1QDQA

X-ray crystal structure of bovine cathepsin b-ca074 complex
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
253
structure length
251
Chain Sequence
LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHSNVNVEVSAEDMLTCCGGECGDGCNGGEPSGAWNFWTKKGLVSGGLYNSHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEIVAGMPCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CATHEPSIN B
publication title Substrate specificity of bovine cathepsin B and its inhibition by CA074, based on crystal structure refinement of the complex.
pubmed rcsb
total genus 76
structure length 251
sequence length 253
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 1999-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1qdqA00
2P0RA 3QJ3A 2IBIA 1NPZA 3RVWA 5JH3A 1EWLA 1QDQA 2YJ9A 4I07A 4BQVA 1ATKA 4G54A 3PW3A 1THEA 2E01A 1EWOA 2BDZA 4BPVA 3WXEA 4PI3A 1MEMA 2HHNA 2YJBA 3I3TA 1BQIA 1KHQA 4X6HA 3MHSA 2B1NA 1TLOA 1FH0A 4CDDB 1CV8A 4DMYA 4PP2E 1TU6A 2E00A 4YYQA 4P6EA 4P6GA 1MDWA 3KW9A 1U5IA 2GHUA 2HD5A 4MZSA 1NB5A 3IEJA 2XU3A 1AU3A 4W5CA 1PXVA 1KFUL 3N3KA 2AYNA 1MEGA 2DCBA 4N8WA 2AVWA 2O6XA 4DMXA 3OF9A 2R9FA 4WA6A 2FUDA 3M99A 1IWDA 3MORA 3KFQA 4KLBA 1YALA 1QMYA 2BDLA 3RVXA 4XUIA 3AI8A 3H8BA 1Y4HA 1SNKA 4QRXA 2G8EA 3IUTA 1GLOA 2AUZA 3HHAA 1GMYA 5CVOB 2DJGB 2R6NA 3K8UA 3ZUAA 3P5UA 2PREA 1TL9A 2AUXA 2AIMA 3BWKA 4W5BA 1POPA 4Q8HA 1DF0A 1HUCB 5FPWA 3S3QA 2P86A 3IHPA 2XU4A 2E02A 3QT4A 1F2BA 3O1GA 3B79A 4I04A 2FRQA 2YJCA 1EF7A 2R9NA 2GFOA 4OEMA 1AIMA 3PDFA 4AXLA 1CTEA 1MIRA 2OP3A 1AU4A 1NLJA 3BC3A 2DC7A 4BS5A 1M6DA 4YYRA 1CQDA 1KXRA 3HWNA 9PAPA 3DF0A 1NL6A 1QOLA 2XU1A 4RY2A 1EWMA 1AYVA 4CZWA 1ZCMA 3MHHA 7PCKA 1AYUA 1KFXL 4BSQA 1STFE 3CH2X 1ME4A 3HHIA 2Y6EA 4PADA 4OELA 3OVXA 1CJLA 1PPDA 3K24A 3BPFA 1PPOA 3OF8A 1BY8A 1SP4B 2NQIA 2VHFA 3IMAA 1O0EA 2OZ2A 2DZYA 4MSXA 2FO5A 3F75A 1CSBB 2FRAA 1Q6KA 1Y08A 3KKUA 1GECE 1PPPA 1PE6A 1ZIVA 5A24A 3D6SA 3PBHA 1QXPA 4YVAA 1VJVA 2YJ2A 3K9MA 2ACTA 1ITOA 2DC8A 2FTDA 1PIPA 1PPNA 4QRGA 2PNSA 1YVBA 1U9XA 4YYWA 3WXGA 1VSNA 3ERVA 4CDCB 3NHEA 3P5XA 4FJCA 2DCAA 3MTNA 2C0YA 1XKGA 3N3GA 2H7JA 4FIPA 4YYVA 3BPMA 1PCIA 8PCHA 5CHTA 2R9OA 3E1ZB 4CDEB 4YV8A 3C9EA 4Q8GA 2PADA 4AXMA 2WBFX 1MHWA 1YT7A 6PADA 3LFYA 2B1MA 1U9VA 1S4VA 2P7UA 3IOQA 4N79A 5F02A 3KWZA 1F29A 2G8JA 1ICFA 2XU5A 3KSEA 3WXFA 2DC6A 2FQ9A 4BS6A 1NQCA 4MZOA 2IPPB 3P5VA 2F1GA 1U9QX 2NQAA 4X6JA 2NQDB 3V6CA 2PBHA 1DEUA 2CIOA 3F5VA 1AYWA 1K3BB 1AU0A 2F7DA 5EGWA 1PBHA 1GCBA 2JQFR 3I06A 1U9WA 3BCNA 1CPJA 1X9YA 1MS6A 2JQGR 4QBBA 4FK5A 3USVA 2FYEA 3H7DA 4PP1A 3BOWA 3O0UA 5J94A 2ATOA 1A6RA 1AU2A 2G7YA 4N4ZA 2NQGA 4YYSA 5JA7A 3KX1A 3PNRA 2VHSA 1F2AA 2FT2A 3IV2A 1KHPA 3QSDA 5CHVA 1NB3A 1PADA 3H8CA 3V6EA 2DC9A 2DZZA 2AYOA 3HD3A 2G6DA 5CVMA 1CS8A 4QH6A 3U8EA 1EWPA 4ZUXU 2OULA 3CBKA 4K7CA 3CH3X 3N4CA 3KWBX 2DCCA 2E03A 2AS8A 4HWYA 3H89A 3OISA 1BGOA 5PADA 2YJ8A 4CDFB 2ARYA 1YK7A 3GCBA 4QRVA 4XR7A 1CVZA 2DCDA 2HXZA 3P5WA 4X6IA 4I05A 5CVNB 2Y5BA 1BP4A 2HH5A 3RVVA 1ME3A 2DJFB 3LXSA 2CB5A 2R9MA 2R9CA 1AECA 2AU1A 3CBJA 3S3RA 1YK8A 4W4UA 1CB5A 4YYUA 1JQPA 5EF4A 5K16A 3OVZA 1F2CA 3H6SA 3TNXA
chains in the Genus database with same CATH superfamily
2P0RA 3QJ3A 4IP3A 2IBIA 1NPZA 3RVWA 5JH3A 1EWLA 2Z84A 1QDQA 3BBAA 2YJ9A 4I07A 4BQVA 1ATKA 4G54A 3PW3A 1THEA 2E01A 3RNVA 1EWOA 2BDZA 2JRIA 4BPVA 2J7QA 3WXEA 4PI3A 1MEMA 2HHNA 2YJBA 3I3TA 1BQIA 1KHQA 2HWKA 4P16A 4X6HA 3MHSA 2B1NA 1TLOA 1FH0A 4CDDB 1CV8A 4DMYA 4PP2E 1TU6A 2E00A 5KO3A 4YYQA 3MJ5A 4P6EA 4P6GA 1MDWA 4IUMA 3KW9A 1U5IA 2GHUA 2HD5A 2JTCA 4R3DA 4MZSA 1NB5A 3B21A 3IEJA 2XU3A 1AU3A 4W5CA 1PXVA 1KFUL 3N3KA 2AYNA 4HXDB 1MEGA 2DCBA 4N8WA 2AVWA 2O6XA 4DMXA 3OF9A 2R9FA 4WA6A 2FUDA 3M99A 1IWDA 3MORA 3KFQA 4KLBA 2BTWB 3TMPA 3MP2A 1YALA 1QMYA 2BDLA 1PVJA 3RVXA 4XUIA 1UKFA 3AI8A 3H8BA 1Y4HA 1SNKA 4QRXA 2G8EA 3IUTA 1GLOA 2AUZA 3HHAA 1GMYA 5CVOB 2DJGB 2DOSA 2R6NA 3K8UA 3ZUAA 3P5UA 2PREA 1TL9A 2AUXA 2AIMA 3BWKA 4W5BA 3PRMA 4PT5A 1POPA 4Q8HA 1DF0A 1HUCB 5FPWA 3S3QA 2P86A 3IHPA 3W31A 2XU4A 2E02A 3QT4A 1F2BA 3O1GA 3B79A 4I04A 2FRQA 2YJCA 1EF7A 2R9NA 4ZTBA 3PT2A 2GFOA 4OEMA 1AIMA 3PDFA 4AXLA 2OP3A 1CTEA 1MIRA 1AU4A 1NLJA 3BC3A 2DC7A 4BS5A 1M6DA 4YYRA 1CQDA 1KXRA 3HWNA 9PAPA 3DF0A 1NL6A 1QOLA 2XU1A 4RY2A 4A5UA 1EWMA 1AYVA 4CZWA 1ZCMA 3MHHA 7PCKA 3PRPA 1AYUA 1KFXL 4MI7A 2FE8A 4BSQA 1STFE 3CH2X 4XZXA 2BU3A 3OQCA 1ME4A 3HHIA 2Y6EA 4PADA 4BOQA 4OELA 3OVXA 1CJLA 1PPDA 3K24A 3BPFA 1PPOA 3OF8A 1BY8A 4GUAA 1SP4B 2NQIA 2VHFA 3IMAA 1DKIA 1O0EA 2OZ2A 2DZYA 2AGAA 4MSXA 3BY4A 2FO5A 3F75A 1CSBB 2FRAA 1Q6KA 1Y08A 3KKUA 5EZQA 1GECE 1PPPA 1PE6A 1ZIVA 5A24A 4BOUA 3D6SA 3PBHA 1QXPA 4YVAA 1VJVA 2YJ2A 3K9MA 2ACTA 1ITOA 2DC8A 2FTDA 1PIPA 3O65A 1PPNA 4QRGA 2PNSA 1YVBA 1U9XA 4YYWA 3W30A 3WXGA 1VSNA 3ERVA 3PHXA 4CDCB 3NHEA 3P5XA 4FJCA 2DCAA 3MTNA 2C0YA 1XKGA 3N3GA 2H7JA 4FIPA 4YYVA 3BPMA 1PCIA 8PCHA 4M0WA 5CHTA 2R9OA 3BB7A 4OVZA 3E1ZB 4CDEB 4YV8A 3C9EA 4BOSA 4Q8GA 2PADA 4AXMA 2WBFX 1MHWA 1YT7A 6PADA 3LFYA 2B1MA 1U9VA 1S4VA 2P7UA 4BOPA 3IOQA 4WURA 3PSEA 4N79A 5F02A 4RF1A 3KWZA 1F29A 2G8JA 1ICFA 2XU5A 3KSEA 3WXFA 4D8BA 2DC6A 2FQ9A 4BS6A 1NQCA 4MZOA 2IPPB 3P5VA 4OW0A 2F1GA 3ZNHA 4D8IA 3MTVA 1U9QX 2NQAA 4MM3B 4X6JA 2NQDB 3V6CA 4D8EA 2PBHA 1DEUA 2CIOA 3F5VA 1AYWA 1K3BB 4RNAA 1AU0A 2F7DA 5EGWA 5EZSA 3PHWA 1PBHA 1GCBA 2JQFR 3I06A 1U9WA 3BCNA 1CPJA 1X9YA 1MS6A 2JQGR 4QBBA 4FK5A 3USVA 2FYEA 3H7DA 4PP1A 3BOWA 3O0UA 5J94A 2ATOA 1A6RA 1AU2A 2G7YA 3IFUA 4N4ZA 2NQGA 4YYSA 5JA7A 3KX1A 4RKXA 3PNRA 2VHSA 1F2AA 3E9SA 2FT2A 2UZJA 3IV2A 1KHPA 3QSDA 5CHVA 1NB3A 1PADA 3H8CA 3V6EA 2DC9A 2DZZA 2AYOA 3HD3A 2G6DA 5CVMA 1CS8A 4QH6A 3U8EA 1EWPA 4ZUXU 5E6JA 2OULA 3CBKA 4OVZB 4K7CA 4BOZA 3CH3X 3N4CA 3KWBX 2DCCA 2E03A 2AS8A 2BTWA 4HWYA 5JZEA 3H89A 3OISA 1BGOA 5PADA 1YZBA 2YJ8A 2J7QC 4CDFB 2ARYA 1YK7A 3GCBA 4QRVA 4XR7A 1CVZA 2DCDA 3C0RA 2HXZA 3P5WA 4X6IA 4I05A 5CVNB 2Y5BA 3TRKA 1BP4A 2HH5A 4RF0A 3RVVA 1ME3A 2DJFB 3LXSA 2CB5A 2R9MA 2R9CA 1AECA 2AU1A 3CBJA 3S3RA 1YK8A 4W4UA 1CB5A 4YYUA 1JQPA 5EF4A 3PHUA 5K16A 3OVZA 1F2CA 3H6SA 3TNXA 4REZA
chains in the Genus database with same CATH topology
2P0RA 3QJ3A 2IBIA 1NPZA 2VFCA 3RVWA 5JH3A 1EWLA 1QDQA 2YJ9A 4I07A 4BQVA 1ATKA 4G54A 3PW3A 1THEA 2E01A 1EWOA 2BDZA 4BPVA 3WXEA 4PI3A 1MEMA 2HHNA 2YJBA 3I3TA 1BQIA 1KHQA 4X6HA 3MHSA 2B1NA 1TLOA 1FH0A 4CDDB 1CV8A 4DMYA 4PP2E 1TU6A 2E00A 4YYQA 4P6EA 4P6GA 1MDWA 3KW9A 1U5IA 2GHUA 2HD5A 4MZSA 1NB5A 3IEJA 2XU3A 1AU3A 4W5CA 1PXVA 1KFUL 3N3KA 2AYNA 1MEGA 2DCBA 4N8WA 2AVWA 2O6XA 4DMXA 3OF9A 2R9FA 4WA6A 2FUDA 4BGFA 3M99A 1IWDA 3MORA 3KFQA 4KLBA 1YALA 1QMYA 2BDLA 3RVXA 4XUIA 3AI8A 3H8BA 1Y4HA 1SNKA 4QRXA 2G8EA 3IUTA 1GLOA 2AUZA 3HHAA 1GMYA 5CVOB 2DJGB 2R6NA 3K8UA 3ZUAA 3P5UA 2PREA 1TL9A 2AUXA 2AIMA 3BWKA 4W5BA 1POPA 4Q8HA 1DF0A 1HUCB 5FPWA 3S3QA 2P86A 3IHPA 2XU4A 2E02A 3QT4A 1F2BA 3O1GA 3B79A 4I04A 2FRQA 2YJCA 1EF7A 1W5RA 2R9NA 2GFOA 4OEMA 1AIMA 3PDFA 1GX3A 4AXLA 1CTEA 1MIRA 2OP3A 1AU4A 1NLJA 3BC3A 2DC7A 4BS5A 1M6DA 4YYRA 1CQDA 1KXRA 3HWNA 9PAPA 3DF0A 1NL6A 1QOLA 2XU1A 4RY2A 1EWMA 1AYVA 4CZWA 4C5PA 1ZCMA 3MHHA 7PCKA 1AYUA 1KFXL 4NV7A 4BSQA 1STFE 3CH2X 1ME4A 3HHIA 4NV8A 2Y6EA 4PADA 4OELA 3OVXA 1CJLA 1PPDA 3K24A 3BPFA 1PPOA 3OF8A 1BY8A 1SP4B 2NQIA 2VHFA 3IMAA 1O0EA 2OZ2A 2DZYA 4MSXA 3LTWA 2FO5A 3F75A 1CSBB 2FRAA 1Q6KA 1Y08A 3KKUA 1GECE 1PPPA 1PE6A 1ZIVA 5A24A 3D6SA 3PBHA 1QXPA 4YVAA 1VJVA 2BSZA 2YJ2A 3K9MA 2ACTA 1ITOA 2DC8A 2FTDA 4GUZA 1PIPA 1PPNA 4QRGA 2PNSA 1YVBA 1U9XA 4YYWA 3WXGA 1VSNA 1E2TA 3ERVA 4CDCB 3NHEA 3P5XA 4FJCA 2DCAA 3MTNA 2C0YA 1XKGA 3N3GA 2H7JA 4FIPA 4YYVA 3BPMA 1PCIA 4B55A 8PCHA 5CHTA 2R9OA 3E1ZB 4CDEB 4YV8A 3C9EA 4Q8GA 2PADA 4AXMA 2WBFX 1MHWA 1YT7A 6PADA 3LFYA 2B1MA 1U9VA 1S4VA 2P7UA 1W4TA 3IOQA 4N79A 5F02A 3KWZA 1F29A 2G8JA 1ICFA 2XU5A 3KSEA 3WXFA 2DC6A 2FQ9A 4BS6A 1NQCA 4MZOA 2IPPB 3P5VA 2F1GA 1U9QX 2NQAA 4X6JA 2NQDB 3V6CA 2PBHA 1DEUA 2CIOA 3F5VA 1AYWA 1K3BB 1AU0A 2F7DA 5EGWA 1PBHA 1GCBA 2JQFR 3I06A 1U9WA 3BCNA 1CPJA 1X9YA 1MS6A 2JQGR 2VFBA 4FK5A 4QBBA 3USVA 2FYEA 3H7DA 4PP1A 3BOWA 3O0UA 5J94A 2ATOA 1A6RA 1AU2A 2G7YA 4N4ZA 2NQGA 4YYSA 5JA7A 3KX1A 3PNRA 2VHSA 1F2AA 2FT2A 3IV2A 1KHPA 3QSDA 5CHVA 1NB3A 1PADA 3H8CA 3V6EA 2DC9A 2DZZA 2AYOA 3HD3A 2G6DA 5CVMA 1CS8A 4QH6A 3U8EA 1EWPA 4ZUXU 2OULA 3CBKA 4K7CA 3CH3X 3N4CA 3KWBX 2DCCA 2E03A 2AS8A 4HWYA 3H89A 3OISA 1BGOA 5PADA 2YJ8A 4CDFB 2ARYA 1YK7A 3GCBA 4QRVA 4XR7A 1CVZA 2DCDA 2HXZA 3P5WA 4X6IA 4I05A 5CVNB 2Y5BA 1BP4A 2HH5A 3RVVA 1ME3A 2DJFB 3LXSA 2CB5A 2R9MA 2R9CA 1AECA 2AU1A 3CBJA 3S3RA 1YK8A 4W4UA 1W6FA 1CB5A 3D9WA 4YYUA 1JQPA 5EF4A 5K16A 3OVZA 1F2CA 3H6SA 3TNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0R A;  3QJ3 A;  2IBI A;  1NPZ A;  3RVW A;  5JH3 A;  1EWL A;  1QDQ A;  2YJ9 A;  4I07 A;  4BQV A;  1ATK A;  4G54 A;  3PW3 A;  1THE A;  2E01 A;  1EWO A;  2BDZ A;  4BPV A;  3WXE A;  4PI3 A;  1MEM A;  2HHN A;  2YJB A;  3I3T A;  1BQI A;  1KHQ A;  4X6H A;  3MHS A;  2B1N A;  1TLO A;  1FH0 A;  4CDD B;  1CV8 A;  4DMY A;  4PP2 E;  1TU6 A;  2E00 A;  4YYQ A;  4P6E A;  4P6G A;  1MDW A;  3KW9 A;  1U5I A;  2GHU A;  2HD5 A;  4MZS A;  1NB5 A;  3IEJ A;  2XU3 A;  1AU3 A;  4W5C A;  1PXV A;  1KFU L;  3N3K A;  2AYN A;  1MEG A;  2DCB A;  4N8W A;  2AVW A;  2O6X A;  4DMX A;  3OF9 A;  2R9F A;  4WA6 A;  2FUD A;  3M99 A;  1IWD A;  3MOR A;  3KFQ A;  4KLB A;  1YAL A;  1QMY A;  2BDL A;  3RVX A;  4XUI A;  3AI8 A;  3H8B A;  1Y4H A;  1SNK A;  4QRX A;  2G8E A;  3IUT A;  1GLO A;  2AUZ A;  3HHA A;  1GMY A;  5CVO B;  2DJG B;  2R6N A;  3K8U A;  3ZUA A;  3P5U A;  2PRE A;  1TL9 A;  2AUX A;  2AIM A;  3BWK A;  4W5B A;  1POP A;  4Q8H A;  1DF0 A;  1HUC B;  5FPW A;  3S3Q A;  2P86 A;  3IHP A;  2XU4 A;  2E02 A;  3QT4 A;  1F2B A;  3O1G A;  3B79 A;  4I04 A;  2FRQ A;  2YJC A;  1EF7 A;  2R9N A;  2GFO A;  4OEM A;  1AIM A;  3PDF A;  4AXL A;  1CTE A;  1MIR A;  2OP3 A;  1AU4 A;  1NLJ A;  3BC3 A;  2DC7 A;  4BS5 A;  1M6D A;  4YYR A;  1CQD A;  1KXR A;  3HWN A;  9PAP A;  3DF0 A;  1NL6 A;  1QOL A;  2XU1 A;  4RY2 A;  1EWM A;  1AYV A;  4CZW A;  1ZCM A;  3MHH A;  7PCK A;  1AYU A;  1KFX L;  4BSQ A;  1STF E;  3CH2 X;  1ME4 A;  3HHI A;  2Y6E A;  4PAD A;  4OEL A;  3OVX A;  1CJL A;  1PPD A;  3K24 A;  3BPF A;  1PPO A;  3OF8 A;  1BY8 A;  1SP4 B;  2NQI A;  2VHF A;  3IMA A;  1O0E A;  2OZ2 A;  2DZY A;  4MSX A;  2FO5 A;  3F75 A;  1CSB B;  2FRA A;  1Q6K A;  1Y08 A;  3KKU A;  1GEC E;  1PPP A;  1PE6 A;  1ZIV A;  5A24 A;  3D6S A;  3PBH A;  1QXP A;  4YVA A;  1VJV A;  2YJ2 A;  3K9M A;  2ACT A;  1ITO A;  2DC8 A;  2FTD A;  1PIP A;  1PPN A;  4QRG A;  2PNS A;  1YVB A;  1U9X A;  4YYW A;  3WXG A;  1VSN A;  3ERV A;  4CDC B;  3NHE A;  3P5X A;  4FJC A;  2DCA A;  3MTN A;  2C0Y A;  1XKG A;  3N3G A;  2H7J A;  4FIP A;  4YYV A;  3BPM A;  1PCI A;  8PCH A;  5CHT A;  2R9O A;  3E1Z B;  4CDE B;  4YV8 A;  3C9E A;  4Q8G A;  2PAD A;  4AXM A;  2WBF X;  1MHW A;  1YT7 A;  6PAD A;  3LFY A;  2B1M A;  1U9V A;  1S4V A;  2P7U A;  3IOQ A;  4N79 A;  5F02 A;  3KWZ A;  1F29 A;  2G8J A;  1ICF A;  2XU5 A;  3KSE A;  3WXF A;  2DC6 A;  2FQ9 A;  4BS6 A;  1NQC A;  4MZO A;  2IPP B;  3P5V A;  2F1G A;  1U9Q X;  2NQA A;  4X6J A;  2NQD B;  3V6C A;  2PBH A;  1DEU A;  2CIO A;  3F5V A;  1AYW A;  1K3B B;  1AU0 A;  2F7D A;  5EGW A;  1PBH A;  1GCB A;  2JQF R;  3I06 A;  1U9W A;  3BCN A;  1CPJ A;  1X9Y A;  1MS6 A;  2JQG R;  4QBB A;  4FK5 A;  3USV A;  2FYE A;  3H7D A;  4PP1 A;  3BOW A;  3O0U A;  5J94 A;  2ATO A;  1A6R A;  1AU2 A;  2G7Y A;  4N4Z A;  2NQG A;  4YYS A;  5JA7 A;  3KX1 A;  3PNR A;  2VHS A;  1F2A A;  2FT2 A;  3IV2 A;  1KHP A;  3QSD A;  5CHV A;  1NB3 A;  1PAD A;  3H8C A;  3V6E A;  2DC9 A;  2DZZ A;  2AYO A;  3HD3 A;  2G6D A;  5CVM A;  1CS8 A;  4QH6 A;  3U8E A;  1EWP A;  4ZUX U;  2OUL A;  3CBK A;  4K7C A;  3CH3 X;  3N4C A;  3KWB X;  2DCC A;  2E03 A;  2AS8 A;  4HWY A;  3H89 A;  3OIS A;  1BGO A;  5PAD A;  2YJ8 A;  4CDF B;  2ARY A;  1YK7 A;  3GCB A;  4QRV A;  4XR7 A;  1CVZ A;  2DCD A;  2HXZ A;  3P5W A;  4X6I A;  4I05 A;  5CVN B;  2Y5B A;  1BP4 A;  2HH5 A;  3RVV A;  1ME3 A;  2DJF B;  3LXS A;  2CB5 A;  2R9M A;  2R9C A;  1AEC A;  2AU1 A;  3CBJ A;  3S3R A;  1YK8 A;  4W4U A;  1CB5 A;  4YYU A;  1JQP A;  5EF4 A;  5K16 A;  3OVZ A;  1F2C A;  3H6S A;  3TNX A; 
#chains in the Genus database with same CATH topology
 2P0R A;  3QJ3 A;  4IP3 A;  2IBI A;  1NPZ A;  3RVW A;  5JH3 A;  1EWL A;  2Z84 A;  1QDQ A;  3BBA A;  2YJ9 A;  4I07 A;  4BQV A;  1ATK A;  4G54 A;  3PW3 A;  1THE A;  2E01 A;  3RNV A;  1EWO A;  2BDZ A;  2JRI A;  4BPV A;  2J7Q A;  3WXE A;  4PI3 A;  1MEM A;  2HHN A;  2YJB A;  3I3T A;  1BQI A;  1KHQ A;  2HWK A;  4P16 A;  4X6H A;  3MHS A;  2B1N A;  1TLO A;  1FH0 A;  4CDD B;  1CV8 A;  4DMY A;  4PP2 E;  1TU6 A;  2E00 A;  5KO3 A;  4YYQ A;  3MJ5 A;  4P6E A;  4P6G A;  1MDW A;  4IUM A;  3KW9 A;  1U5I A;  2GHU A;  2HD5 A;  2JTC A;  4R3D A;  4MZS A;  1NB5 A;  3B21 A;  3IEJ A;  2XU3 A;  1AU3 A;  4W5C A;  1PXV A;  1KFU L;  3N3K A;  2AYN A;  4HXD B;  1MEG A;  2DCB A;  4N8W A;  2AVW A;  2O6X A;  4DMX A;  3OF9 A;  2R9F A;  4WA6 A;  2FUD A;  3M99 A;  1IWD A;  3MOR A;  3KFQ A;  4KLB A;  2BTW B;  3TMP A;  3MP2 A;  1YAL A;  1QMY A;  2BDL A;  1PVJ A;  3RVX A;  4XUI A;  1UKF A;  3AI8 A;  3H8B A;  1Y4H A;  1SNK A;  4QRX A;  2G8E A;  3IUT A;  1GLO A;  2AUZ A;  3HHA A;  1GMY A;  5CVO B;  2DJG B;  2DOS A;  2R6N A;  3K8U A;  3ZUA A;  3P5U A;  2PRE A;  1TL9 A;  2AUX A;  2AIM A;  3BWK A;  4W5B A;  3PRM A;  4PT5 A;  1POP A;  4Q8H A;  1DF0 A;  1HUC B;  5FPW A;  3S3Q A;  2P86 A;  3IHP A;  3W31 A;  2XU4 A;  2E02 A;  3QT4 A;  1F2B A;  3O1G A;  3B79 A;  4I04 A;  2FRQ A;  2YJC A;  1EF7 A;  2R9N A;  4ZTB A;  3PT2 A;  2GFO A;  4OEM A;  1AIM A;  3PDF A;  4AXL A;  2OP3 A;  1CTE A;  1MIR A;  1AU4 A;  1NLJ A;  3BC3 A;  2DC7 A;  4BS5 A;  1M6D A;  4YYR A;  1CQD A;  1KXR A;  3HWN A;  9PAP A;  3DF0 A;  1NL6 A;  1QOL A;  2XU1 A;  4RY2 A;  4A5U A;  1EWM A;  1AYV A;  4CZW A;  1ZCM A;  3MHH A;  7PCK A;  3PRP A;  1AYU A;  1KFX L;  4MI7 A;  2FE8 A;  4BSQ A;  1STF E;  3CH2 X;  4XZX A;  2BU3 A;  3OQC A;  1ME4 A;  3HHI A;  2Y6E A;  4PAD A;  4BOQ A;  4OEL A;  3OVX A;  1CJL A;  1PPD A;  3K24 A;  3BPF A;  1PPO A;  3OF8 A;  1BY8 A;  4GUA A;  1SP4 B;  2NQI A;  2VHF A;  3IMA A;  1DKI A;  1O0E A;  2OZ2 A;  2DZY A;  2AGA A;  4MSX A;  3BY4 A;  2FO5 A;  3F75 A;  1CSB B;  2FRA A;  1Q6K A;  1Y08 A;  3KKU A;  5EZQ A;  1GEC E;  1PPP A;  1PE6 A;  1ZIV A;  5A24 A;  4BOU A;  3D6S A;  3PBH A;  1QXP A;  4YVA A;  1VJV A;  2YJ2 A;  3K9M A;  2ACT A;  1ITO A;  2DC8 A;  2FTD A;  1PIP A;  3O65 A;  1PPN A;  4QRG A;  2PNS A;  1YVB A;  1U9X A;  4YYW A;  3W30 A;  3WXG A;  1VSN A;  3ERV A;  3PHX A;  4CDC B;  3NHE A;  3P5X A;  4FJC A;  2DCA A;  3MTN A;  2C0Y A;  1XKG A;  3N3G A;  2H7J A;  4FIP A;  4YYV A;  3BPM A;  1PCI A;  8PCH A;  4M0W A;  5CHT A;  2R9O A;  3BB7 A;  4OVZ A;  3E1Z B;  4CDE B;  4YV8 A;  3C9E A;  4BOS A;  4Q8G A;  2PAD A;  4AXM A;  2WBF X;  1MHW A;  1YT7 A;  6PAD A;  3LFY A;  2B1M A;  1U9V A;  1S4V A;  2P7U A;  4BOP A;  3IOQ A;  4WUR A;  3PSE A;  4N79 A;  5F02 A;  4RF1 A;  3KWZ A;  1F29 A;  2G8J A;  1ICF A;  2XU5 A;  3KSE A;  3WXF A;  4D8B A;  2DC6 A;  2FQ9 A;  4BS6 A;  1NQC A;  4MZO A;  2IPP B;  3P5V A;  4OW0 A;  2F1G A;  3ZNH A;  4D8I A;  3MTV A;  1U9Q X;  2NQA A;  4MM3 B;  4X6J A;  2NQD B;  3V6C A;  4D8E A;  2PBH A;  1DEU A;  2CIO A;  3F5V A;  1AYW A;  1K3B B;  4RNA A;  1AU0 A;  2F7D A;  5EGW A;  5EZS A;  3PHW A;  1PBH A;  1GCB A;  2JQF R;  3I06 A;  1U9W A;  3BCN A;  1CPJ A;  1X9Y A;  1MS6 A;  2JQG R;  4QBB A;  4FK5 A;  3USV A;  2FYE A;  3H7D A;  4PP1 A;  3BOW A;  3O0U A;  5J94 A;  2ATO A;  1A6R A;  1AU2 A;  2G7Y A;  3IFU A;  4N4Z A;  2NQG A;  4YYS A;  5JA7 A;  3KX1 A;  4RKX A;  3PNR A;  2VHS A;  1F2A A;  3E9S A;  2FT2 A;  2UZJ A;  3IV2 A;  1KHP A;  3QSD A;  5CHV A;  1NB3 A;  1PAD A;  3H8C A;  3V6E A;  2DC9 A;  2DZZ A;  2AYO A;  3HD3 A;  2G6D A;  5CVM A;  1CS8 A;  4QH6 A;  3U8E A;  1EWP A;  4ZUX U;  5E6J A;  2OUL A;  3CBK A;  4OVZ B;  4K7C A;  4BOZ A;  3CH3 X;  3N4C A;  3KWB X;  2DCC A;  2E03 A;  2AS8 A;  2BTW A;  4HWY A;  5JZE A;  3H89 A;  3OIS A;  1BGO A;  5PAD A;  1YZB A;  2YJ8 A;  2J7Q C;  4CDF B;  2ARY A;  1YK7 A;  3GCB A;  4QRV A;  4XR7 A;  1CVZ A;  2DCD A;  3C0R A;  2HXZ A;  3P5W A;  4X6I A;  4I05 A;  5CVN B;  2Y5B A;  3TRK A;  1BP4 A;  2HH5 A;  4RF0 A;  3RVV A;  1ME3 A;  2DJF B;  3LXS A;  2CB5 A;  2R9M A;  2R9C A;  1AEC A;  2AU1 A;  3CBJ A;  3S3R A;  1YK8 A;  4W4U A;  1CB5 A;  4YYU A;  1JQP A;  5EF4 A;  3PHU A;  5K16 A;  3OVZ A;  1F2C A;  3H6S A;  3TNX A;  4REZ A; 
#chains in the Genus database with same CATH homology
 2P0R A;  3QJ3 A;  2IBI A;  1NPZ A;  2VFC A;  3RVW A;  5JH3 A;  1EWL A;  1QDQ A;  2YJ9 A;  4I07 A;  4BQV A;  1ATK A;  4G54 A;  3PW3 A;  1THE A;  2E01 A;  1EWO A;  2BDZ A;  4BPV A;  3WXE A;  4PI3 A;  1MEM A;  2HHN A;  2YJB A;  3I3T A;  1BQI A;  1KHQ A;  4X6H A;  3MHS A;  2B1N A;  1TLO A;  1FH0 A;  4CDD B;  1CV8 A;  4DMY A;  4PP2 E;  1TU6 A;  2E00 A;  4YYQ A;  4P6E A;  4P6G A;  1MDW A;  3KW9 A;  1U5I A;  2GHU A;  2HD5 A;  4MZS A;  1NB5 A;  3IEJ A;  2XU3 A;  1AU3 A;  4W5C A;  1PXV A;  1KFU L;  3N3K A;  2AYN A;  1MEG A;  2DCB A;  4N8W A;  2AVW A;  2O6X A;  4DMX A;  3OF9 A;  2R9F A;  4WA6 A;  2FUD A;  4BGF A;  3M99 A;  1IWD A;  3MOR A;  3KFQ A;  4KLB A;  1YAL A;  1QMY A;  2BDL A;  3RVX A;  4XUI A;  3AI8 A;  3H8B A;  1Y4H A;  1SNK A;  4QRX A;  2G8E A;  3IUT A;  1GLO A;  2AUZ A;  3HHA A;  1GMY A;  5CVO B;  2DJG B;  2R6N A;  3K8U A;  3ZUA A;  3P5U A;  2PRE A;  1TL9 A;  2AUX A;  2AIM A;  3BWK A;  4W5B A;  1POP A;  4Q8H A;  1DF0 A;  1HUC B;  5FPW A;  3S3Q A;  2P86 A;  3IHP A;  2XU4 A;  2E02 A;  3QT4 A;  1F2B A;  3O1G A;  3B79 A;  4I04 A;  2FRQ A;  2YJC A;  1EF7 A;  1W5R A;  2R9N A;  2GFO A;  4OEM A;  1AIM A;  3PDF A;  1GX3 A;  4AXL A;  1CTE A;  1MIR A;  2OP3 A;  1AU4 A;  1NLJ A;  3BC3 A;  2DC7 A;  4BS5 A;  1M6D A;  4YYR A;  1CQD A;  1KXR A;  3HWN A;  9PAP A;  3DF0 A;  1NL6 A;  1QOL A;  2XU1 A;  4RY2 A;  1EWM A;  1AYV A;  4CZW A;  4C5P A;  1ZCM A;  3MHH A;  7PCK A;  1AYU A;  1KFX L;  4NV7 A;  4BSQ A;  1STF E;  3CH2 X;  1ME4 A;  3HHI A;  4NV8 A;  2Y6E A;  4PAD A;  4OEL A;  3OVX A;  1CJL A;  1PPD A;  3K24 A;  3BPF A;  1PPO A;  3OF8 A;  1BY8 A;  1SP4 B;  2NQI A;  2VHF A;  3IMA A;  1O0E A;  2OZ2 A;  2DZY A;  4MSX A;  3LTW A;  2FO5 A;  3F75 A;  1CSB B;  2FRA A;  1Q6K A;  1Y08 A;  3KKU A;  1GEC E;  1PPP A;  1PE6 A;  1ZIV A;  5A24 A;  3D6S A;  3PBH A;  1QXP A;  4YVA A;  1VJV A;  2BSZ A;  2YJ2 A;  3K9M A;  2ACT A;  1ITO A;  2DC8 A;  2FTD A;  4GUZ A;  1PIP A;  1PPN A;  4QRG A;  2PNS A;  1YVB A;  1U9X A;  4YYW A;  3WXG A;  1VSN A;  1E2T A;  3ERV A;  4CDC B;  3NHE A;  3P5X A;  4FJC A;  2DCA A;  3MTN A;  2C0Y A;  1XKG A;  3N3G A;  2H7J A;  4FIP A;  4YYV A;  3BPM A;  1PCI A;  4B55 A;  8PCH A;  5CHT A;  2R9O A;  3E1Z B;  4CDE B;  4YV8 A;  3C9E A;  4Q8G A;  2PAD A;  4AXM A;  2WBF X;  1MHW A;  1YT7 A;  6PAD A;  3LFY A;  2B1M A;  1U9V A;  1S4V A;  2P7U A;  1W4T A;  3IOQ A;  4N79 A;  5F02 A;  3KWZ A;  1F29 A;  2G8J A;  1ICF A;  2XU5 A;  3KSE A;  3WXF A;  2DC6 A;  2FQ9 A;  4BS6 A;  1NQC A;  4MZO A;  2IPP B;  3P5V A;  2F1G A;  1U9Q X;  2NQA A;  4X6J A;  2NQD B;  3V6C A;  2PBH A;  1DEU A;  2CIO A;  3F5V A;  1AYW A;  1K3B B;  1AU0 A;  2F7D A;  5EGW A;  1PBH A;  1GCB A;  2JQF R;  3I06 A;  1U9W A;  3BCN A;  1CPJ A;  1X9Y A;  1MS6 A;  2JQG R;  2VFB A;  4FK5 A;  4QBB A;  3USV A;  2FYE A;  3H7D A;  4PP1 A;  3BOW A;  3O0U A;  5J94 A;  2ATO A;  1A6R A;  1AU2 A;  2G7Y A;  4N4Z A;  2NQG A;  4YYS A;  5JA7 A;  3KX1 A;  3PNR A;  2VHS A;  1F2A A;  2FT2 A;  3IV2 A;  1KHP A;  3QSD A;  5CHV A;  1NB3 A;  1PAD A;  3H8C A;  3V6E A;  2DC9 A;  2DZZ A;  2AYO A;  3HD3 A;  2G6D A;  5CVM A;  1CS8 A;  4QH6 A;  3U8E A;  1EWP A;  4ZUX U;  2OUL A;  3CBK A;  4K7C A;  3CH3 X;  3N4C A;  3KWB X;  2DCC A;  2E03 A;  2AS8 A;  4HWY A;  3H89 A;  3OIS A;  1BGO A;  5PAD A;  2YJ8 A;  4CDF B;  2ARY A;  1YK7 A;  3GCB A;  4QRV A;  4XR7 A;  1CVZ A;  2DCD A;  2HXZ A;  3P5W A;  4X6I A;  4I05 A;  5CVN B;  2Y5B A;  1BP4 A;  2HH5 A;  3RVV A;  1ME3 A;  2DJF B;  3LXS A;  2CB5 A;  2R9M A;  2R9C A;  1AEC A;  2AU1 A;  3CBJ A;  3S3R A;  1YK8 A;  4W4U A;  1W6F A;  1CB5 A;  3D9W A;  4YYU A;  1JQP A;  5EF4 A;  5K16 A;  3OVZ A;  1F2C A;  3H6S A;  3TNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...