1STFE

The refined 2.4 angstroms x-ray crystal structure of recombinant human stefin b in complex with the cysteine proteinase papain: a novel type of proteinase inhibitor interaction
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
212
structure length
211
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAPAIN
publication title The refined 2.4 A X-ray crystal structure of recombinant human stefin B in complex with the cysteine proteinase papain: a novel type of proteinase inhibitor interaction.
pubmed rcsb
source organism Carica papaya
molecule tags Hydrolase(sulfhydryl proteinase)
total genus 63
structure length 211
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1993-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1stfE00
3N4CA 2ARYA 2HHNA 1F2BA 1DEUA 2VHSA 3I06A 2FT2A 1PPPA 1YALA 1VJVA 2FUDA 3CH2X 4FIPA 2OZ2A 3N3KA 1MS6A 4K7CA 3I3TA 4X6IA 2XU5A 2AIMA 3WXEA 1MDWA 3BOWA 4AXMA 2DC8A 2E03A 3E1ZB 2E01A 3H6SA 4CDDB 1TU6A 4BS5A 2ATOA 1CJLA 3LXSA 2HD5A 2HXZA 2WBFX 5EF4A 1EWMA 3CH3X 4W5CA 4KLBA 1AU3A 3C9EA 1FH0A 3OF8A 1Y4HA 2GFOA 1F2AA 4N79A 5CVOB 1HUCB 5F02A 2E00A 1PXVA 4QRVA 1NB3A 2AS8A 3HD3A 3DF0A 1U9WA 1YT7A 3KSEA 5K16A 3KX1A 2Y5BA 4MZOA 3MORA 2P0RA 4PP1A 4PP2E 5J94A 4BS6A 3D6SA 2C0YA 1AYUA 3ZUAA 3PW3A 1ATKA 1BQIA 2PREA 3HHIA 4DMYA 2YJCA 1SP4B 3RVXA 4RY2A 3WXGA 2B1NA 2F1GA 1VSNA 1QOLA 3V6CA 2CB5A 4FK5A 4OELA 1PIPA 5CHTA 2NQDB 3NHEA 1KXRA 1U9VA 3RVVA 4W5BA 1PPNA 3CBKA 1GCBA 3KW9A 2VHFA 3OVXA 1CS8A 4YYRA 1CSBB 4DMXA 1AU0A 2FYEA 4YYWA 2G6DA 1EWPA 1ITOA 3H8BA 3KKUA 2DC7A 5FPWA 3U8EA 2DCAA 3LFYA 1Y08A 2XU3A 2YJ8A 2OULA 2G8EA 4WA6A 4CDEB 1THEA 2DCDA 7PCKA 2R9FA 2H7JA 4MSXA 2IBIA 2AYNA 1PPDA 3WXFA 4OEMA 1CB5A 1STFE 3O0UA 1GECE 3S3QA 1AYWA 1ZIVA 3IUTA 1NPZA 2YJBA 2DCBA 5CVNB 3H89A 2R9MA 1EWOA 3H7DA 1O0EA 1CTEA 1JQPA 2DZYA 2F7DA 4YYSA 3BPFA 2BDZA 2CIOA 1PCIA 3BCNA 2DJFB 3K9MA 1DF0A 2PBHA 3IOQA 4XUIA 5CHVA 1NLJA 5EGWA 3QJ3A 4CDFB 3M99A 1BGOA 1QDQA 4PI3A 3K8UA 1KFUL 3F75A 1QXPA 5CVMA 8PCHA 4MZSA 2NQGA 2DZZA 2AUXA 3KWZA 3B79A 1AU2A 2HH5A 1GLOA 3RVWA 3IV2A 1ME3A 2YJ9A 4YV8A 1NL6A 1YK8A 1U5IA 1CVZA 4HWYA 9PAPA 4YYQA 4YVAA 3K24A 3QSDA 1NB5A 2FO5A 1ME4A 1CQDA 1S4VA 3N3GA 2AUZA 1PBHA 2IPPB 2AYOA 2OP3A 3P5XA 3HWNA 3MHHA 2R9NA 2FRQA 2JQFR 2P86A 1AECA 4AXLA 1ZCMA 2AVWA 3P5WA 3PNRA 4YYUA 2DCCA 2P7UA 3GCBA 3O1GA 1A6RA 1GMYA 3P5VA 4P6GA 1MHWA 1MEMA 4BSQA 3USVA 1SNKA 1TL9A 1M6DA 3HHAA 2BDLA 1F2CA 4W4UA 1KHQA 4N4ZA 2Y6EA 2G8JA 2XU4A 4X6HA 2ACTA 1TLOA 1U9XA 2NQIA 6PADA 1U9QX 5JA7A 3IEJA 3S3RA 3MHSA 5A24A 2DJGB 2B1MA 3KWBX 2E02A 4BPVA 1KHPA 3ERVA 4CDCB 1X9YA 3IHPA 4QH6A 1AU4A 3TNXA 2G7YA 4QBBA 2NQAA 1EF7A 3P5UA 1KFXL 1XKGA 3BC3A 4QRGA 1YK7A 3PDFA 1MIRA 2FQ9A 1CPJA 1AIMA 2R9OA 1CV8A 1PADA 2R6NA 3CBJA 3OVZA 1BP4A 4QRXA 1PE6A 1NQCA 3MTNA 1K3BB 4I05A 5PADA 2AU1A 4ZUXU 4Q8HA 4I07A 3OISA 4N8WA 4BQVA 4X6JA 4I04A 1F29A 1IWDA 1PPOA 2DC6A 1EWLA 2XU1A 5JH3A 2O6XA 1AYVA 3PBHA 4YYVA 1ICFA 2GHUA 2JQGR 1MEGA 4CZWA 4PADA 1QMYA 2YJ2A 4XR7A 4FJCA 3BPMA 2DC9A 2PADA 3KFQA 3V6EA 2FRAA 2PNSA 3AI8A 1YVBA 3OF9A 2FTDA 1POPA 4Q8GA 3BWKA 4G54A 1BY8A 3H8CA 1Q6KA 3IMAA 3QT4A 4P6EA 3F5VA 2R9CA
chains in the Genus database with same CATH superfamily
3N4CA 2ARYA 2HHNA 3PRPA 1F2BA 1DEUA 2VHSA 3I06A 2FT2A 4RF0A 1PPPA 1YALA 1VJVA 4HXDB 2FUDA 3PHUA 3CH2X 4FIPA 3MJ5A 5EZSA 1YZBA 2OZ2A 3N3KA 1MS6A 4K7CA 3I3TA 4X6IA 2XU5A 2AIMA 3WXEA 1MDWA 3BOWA 4AXMA 2DC8A 4REZA 2E03A 3E1ZB 2E01A 3H6SA 4CDDB 1TU6A 3ZNHA 4BS5A 2ATOA 1CJLA 3LXSA 2HD5A 2HXZA 2WBFX 5EF4A 1EWMA 3CH3X 4W5CA 4KLBA 1AU3A 3C9EA 1FH0A 3OF8A 1Y4HA 2J7QC 4BOUA 2GFOA 4XZXA 2BTWB 1F2AA 4N79A 5CVOB 1HUCB 5EZQA 5F02A 2E00A 1PXVA 4QRVA 1NB3A 2AS8A 3HD3A 3DF0A 1U9WA 1YT7A 3KSEA 5K16A 3KX1A 2Y5BA 4MZOA 3MORA 2P0RA 4BOPA 4PP1A 4PP2E 5J94A 4BS6A 3D6SA 2C0YA 1AYUA 3ZUAA 3PW3A 1DKIA 1ATKA 1BQIA 2JRIA 2PREA 2FE8A 3HHIA 4BOZA 4DMYA 3W31A 3MTVA 3TRKA 2YJCA 1SP4B 3RVXA 4RY2A 3WXGA 2B1NA 2F1GA 1VSNA 1QOLA 3V6CA 2CB5A 4FK5A 4OELA 1PIPA 5CHTA 3TMPA 2BU3A 2NQDB 4RF1A 3NHEA 4OVZA 1KXRA 1U9VA 3RVVA 4W5BA 1PPNA 3CBKA 1PVJA 1GCBA 4ZTBA 3KW9A 2VHFA 3OVXA 4RKXA 1CS8A 4YYRA 1CSBB 4DMXA 1AU0A 2FYEA 4D8IA 4YYWA 2AGAA 4BOQA 2G6DA 1EWPA 1ITOA 3H8BA 3KKUA 5E6JA 2DC7A 5FPWA 3U8EA 2DCAA 3LFYA 1Y08A 2XU3A 2YJ8A 2OULA 2G8EA 4WA6A 4CDEB 1THEA 4MI7A 2DCDA 7PCKA 2R9FA 4RNAA 2H7JA 4MSXA 2IBIA 2AYNA 1PPDA 3WXFA 4BOSA 4A5UA 4OEMA 1CB5A 1STFE 3O0UA 1GECE 3S3QA 1AYWA 1ZIVA 3IUTA 1NPZA 2DOSA 2YJBA 2DCBA 5CVNB 3H89A 3O65A 2R9MA 1EWOA 3H7DA 1O0EA 1CTEA 1JQPA 2DZYA 2F7DA 4YYSA 3BPFA 2BDZA 2CIOA 1PCIA 3BCNA 2DJFB 3K9MA 1DF0A 2PBHA 3IOQA 4XUIA 5CHVA 2J7QA 4OW0A 1NLJA 5EGWA 3QJ3A 4CDFB 3BY4A 3M99A 1BGOA 1QDQA 4PI3A 3K8UA 1KFUL 3F75A 1QXPA 5CVMA 8PCHA 3PHWA 4MZSA 3PT2A 2NQGA 2DZZA 2AUXA 3KWZA 3B79A 1AU2A 2HH5A 3BB7A 4M0WA 4OVZB 1GLOA 3RVWA 3IV2A 1ME3A 2YJ9A 4YV8A 1NL6A 1YK8A 1U5IA 1CVZA 3PRMA 4HWYA 9PAPA 4YYQA 4YVAA 3K24A 3QSDA 1NB5A 2FO5A 1ME4A 1CQDA 1S4VA 3N3GA 4MM3B 2JTCA 2AUZA 1PBHA 2IPPB 3B21A 2AYOA 2OP3A 3P5XA 3HWNA 3PHXA 3MHHA 2R9NA 2FRQA 2JQFR 4WURA 2P86A 1AECA 4AXLA 1ZCMA 2AVWA 3P5WA 4PT5A 3PNRA 4R3DA 4YYUA 2DCCA 2P7UA 3GCBA 3O1GA 1A6RA 1GMYA 3P5VA 4P6GA 1MHWA 1MEMA 4BSQA 3USVA 1SNKA 1TL9A 1M6DA 5JZEA 5KO3A 3HHAA 2BDLA 1F2CA 1UKFA 4W4UA 1KHQA 3BBAA 4N4ZA 2Y6EA 2G8JA 2XU4A 4IUMA 4X6HA 3OQCA 2ACTA 1TLOA 4GUAA 1U9XA 2NQIA 4IP3A 6PADA 1U9QX 3C0RA 5JA7A 3IEJA 3S3RA 3MHSA 5A24A 2DJGB 2B1MA 3KWBX 2E02A 4BPVA 1KHPA 3ERVA 4CDCB 3RNVA 1X9YA 3IHPA 4QH6A 1AU4A 3TNXA 2G7YA 2UZJA 4QBBA 2NQAA 1EF7A 3P5UA 1KFXL 1XKGA 3BC3A 4QRGA 1YK7A 3PDFA 3PSEA 3W30A 1MIRA 2FQ9A 1CPJA 1AIMA 2R9OA 1CV8A 1PADA 2R6NA 3CBJA 3OVZA 1BP4A 4QRXA 2HWKA 1PE6A 1NQCA 3MTNA 2Z84A 1K3BB 4I05A 5PADA 2AU1A 4ZUXU 4Q8HA 4D8BA 4I07A 3OISA 4N8WA 2BTWA 3IFUA 4BQVA 4X6JA 3E9SA 4I04A 1F29A 3MP2A 1IWDA 1PPOA 2DC6A 1EWLA 2XU1A 5JH3A 2O6XA 1AYVA 3PBHA 4YYVA 1ICFA 2GHUA 2JQGR 1MEGA 4CZWA 4PADA 1QMYA 2YJ2A 4XR7A 4FJCA 3BPMA 2DC9A 2PADA 4D8EA 4P16A 3KFQA 3V6EA 2FRAA 2PNSA 3AI8A 1YVBA 3OF9A 2FTDA 1POPA 4Q8GA 3BWKA 4G54A 1BY8A 3H8CA 1Q6KA 3IMAA 3QT4A 4P6EA 3F5VA 2R9CA
chains in the Genus database with same CATH topology
3N4CA 2ARYA 2HHNA 1F2BA 1DEUA 2VHSA 3I06A 2FT2A 1PPPA 1YALA 1VJVA 4GUZA 2FUDA 3CH2X 4FIPA 2OZ2A 3N3KA 1MS6A 4K7CA 3I3TA 4X6IA 2XU5A 2AIMA 3WXEA 1MDWA 3BOWA 4AXMA 2DC8A 2E03A 3E1ZB 2E01A 3H6SA 4CDDB 1TU6A 4BS5A 2ATOA 2VFBA 1CJLA 3LXSA 2HD5A 2HXZA 2WBFX 5EF4A 2BSZA 1EWMA 3CH3X 4W5CA 4KLBA 1AU3A 3C9EA 1FH0A 3OF8A 1Y4HA 2GFOA 4C5PA 1F2AA 4N79A 5CVOB 1E2TA 1HUCB 3LTWA 5F02A 2E00A 1PXVA 4QRVA 1NB3A 2AS8A 3HD3A 3DF0A 1U9WA 1YT7A 3KSEA 5K16A 3KX1A 2Y5BA 4MZOA 3MORA 2P0RA 4PP1A 4PP2E 5J94A 4BS6A 3D6SA 2C0YA 1AYUA 3ZUAA 3PW3A 1ATKA 1BQIA 2PREA 3HHIA 4DMYA 2YJCA 1SP4B 3RVXA 4RY2A 3WXGA 2B1NA 2F1GA 1VSNA 1QOLA 3V6CA 2CB5A 4FK5A 4OELA 1PIPA 5CHTA 2NQDB 3NHEA 1KXRA 1GX3A 1U9VA 3RVVA 4W5BA 1PPNA 3CBKA 1GCBA 3KW9A 2VHFA 3OVXA 1CS8A 4YYRA 1CSBB 4DMXA 1AU0A 2FYEA 4YYWA 2G6DA 1EWPA 1ITOA 3H8BA 3KKUA 2DC7A 5FPWA 3U8EA 2DCAA 3LFYA 1Y08A 2XU3A 2YJ8A 2OULA 2G8EA 4WA6A 4CDEB 1THEA 2DCDA 7PCKA 2R9FA 2H7JA 4MSXA 2IBIA 2AYNA 1PPDA 3WXFA 4OEMA 1CB5A 1STFE 3O0UA 1GECE 3S3QA 1AYWA 1ZIVA 3IUTA 1NPZA 4BGFA 2YJBA 2DCBA 5CVNB 3H89A 2R9MA 1EWOA 3H7DA 1O0EA 1CTEA 1JQPA 2DZYA 2F7DA 4YYSA 3BPFA 2BDZA 2CIOA 1PCIA 3BCNA 2DJFB 3K9MA 1DF0A 2PBHA 3IOQA 4XUIA 5CHVA 1NLJA 5EGWA 3QJ3A 4CDFB 3M99A 1BGOA 1QDQA 4PI3A 3K8UA 1KFUL 3F75A 1QXPA 5CVMA 8PCHA 4MZSA 2NQGA 2DZZA 2AUXA 3KWZA 3B79A 1AU2A 2HH5A 1GLOA 3RVWA 3IV2A 4B55A 1ME3A 2YJ9A 4YV8A 1NL6A 1YK8A 1U5IA 1CVZA 4HWYA 9PAPA 4YYQA 4YVAA 3K24A 3QSDA 1NB5A 2FO5A 1ME4A 1CQDA 1S4VA 3N3GA 2AUZA 1PBHA 2IPPB 2AYOA 2OP3A 3P5XA 3HWNA 3MHHA 2R9NA 2FRQA 2JQFR 2P86A 1AECA 4AXLA 1ZCMA 2AVWA 3P5WA 3PNRA 4YYUA 2DCCA 2P7UA 3GCBA 3O1GA 1A6RA 1GMYA 3P5VA 4P6GA 1MHWA 1MEMA 4BSQA 3USVA 1SNKA 1TL9A 1M6DA 3HHAA 2BDLA 1F2CA 4W4UA 1KHQA 4N4ZA 2Y6EA 2G8JA 2XU4A 4X6HA 2ACTA 1TLOA 1U9XA 2NQIA 6PADA 1U9QX 5JA7A 3IEJA 3S3RA 3MHSA 5A24A 2DJGB 2B1MA 3KWBX 2E02A 4BPVA 1KHPA 3ERVA 4CDCB 1X9YA 3IHPA 4QH6A 1AU4A 3TNXA 2G7YA 1W4TA 2NQAA 1EF7A 4QBBA 3P5UA 1KFXL 1XKGA 3BC3A 4QRGA 1YK7A 3PDFA 1MIRA 2FQ9A 1CPJA 1AIMA 2R9OA 1CV8A 1PADA 2R6NA 3CBJA 3OVZA 1BP4A 4QRXA 4NV8A 1PE6A 1NQCA 3MTNA 1K3BB 4I05A 4NV7A 2AU1A 5PADA 4ZUXU 4Q8HA 4I07A 1W6FA 3OISA 4N8WA 4BQVA 4X6JA 4I04A 1F29A 1IWDA 1PPOA 2VFCA 2DC6A 1EWLA 3D9WA 2XU1A 5JH3A 2O6XA 1AYVA 3PBHA 4YYVA 1ICFA 2GHUA 2JQGR 1MEGA 4CZWA 4PADA 1QMYA 1W5RA 2YJ2A 4XR7A 4FJCA 3BPMA 2DC9A 2PADA 3KFQA 3V6EA 2FRAA 2PNSA 3AI8A 1YVBA 3OF9A 2FTDA 1POPA 4Q8GA 3BWKA 4G54A 1BY8A 3H8CA 1Q6KA 3IMAA 3QT4A 4P6EA 3F5VA 2R9CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N4C A;  2ARY A;  2HHN A;  1F2B A;  1DEU A;  2VHS A;  3I06 A;  2FT2 A;  1PPP A;  1YAL A;  1VJV A;  2FUD A;  3CH2 X;  4FIP A;  2OZ2 A;  3N3K A;  1MS6 A;  4K7C A;  3I3T A;  4X6I A;  2XU5 A;  2AIM A;  3WXE A;  1MDW A;  3BOW A;  4AXM A;  2DC8 A;  2E03 A;  3E1Z B;  2E01 A;  3H6S A;  4CDD B;  1TU6 A;  4BS5 A;  2ATO A;  1CJL A;  3LXS A;  2HD5 A;  2HXZ A;  2WBF X;  5EF4 A;  1EWM A;  3CH3 X;  4W5C A;  4KLB A;  1AU3 A;  3C9E A;  1FH0 A;  3OF8 A;  1Y4H A;  2GFO A;  1F2A A;  4N79 A;  5CVO B;  1HUC B;  5F02 A;  2E00 A;  1PXV A;  4QRV A;  1NB3 A;  2AS8 A;  3HD3 A;  3DF0 A;  1U9W A;  1YT7 A;  3KSE A;  5K16 A;  3KX1 A;  2Y5B A;  4MZO A;  3MOR A;  2P0R A;  4PP1 A;  4PP2 E;  5J94 A;  4BS6 A;  3D6S A;  2C0Y A;  1AYU A;  3ZUA A;  3PW3 A;  1ATK A;  1BQI A;  2PRE A;  3HHI A;  4DMY A;  2YJC A;  1SP4 B;  3RVX A;  4RY2 A;  3WXG A;  2B1N A;  2F1G A;  1VSN A;  1QOL A;  3V6C A;  2CB5 A;  4FK5 A;  4OEL A;  1PIP A;  5CHT A;  2NQD B;  3NHE A;  1KXR A;  1U9V A;  3RVV A;  4W5B A;  1PPN A;  3CBK A;  1GCB A;  3KW9 A;  2VHF A;  3OVX A;  1CS8 A;  4YYR A;  1CSB B;  4DMX A;  1AU0 A;  2FYE A;  4YYW A;  2G6D A;  1EWP A;  1ITO A;  3H8B A;  3KKU A;  2DC7 A;  5FPW A;  3U8E A;  2DCA A;  3LFY A;  1Y08 A;  2XU3 A;  2YJ8 A;  2OUL A;  2G8E A;  4WA6 A;  4CDE B;  1THE A;  2DCD A;  7PCK A;  2R9F A;  2H7J A;  4MSX A;  2IBI A;  2AYN A;  1PPD A;  3WXF A;  4OEM A;  1CB5 A;  1STF E;  3O0U A;  1GEC E;  3S3Q A;  1AYW A;  1ZIV A;  3IUT A;  1NPZ A;  2YJB A;  2DCB A;  5CVN B;  3H89 A;  2R9M A;  1EWO A;  3H7D A;  1O0E A;  1CTE A;  1JQP A;  2DZY A;  2F7D A;  4YYS A;  3BPF A;  2BDZ A;  2CIO A;  1PCI A;  3BCN A;  2DJF B;  3K9M A;  1DF0 A;  2PBH A;  3IOQ A;  4XUI A;  5CHV A;  1NLJ A;  5EGW A;  3QJ3 A;  4CDF B;  3M99 A;  1BGO A;  1QDQ A;  4PI3 A;  3K8U A;  1KFU L;  3F75 A;  1QXP A;  5CVM A;  8PCH A;  4MZS A;  2NQG A;  2DZZ A;  2AUX A;  3KWZ A;  3B79 A;  1AU2 A;  2HH5 A;  1GLO A;  3RVW A;  3IV2 A;  1ME3 A;  2YJ9 A;  4YV8 A;  1NL6 A;  1YK8 A;  1U5I A;  1CVZ A;  4HWY A;  9PAP A;  4YYQ A;  4YVA A;  3K24 A;  3QSD A;  1NB5 A;  2FO5 A;  1ME4 A;  1CQD A;  1S4V A;  3N3G A;  2AUZ A;  1PBH A;  2IPP B;  2AYO A;  2OP3 A;  3P5X A;  3HWN A;  3MHH A;  2R9N A;  2FRQ A;  2JQF R;  2P86 A;  1AEC A;  4AXL A;  1ZCM A;  2AVW A;  3P5W A;  3PNR A;  4YYU A;  2DCC A;  2P7U A;  3GCB A;  3O1G A;  1A6R A;  1GMY A;  3P5V A;  4P6G A;  1MHW A;  1MEM A;  4BSQ A;  3USV A;  1SNK A;  1TL9 A;  1M6D A;  3HHA A;  2BDL A;  1F2C A;  4W4U A;  1KHQ A;  4N4Z A;  2Y6E A;  2G8J A;  2XU4 A;  4X6H A;  2ACT A;  1TLO A;  1U9X A;  2NQI A;  6PAD A;  1U9Q X;  5JA7 A;  3IEJ A;  3S3R A;  3MHS A;  5A24 A;  2DJG B;  2B1M A;  3KWB X;  2E02 A;  4BPV A;  1KHP A;  3ERV A;  4CDC B;  1X9Y A;  3IHP A;  4QH6 A;  1AU4 A;  3TNX A;  2G7Y A;  4QBB A;  2NQA A;  1EF7 A;  3P5U A;  1KFX L;  1XKG A;  3BC3 A;  4QRG A;  1YK7 A;  3PDF A;  1MIR A;  2FQ9 A;  1CPJ A;  1AIM A;  2R9O A;  1CV8 A;  1PAD A;  2R6N A;  3CBJ A;  3OVZ A;  1BP4 A;  4QRX A;  1PE6 A;  1NQC A;  3MTN A;  1K3B B;  4I05 A;  5PAD A;  2AU1 A;  4ZUX U;  4Q8H A;  4I07 A;  3OIS A;  4N8W A;  4BQV A;  4X6J A;  4I04 A;  1F29 A;  1IWD A;  1PPO A;  2DC6 A;  1EWL A;  2XU1 A;  5JH3 A;  2O6X A;  1AYV A;  3PBH A;  4YYV A;  1ICF A;  2GHU A;  2JQG R;  1MEG A;  4CZW A;  4PAD A;  1QMY A;  2YJ2 A;  4XR7 A;  4FJC A;  3BPM A;  2DC9 A;  2PAD A;  3KFQ A;  3V6E A;  2FRA A;  2PNS A;  3AI8 A;  1YVB A;  3OF9 A;  2FTD A;  1POP A;  4Q8G A;  3BWK A;  4G54 A;  1BY8 A;  3H8C A;  1Q6K A;  3IMA A;  3QT4 A;  4P6E A;  3F5V A;  2R9C A; 
#chains in the Genus database with same CATH topology
 3N4C A;  2ARY A;  2HHN A;  3PRP A;  1F2B A;  1DEU A;  2VHS A;  3I06 A;  2FT2 A;  4RF0 A;  1PPP A;  1YAL A;  1VJV A;  4HXD B;  2FUD A;  3PHU A;  3CH2 X;  4FIP A;  3MJ5 A;  5EZS A;  1YZB A;  2OZ2 A;  3N3K A;  1MS6 A;  4K7C A;  3I3T A;  4X6I A;  2XU5 A;  2AIM A;  3WXE A;  1MDW A;  3BOW A;  4AXM A;  2DC8 A;  4REZ A;  2E03 A;  3E1Z B;  2E01 A;  3H6S A;  4CDD B;  1TU6 A;  3ZNH A;  4BS5 A;  2ATO A;  1CJL A;  3LXS A;  2HD5 A;  2HXZ A;  2WBF X;  5EF4 A;  1EWM A;  3CH3 X;  4W5C A;  4KLB A;  1AU3 A;  3C9E A;  1FH0 A;  3OF8 A;  1Y4H A;  2J7Q C;  4BOU A;  2GFO A;  4XZX A;  2BTW B;  1F2A A;  4N79 A;  5CVO B;  1HUC B;  5EZQ A;  5F02 A;  2E00 A;  1PXV A;  4QRV A;  1NB3 A;  2AS8 A;  3HD3 A;  3DF0 A;  1U9W A;  1YT7 A;  3KSE A;  5K16 A;  3KX1 A;  2Y5B A;  4MZO A;  3MOR A;  2P0R A;  4BOP A;  4PP1 A;  4PP2 E;  5J94 A;  4BS6 A;  3D6S A;  2C0Y A;  1AYU A;  3ZUA A;  3PW3 A;  1DKI A;  1ATK A;  1BQI A;  2JRI A;  2PRE A;  2FE8 A;  3HHI A;  4BOZ A;  4DMY A;  3W31 A;  3MTV A;  3TRK A;  2YJC A;  1SP4 B;  3RVX A;  4RY2 A;  3WXG A;  2B1N A;  2F1G A;  1VSN A;  1QOL A;  3V6C A;  2CB5 A;  4FK5 A;  4OEL A;  1PIP A;  5CHT A;  3TMP A;  2BU3 A;  2NQD B;  4RF1 A;  3NHE A;  4OVZ A;  1KXR A;  1U9V A;  3RVV A;  4W5B A;  1PPN A;  3CBK A;  1PVJ A;  1GCB A;  4ZTB A;  3KW9 A;  2VHF A;  3OVX A;  4RKX A;  1CS8 A;  4YYR A;  1CSB B;  4DMX A;  1AU0 A;  2FYE A;  4D8I A;  4YYW A;  2AGA A;  4BOQ A;  2G6D A;  1EWP A;  1ITO A;  3H8B A;  3KKU A;  5E6J A;  2DC7 A;  5FPW A;  3U8E A;  2DCA A;  3LFY A;  1Y08 A;  2XU3 A;  2YJ8 A;  2OUL A;  2G8E A;  4WA6 A;  4CDE B;  1THE A;  4MI7 A;  2DCD A;  7PCK A;  2R9F A;  4RNA A;  2H7J A;  4MSX A;  2IBI A;  2AYN A;  1PPD A;  3WXF A;  4BOS A;  4A5U A;  4OEM A;  1CB5 A;  1STF E;  3O0U A;  1GEC E;  3S3Q A;  1AYW A;  1ZIV A;  3IUT A;  1NPZ A;  2DOS A;  2YJB A;  2DCB A;  5CVN B;  3H89 A;  3O65 A;  2R9M A;  1EWO A;  3H7D A;  1O0E A;  1CTE A;  1JQP A;  2DZY A;  2F7D A;  4YYS A;  3BPF A;  2BDZ A;  2CIO A;  1PCI A;  3BCN A;  2DJF B;  3K9M A;  1DF0 A;  2PBH A;  3IOQ A;  4XUI A;  5CHV A;  2J7Q A;  4OW0 A;  1NLJ A;  5EGW A;  3QJ3 A;  4CDF B;  3BY4 A;  3M99 A;  1BGO A;  1QDQ A;  4PI3 A;  3K8U A;  1KFU L;  3F75 A;  1QXP A;  5CVM A;  8PCH A;  3PHW A;  4MZS A;  3PT2 A;  2NQG A;  2DZZ A;  2AUX A;  3KWZ A;  3B79 A;  1AU2 A;  2HH5 A;  3BB7 A;  4M0W A;  4OVZ B;  1GLO A;  3RVW A;  3IV2 A;  1ME3 A;  2YJ9 A;  4YV8 A;  1NL6 A;  1YK8 A;  1U5I A;  1CVZ A;  3PRM A;  4HWY A;  9PAP A;  4YYQ A;  4YVA A;  3K24 A;  3QSD A;  1NB5 A;  2FO5 A;  1ME4 A;  1CQD A;  1S4V A;  3N3G A;  4MM3 B;  2JTC A;  2AUZ A;  1PBH A;  2IPP B;  3B21 A;  2AYO A;  2OP3 A;  3P5X A;  3HWN A;  3PHX A;  3MHH A;  2R9N A;  2FRQ A;  2JQF R;  4WUR A;  2P86 A;  1AEC A;  4AXL A;  1ZCM A;  2AVW A;  3P5W A;  4PT5 A;  3PNR A;  4R3D A;  4YYU A;  2DCC A;  2P7U A;  3GCB A;  3O1G A;  1A6R A;  1GMY A;  3P5V A;  4P6G A;  1MHW A;  1MEM A;  4BSQ A;  3USV A;  1SNK A;  1TL9 A;  1M6D A;  5JZE A;  5KO3 A;  3HHA A;  2BDL A;  1F2C A;  1UKF A;  4W4U A;  1KHQ A;  3BBA A;  4N4Z A;  2Y6E A;  2G8J A;  2XU4 A;  4IUM A;  4X6H A;  3OQC A;  2ACT A;  1TLO A;  4GUA A;  1U9X A;  2NQI A;  4IP3 A;  6PAD A;  1U9Q X;  3C0R A;  5JA7 A;  3IEJ A;  3S3R A;  3MHS A;  5A24 A;  2DJG B;  2B1M A;  3KWB X;  2E02 A;  4BPV A;  1KHP A;  3ERV A;  4CDC B;  3RNV A;  1X9Y A;  3IHP A;  4QH6 A;  1AU4 A;  3TNX A;  2G7Y A;  2UZJ A;  4QBB A;  2NQA A;  1EF7 A;  3P5U A;  1KFX L;  1XKG A;  3BC3 A;  4QRG A;  1YK7 A;  3PDF A;  3PSE A;  3W30 A;  1MIR A;  2FQ9 A;  1CPJ A;  1AIM A;  2R9O A;  1CV8 A;  1PAD A;  2R6N A;  3CBJ A;  3OVZ A;  1BP4 A;  4QRX A;  2HWK A;  1PE6 A;  1NQC A;  3MTN A;  2Z84 A;  1K3B B;  4I05 A;  5PAD A;  2AU1 A;  4ZUX U;  4Q8H A;  4D8B A;  4I07 A;  3OIS A;  4N8W A;  2BTW A;  3IFU A;  4BQV A;  4X6J A;  3E9S A;  4I04 A;  1F29 A;  3MP2 A;  1IWD A;  1PPO A;  2DC6 A;  1EWL A;  2XU1 A;  5JH3 A;  2O6X A;  1AYV A;  3PBH A;  4YYV A;  1ICF A;  2GHU A;  2JQG R;  1MEG A;  4CZW A;  4PAD A;  1QMY A;  2YJ2 A;  4XR7 A;  4FJC A;  3BPM A;  2DC9 A;  2PAD A;  4D8E A;  4P16 A;  3KFQ A;  3V6E A;  2FRA A;  2PNS A;  3AI8 A;  1YVB A;  3OF9 A;  2FTD A;  1POP A;  4Q8G A;  3BWK A;  4G54 A;  1BY8 A;  3H8C A;  1Q6K A;  3IMA A;  3QT4 A;  4P6E A;  3F5V A;  2R9C A; 
#chains in the Genus database with same CATH homology
 3N4C A;  2ARY A;  2HHN A;  1F2B A;  1DEU A;  2VHS A;  3I06 A;  2FT2 A;  1PPP A;  1YAL A;  1VJV A;  4GUZ A;  2FUD A;  3CH2 X;  4FIP A;  2OZ2 A;  3N3K A;  1MS6 A;  4K7C A;  3I3T A;  4X6I A;  2XU5 A;  2AIM A;  3WXE A;  1MDW A;  3BOW A;  4AXM A;  2DC8 A;  2E03 A;  3E1Z B;  2E01 A;  3H6S A;  4CDD B;  1TU6 A;  4BS5 A;  2ATO A;  2VFB A;  1CJL A;  3LXS A;  2HD5 A;  2HXZ A;  2WBF X;  5EF4 A;  2BSZ A;  1EWM A;  3CH3 X;  4W5C A;  4KLB A;  1AU3 A;  3C9E A;  1FH0 A;  3OF8 A;  1Y4H A;  2GFO A;  4C5P A;  1F2A A;  4N79 A;  5CVO B;  1E2T A;  1HUC B;  3LTW A;  5F02 A;  2E00 A;  1PXV A;  4QRV A;  1NB3 A;  2AS8 A;  3HD3 A;  3DF0 A;  1U9W A;  1YT7 A;  3KSE A;  5K16 A;  3KX1 A;  2Y5B A;  4MZO A;  3MOR A;  2P0R A;  4PP1 A;  4PP2 E;  5J94 A;  4BS6 A;  3D6S A;  2C0Y A;  1AYU A;  3ZUA A;  3PW3 A;  1ATK A;  1BQI A;  2PRE A;  3HHI A;  4DMY A;  2YJC A;  1SP4 B;  3RVX A;  4RY2 A;  3WXG A;  2B1N A;  2F1G A;  1VSN A;  1QOL A;  3V6C A;  2CB5 A;  4FK5 A;  4OEL A;  1PIP A;  5CHT A;  2NQD B;  3NHE A;  1KXR A;  1GX3 A;  1U9V A;  3RVV A;  4W5B A;  1PPN A;  3CBK A;  1GCB A;  3KW9 A;  2VHF A;  3OVX A;  1CS8 A;  4YYR A;  1CSB B;  4DMX A;  1AU0 A;  2FYE A;  4YYW A;  2G6D A;  1EWP A;  1ITO A;  3H8B A;  3KKU A;  2DC7 A;  5FPW A;  3U8E A;  2DCA A;  3LFY A;  1Y08 A;  2XU3 A;  2YJ8 A;  2OUL A;  2G8E A;  4WA6 A;  4CDE B;  1THE A;  2DCD A;  7PCK A;  2R9F A;  2H7J A;  4MSX A;  2IBI A;  2AYN A;  1PPD A;  3WXF A;  4OEM A;  1CB5 A;  1STF E;  3O0U A;  1GEC E;  3S3Q A;  1AYW A;  1ZIV A;  3IUT A;  1NPZ A;  4BGF A;  2YJB A;  2DCB A;  5CVN B;  3H89 A;  2R9M A;  1EWO A;  3H7D A;  1O0E A;  1CTE A;  1JQP A;  2DZY A;  2F7D A;  4YYS A;  3BPF A;  2BDZ A;  2CIO A;  1PCI A;  3BCN A;  2DJF B;  3K9M A;  1DF0 A;  2PBH A;  3IOQ A;  4XUI A;  5CHV A;  1NLJ A;  5EGW A;  3QJ3 A;  4CDF B;  3M99 A;  1BGO A;  1QDQ A;  4PI3 A;  3K8U A;  1KFU L;  3F75 A;  1QXP A;  5CVM A;  8PCH A;  4MZS A;  2NQG A;  2DZZ A;  2AUX A;  3KWZ A;  3B79 A;  1AU2 A;  2HH5 A;  1GLO A;  3RVW A;  3IV2 A;  4B55 A;  1ME3 A;  2YJ9 A;  4YV8 A;  1NL6 A;  1YK8 A;  1U5I A;  1CVZ A;  4HWY A;  9PAP A;  4YYQ A;  4YVA A;  3K24 A;  3QSD A;  1NB5 A;  2FO5 A;  1ME4 A;  1CQD A;  1S4V A;  3N3G A;  2AUZ A;  1PBH A;  2IPP B;  2AYO A;  2OP3 A;  3P5X A;  3HWN A;  3MHH A;  2R9N A;  2FRQ A;  2JQF R;  2P86 A;  1AEC A;  4AXL A;  1ZCM A;  2AVW A;  3P5W A;  3PNR A;  4YYU A;  2DCC A;  2P7U A;  3GCB A;  3O1G A;  1A6R A;  1GMY A;  3P5V A;  4P6G A;  1MHW A;  1MEM A;  4BSQ A;  3USV A;  1SNK A;  1TL9 A;  1M6D A;  3HHA A;  2BDL A;  1F2C A;  4W4U A;  1KHQ A;  4N4Z A;  2Y6E A;  2G8J A;  2XU4 A;  4X6H A;  2ACT A;  1TLO A;  1U9X A;  2NQI A;  6PAD A;  1U9Q X;  5JA7 A;  3IEJ A;  3S3R A;  3MHS A;  5A24 A;  2DJG B;  2B1M A;  3KWB X;  2E02 A;  4BPV A;  1KHP A;  3ERV A;  4CDC B;  1X9Y A;  3IHP A;  4QH6 A;  1AU4 A;  3TNX A;  2G7Y A;  1W4T A;  2NQA A;  1EF7 A;  4QBB A;  3P5U A;  1KFX L;  1XKG A;  3BC3 A;  4QRG A;  1YK7 A;  3PDF A;  1MIR A;  2FQ9 A;  1CPJ A;  1AIM A;  2R9O A;  1CV8 A;  1PAD A;  2R6N A;  3CBJ A;  3OVZ A;  1BP4 A;  4QRX A;  4NV8 A;  1PE6 A;  1NQC A;  3MTN A;  1K3B B;  4I05 A;  4NV7 A;  2AU1 A;  5PAD A;  4ZUX U;  4Q8H A;  4I07 A;  1W6F A;  3OIS A;  4N8W A;  4BQV A;  4X6J A;  4I04 A;  1F29 A;  1IWD A;  1PPO A;  2VFC A;  2DC6 A;  1EWL A;  3D9W A;  2XU1 A;  5JH3 A;  2O6X A;  1AYV A;  3PBH A;  4YYV A;  1ICF A;  2GHU A;  2JQG R;  1MEG A;  4CZW A;  4PAD A;  1QMY A;  1W5R A;  2YJ2 A;  4XR7 A;  4FJC A;  3BPM A;  2DC9 A;  2PAD A;  3KFQ A;  3V6E A;  2FRA A;  2PNS A;  3AI8 A;  1YVB A;  3OF9 A;  2FTD A;  1POP A;  4Q8G A;  3BWK A;  4G54 A;  1BY8 A;  3H8C A;  1Q6K A;  3IMA A;  3QT4 A;  4P6E A;  3F5V A;  2R9C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...