N79 A;  3IEJ A;  1ICF A;  1CPJ A;  4Q8G A;  2ARY A;  2AVW A;  3DF0 A;  4AXL A;  2P7U A;  3P5V A;  2FYE A;  3BCN A;  1ATK A;  1GMY A;  1K3B B;  2R9N A;  2G8J A;  3F75 A;  4HWY A;  1CTE A;  3I3T A;  3H8C A;  2YJ8 A;  1AIM A;  2AUX A;  3ZUA A;  4X6I A;  5EF4 A;  4BPV A;  1ZIV A;  3OVZ A;  3H89 A;  2DJF B;  4FIP A;  2FTD A;  1PIP A;  1F2C A;  1QXP A;  2CB5 A;  1W5R A;  2XU1 A;  1E2T A;  2R9O A;  2IPP B;  1NL6 A;  4N8W A;  4YYS A;  2XU5 A;  3PW3 A;  2DC6 A;  2YJ2 A;  1PE6 A;  2FRA A;  3HD3 A;  1AU4 A;  2ACT A;  1EWO A;  4W5C A;  2HXZ A;  1AU3 A;  4DMY A;  1AYV A;  1YT7 A;  3RVW A;  2NQG A;  4YVA A;  3BPF A;  3S3Q A;  3D6S A;  1MIR A;  1EWM A;  3K9M A;  4Q8H A;  1KXR A;  2WBF X;  2R9C A;  1ZCM A;  1POP A;  2JQF R;  4MSX A;  1MHW A;  3V6E A;  3QSD A;  4X6H A;  3K24 A;  4NV8 A;  4BS6 A;  4GUZ A;  1NPZ A;  1KFX L;  3NHE A;  3WXE A;  3OF8 A;  4MZS A;  3V6C A;  4BGF A;  4W4U A;  4CZW A;  3H6S A;  3CH3 X;  8PCH A;  2FT2 A;  4RY2 A;  3WXF A;  3USV A;  3MTN A;  4FJC A;  3IOQ A;  2DCD A;  2G6D A;  2DCA A;  1U9X A;  4MZO A;  3KKU A;  1CS8 A;  3ERV A;  2BSZ A;  2BDZ A;  3HHA A;  4KLB A;  2BDL A;  3GCB A;  3M99 A;  1PPO A;  2R9F A;  3BWK A;  2HH5 A;  1CJL A;  2Y5B A;  7PCK A;  2PNS A;  2YJB A;  3KX1 A;  5J94 A;  3RVX A;  3IV2 A;  2HD5 A;  3BOW A;  2DZY A;  1JQP A;  2PRE A;  1PXV A;  1S4V A;  1PAD A;  1U9W A;  2VHS A;  4QRG A;  4K7C A;  2B1M A;  1PCI A;  2DC8 A;  3KWB X;  2DCC A;  3LTW A;  1IWD A;  3BC3 A;  3H7D A;  1TL9 A;  1MEG A;  1CVZ A;  4XUI A;  4QBB A;  3LFY A;  1SP4 B;  3KFQ A;  1CV8 A;  1A6R A;  3U8E A;  4YYR A;  4BS5 A;  1BQI A;  1PPN A;  2E01 A;  2IBI A;  2R9M A;  1U5I A;  3B79 A;  3F5V A;  3AI8 A;  4B55 A;  1KHP A;  1BGO A;  3E1Z B;  4OEM A;  1NQC A;  2AS8 A;  2AIM A;  3MHH A;  2C0Y A;  4BSQ A;  2FO5 A;  5JH3 A;  3RVV A;  2DJG B;  3H8B A;  3WXG A;  4QRV A;  9PAP A;  4I07 A;  1X9Y A;  1NB3 A;  4AXM A;  1DF0 A;  6PAD A;  1YAL A;  2AU1 A;  2HHN A;  1ITO A;  4PP1 A;  2OZ2 A;  1KHQ A;  4W5B A;  3IHP A;  4G54 A;  3QJ3 A;  2GHU A;  4CDF B;  1U9V A;  4DMX A;  5A24 A;  4P6G A;  1W6F A;  2XU3 A;  2VFB A;  4XR7 A;  4C5P A;  3KW9 A;  1GEC E;  2H7J A;  2PBH A;  2FRQ A;  4CDD B;  4PP2 E;  4X6J A;  2NQA A;  5PAD A;  3K8U A;  4PI3 A;  3PBH A;  3LXS A;  2AYO A;  2F1G A;  1DEU A;  3I06 A;  2F7D A;  1QOL A;  3BPM A;  1AYU A;  1TU6 A;  3N3K A;  4I04 A;  1NLJ A;  1F2A A;  3OIS A;  1AU2 A;  5EGW A;  1EF7 A;  4YYW A;  4YYQ A;  2NQD B;  2CIO A;  3CH2 X;  3CBJ A;  1O0E A;  2PAD A;  3C9E A;  2E00 A;  2NQI A;  1KFU L;  5CVN B;  2FQ9 A;  3OVX A;  3CBK A;  2GFO A;  1AYW A;  1AU0 A;  1Q6K A;  3P5W A;  1PPD A;  2OP3 A;  3PNR A;  1YK7 A;  1EWP A;  1TLO A;  1NB5 A;  1U9Q X;  1QMY A;  2AYN A;  1AEC A;  3O0U A;  4I05 A;  5CHT A;  2Y6E A;  4PAD A;  3D9W A;  2P0R A;  1MS6 A;  2XU4 A;  1GX3 A;  2B1N A;  1GLO A;  2VFC A;  1VSN A;  2AUZ A;  1CQD A;  4ZUX U;  1YVB A;  2YJC A;  1HUC B;  1BP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...