4FK5A

Structure of the saga ubp8(s144n)/sgf11/sus1/sgf73 dub module
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
473
structure length
437
Chain Sequence
AAMSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGNTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALSTNRQTGFIYLLTCAWKINQQQDAHEFWQFIINQIHQSYVLDLPNAKEVSRANNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQCGECNSAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
total genus 132
structure length 437
sequence length 473
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4fk5A01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4fk5A02
4QH6A 3HWNA 3RTRB 2QICA 1SP4B 2YU4A 2JMDA 1G25A 2VP7A 3O37A 1DVPA 4QRGA 3O35A 1ME3A 2LV9A 1NB5A 2KIZA 5TDWA 2YT5A 4V3LC 3WXGA 4X3GA 4MVTA 1ZCMA 3WXEA 1K2FA 2KE1A 3SHBA 5H1UA 1QOLA 1O0EA 1Q6KA 5D1LB 4Q8HA 4X6JA 1JM7A 3QJ3A 2HD5A 1EF7A 5PADA 3M62A 2CSZA 2M85A 3P5XA 4CDCB 3D6SA 3ZPVE 3PW3A 1WEVA 3K9MA 2E01A 2YURA 2E02A 2YUCA 1MM2A 1CS8A 1NLJA 5CVNB 2DX8A 4F52B 3DQVR 4OEMA 1HUCB 2OXQC 5I3LA 3PBHA 2G6DA 4YBTA 5LKTA 5G0FA 5KH7A 3IOQA 2C2VS 3I3TA 3KX1A 3BPMA 1V87A 3ZNIA 2YSJA 3N9MA 4TKPB 1DF0A 2HH5A 1PPOA 2H0DB 3GV4A 2LGGA 2MD8C 3RVWA 3F75A 5H1TA 1YALA 5K16A 2VPBA 5DKAA 2YW8A 3CBJA 4XI1A 4BQVA 2ARYA 2R9NA 4GNDA 1JQPA 1X4JA 1CTEA 3DF0A 4I07A 3RVXA 1QXPA 2L80A 3O7AA 2OP3A 4CDFB 3L1XA 4CDDB 2PNXA 4CDEB 2KWJA 5CHVA 2AIMA 4QF2A 2BDLA 3EB5A 4I7BA 6PADA 2KU3A 3HCUA 2ECVA 4GNEA 2DJGB 3U5PA 3H8BA 3P5WA 5LKZA 4P5OB 4N8WA 2FSAA 5J94A 1WILA 3IEJA 2G8JA 4AVXA 1MEMA 3I2DA 2FT2A 2DC6A 5EGWA 1U9QX 2YJ2A 2L5UA 2DC7A 3RVVA 3S3RA 3N9QA 4L7XA 1MM3A 5J3XA 2LGLA 2VJEB 5KH3A 1EWOA 1MS6A 2ECWA 5B78A 2DZZA 2JRJA 1ZIVA 2P86A 1EWPA 3I06A 1MIRA 3IV2A 2I50A 2JQFR 4CCGX 4OELA 4GNFA 2DJFB 5CVOB 2FQ9A 1GECE 2JMJA 1NQCA 2E00A 3LXSA 3O1GA 3CBKA 3ZVZB 3PHDA 2ACTA 2ECGA 2ECTA 1U5IA 2VJFB 3FL2A 2H7JA 2D8SA 2PADA 1AYVA 3PUQA 5D1MB 2AVWA 3N9OA 2YJ9A 2FO5A 1WIMA 1WEQA 2F6NA 1IYMA 1WEPA 1WENA 5AIUA 2CKLB 1BP4A 4I7CA 2P0RA 4GB0A 5D1KB 5DINA 2MIQA 1FBVA 2H0DA 1ITOA 1QMYA 4R7EA 4HWYA 1XWHA 4V3KC 3O0UA 3B79A 4MZSA 2MD7B 3PNRA 1SNKA 1BGOA 1ME4A 4BS6A 2VHSA 2R9CA 3RPGB 1PPDA 3PURA 2F1GA 3N4CA 3ZPV1 1MDWA 4O64A 3ZUAA 3OVXA 2YJBA 2PBHA 2KGIA 4AP4A 2KWOA 2VPEA 4I05A 4PTBA 1ZBDB 2IDAA 4AXMA 3KNVA 1N87A 1U9WA 2FRQA 1FP0A 4I04A 1DEUA 3N3KA 3GL6A 4YBMA 2VHFA 4NN2A 5H9MA 5B77A 3LRQA 4UP0A 2XB1A 4B7YC 1TU6A 2GHUA 5CHTA 4LLBA 2HYED 2C0YA 4MZOA 4BPVA 3BOWA 3DPLR 3ZYQA 3ZVYA 3BPFA 4P6GA 4QRXA 2L43A 2AUXA 1AIMA 4I7DA 4QBBA 2CIOA 4YYQA 1NB3A 1WFKA 2KWNA 2YHNA 4A0CD 1WEEA 3MHHA 5A24A 3WXFA 2FRAA 1LDJB 2EA6A 2VNFA 1CV8A 4UP5A 2G45A 2KR4A 5EF4A 1XKGA 2NQDB 1M6DA 4W5BA 3C9EA 2M6MA 2ZETC 2XU4A 2NQIA 2MA6A 1CVZA 3U5OA 1EWMA 4WZ3B 5AITA 1GCBA 1S4VA 2PNSA 4UI9B 4X6HA 3OF9A 3CH3X 1AU2A 1F2AA 1GLOA 2MNYA 2MNZA 5B75A 5C13A 2IBIA 1VFYA 2EGPA 4IC2A 1YT7A 2AUZA 4PP2E 3AI8A 3HTKC 5B8DA 3H8CA 1CSBB 5B76A 4PP1A 2KGGA 3GCBA 2MT5A 1HYJA 3KWBX 2ECIA 5H1VA 4G54A 2R9OA 3HHIA 2Y5BA 2ATOA 5LCWB 1T1HA 3KW9A 4RY2A 2P7UA 4YYVA 3MTNA 2LXHC 2VJFA 1YVBA 3L11A 3N9PA 1PBHA 3P5VA 4C9ZA 1WEUA 2KWKA 3TNXA 1KHQA 4B86C 4LKAA 4YATA 1PE6A 3KSEA 3M63A 2HXZA 1AYWA 1ICFA 5FB1A 2AU1A 4Q6FA 2NQGA 1MEGA 3C5KA 3KKUA 4IC3A 3V43A 3RPGC 5JH3A 1Z2QA 4ZQLA 3N3GA 3E1ZB 5F02A 5TRBA 1JOCA 2FTDA 4N3WA 2FUIA 4CZWA 4ZUXU 3O36A 2PUYA 5TABA 2E03A 2CB5A 4YVAA 1U6GB 1AU4A 1F2BA 2M1RA 1PPPA 4QRVA 3U8EA 2JQGR 4DMYA 4A49A 3T6RA 2UZGA 2G8EA 2AYOA 3HHAA 2YQLA 3T7LA 1CPJA 2G43A 2B1NA 3S3QA 2XU1A 3NG2A 1IWDA 7PCKA 1Z60A 2AN6A 2ECNA 1E4UA 4LADB 2OZ2A 3KV5A 1VYXA 5KH9A 2YYRA 3BWKA 2DCBA 4WA6A 3USVA 2CSYA 4YYSA 3NHEA 3OF8A 5C11A 2LQ6A 1F2CA 1PPNA 4WZ2A 3SOWA 4FIPA 4YC9A 1WEOA 2LGVA 2MA5A 1PXVA 3N9NA 4Q8GA 5FPWA 3O70A 4N4ZA 3BC3A 1Y08A 3CH2X 4YYWA 3V6CA 1LDKC 4FK5A 3H89A 2O6XA 1CHCA 2HHNA 2OULA 4BS5A 4LJNA 2G7YA 1BORA 2MUMA 1KHPA 2LRIC 4BSQA 3MORA 3U5MA 4WZ0A 2F6JA 4XR7A 4LK9A 4ZDTA 2R9FA 1X4IA 2B1MA 2VPDA 5FB0A 1ATKA 3EB6A 1MHWA 3ERVA 4S3OC 4R2YA 2F7DA 1THEA 4BHWA 1CB5A 1BQIA 2K4DA 3BCNA 3C6WA 2BAYA 3O34A 3IHPA 2YREA 1KXRA 3QSDA 2DZYA 3OVZA 4YADA 3MHSA 3N9LA 2HDPA 4CA1A 2VPGA 3K8UA 1CJLA 1KFXL 4YYRA 2WBFX 2LDRA 3M99A 1F62A 2E6RA 2R9MA 4YAXA 4YYUA 3L1ZB 1TL9A 3IMAA 5LKUA 2LGKA 1NL6A 3K24A 4DMXA 4MSXA 5G05B 1EWLA 2XU5A 4AYCA 3LQJA 2GFOA 5TDRA 2AS8A 4FO9A 1AU3A 3LQHA 1BY8A 4A4CA 4FJCA 2KFTA 3HCSA 3P5UA 2K16A 5G04B 2Y1MA 2CKLA 3ASLA 1AYUA 3KFQA 1Z6UA 2K1JA 5FERA 1JM7B 3QT4A 2VJEA 4AXLA 1K3BB 2DCCA 3OISA 5LKXA 1AECA 2LN0A 2R6NA 5FEYA 2YHOA 4BBQA 2XU3A 2C2LA 3VK6A 4N79A 4L58A 3SOXA 3LQIA 1TLOA 2DCAA 4X6IA 4P6EA 5JA7A 4GNGA 4AUQB 1CQDA 1WEMA 2FUUA 2CT2A 9PAPA 2FUDA 1HYIA 2YJ8A 4XUIA 3HCTA 3SOUA 2DCDA 3HD3A 2M3HA 4W4UA 1YK7A 4YBSA 4PADA 2NQAA 1WGMA 2YQMA 1PIPA 2NAAA 1STFE 1Y4HA 1NPZA 3H6SA 1VJVA 4R8PK 1PCIA 3PDFA 1U9VA 2AYNA 2F42A 2EODA 3QZVA 2Y1NA 1GMYA 2Y43A 1X9YA 1KFUL 1POPA 3F5VA 3LFYA 4PPEA 4N4FA 2K17A 1VD4A 2QIZA 3O33A 2QJ0A 3U5NA 3IUTA 1F29A 1VSNA 2DC9A 2XEUA 1WESA 2E6SA 2KYUA 2RI7A 4S3OB 4KLBA 4AYCB 2L75A 8PCHA 4YABA 5CVMA 1YK8A 2Y6EA 1U9XA 5EYAF 1RMDA 3ZTGA 1WE9A 2L0BA 2LXPC 5TBNA 2YSMA 3H7DA 2KREA 4W5CA 1QDQA 4QF3A 3KV6A 5B79A 5JG6A 2BDZA 2FYEA 4K7CA 4A4BA 1X4UA 2ECJA 2IPPB 2PREA 1PADA 1A6RA 2G6QA 3KWZA 3V6EA 2YJCA 1AU0A 2DC8A 1WEWA 1FH0A 2RSDA 4YV8A 3KQIA 2JMIA 4PI3A
chains in the Genus database with same CATH superfamily
4QH6A 3HWNA 4D8BA 3RTRB 3IFUA 2CRWA 2QICA 3JUEA 2YU4A 1SP4B 2JMDA 1G25A 2VP7A 3O37A 1DVPA 4QRGA 3O35A 4RF1A 1ME3A 2LV9A 4BOPA 1NB5A 2KIZA 2OWAA 5TDWA 2YT5A 4V3LC 2JRIA 4X3GA 3PRPA 4MVTA 3WXGA 1ZCMA 3PHXA 3WXEA 1K2FA 2KE1A 3SHBA 5H1UA 1QOLA 1O0EA 1Q6KA 5D1LB 4Q8HA 4X6JA 3BY4A 1JM7A 3QJ3A 2HD5A 1DKIA 1EF7A 5PADA 3M62A 4IP3A 2CSZA 2M85A 3P5XA 4CDCB 3D6SA 3ZPVE 3PW3A 1WEVA 3K9MA 2HWKA 4O62A 3TMPA 2BTWB 2E01A 2YURA 2E02A 2YUCA 1MM2A 1CS8A 1NLJA 5CVNB 2DX8A 4F52B 4Z0RA 3DQVR 4OEMA 1HUCB 2OXQC 5I3LA 3PBHA 2G6DA 4YBTA 5LKTA 5G0FA 2MKEA 5KH7A 3IOQA 2C2VS 3FJUB 3I3TA 3KX1A 3BPMA 1V87A 3ZNIA 2YSJA 3N9MA 4TKPB 1DF0A 4BOQA 2HH5A 4RF0A 1PPOA 4MM3B 2H0DB 3GV4A 2LGGA 1UKFA 2MD8C 3RVWA 3F75A 5H1TA 1YALA 5K16A 2VPBA 5DKAA 2YW8A 3CBJA 4XI1A 4BQVA 2ARYA 2B0OE 2DOSA 2R9NA 4GNDA 1JQPA 1X4JA 1CTEA 3DF0A 4I07A 3RVXA 1QXPA 2L80A 3O7AA 2OP3A 4CDFB 3L1XA 4CDDB 2PNXA 4CDEB 2KWJA 5CHVA 2AIMA 4QF2A 2BDLA 3EB5A 4I7BA 6PADA 2KU3A 3HCUA 2ECVA 4GNEA 2DJGB 5EZSA 3U5PA 3H8BA 3P5WA 5LKZA 2EXUA 4P5OB 4N8WA 2FSAA 5J94A 1WILA 3IEJA 2G8JA 4AVXA 3PHWA 1MEMA 2CRRA 3I2DA 2FT2A 2DC6A 5EGWA 1U9QX 2YJ2A 2L5UA 2DC7A 3RVVA 3S3RA 3N9QA 4L7XA 1MM3A 5J3XA 2LGLA 2VJEB 5KH3A 1EWOA 1MS6A 2ECWA 5B78A 2DZZA 2JRJA 1ZIVA 2P86A 1EWPA 2CONA 3I06A 1MIRA 3IV2A 2I50A 2JQFR 4CCGX 4OELA 4GNFA 2DJFB 5CVOB 2FQ9A 1GECE 2JMJA 1NQCA 2E00A 2JTCA 3LXSA 3O1GA 4BOSA 2IQJA 3CBKA 3ZVZB 2XOCA 3MDBC 3PHDA 2YVRA 2ACTA 2ECGA 2ECTA 2D8UA 1U5IA 2VJFB 3O65A 3FL2A 2H7JA 2D8SA 2PADA 1AYVA 3PUQA 5D1MB 2AVWA 3N9OA 2FD4A 2FO5A 2YJ9A 1WIMA 1WEQA 2KKYA 2F6NA 2FE8A 3W30A 1IYMA 1WEPA 1WENA 4H9DA 5AIUA 2CKLB 1BP4A 4I7CA 2P0RA 4GB0A 3BB7A 5D1KB 5DINA 2MIQA 1FBVA 2H0DA 1ITOA 3E2DA 1QMYA 4R7EA 4HWYA 4REZA 1XWHA 4V3KC 3O0UA 3B79A 4MZSA 3M7KA 2MD7B 3PNRA 1SNKA 1PVJA 1BGOA 1ME4A 4BS6A 2VHSA 2R9CA 3RPGB 1PPDA 3PURA 2F1GA 2FFWA 3N4CA 3MJ5A 3ZPV1 1MDWA 4O64A 4D8IA 3ZUAA 5E6JA 2J7QC 3OVXA 2YJBA 2PBHA 2KGIA 4AP4A 3ZNHA 2KWOA 2VPEA 4I05A 4P16A 4PTBA 1ZBDB 2IDAA 1MBMA 4AXMA 3KNVA 1N87A 1U9WA 2FRQA 1FP0A 4I04A 1DEUA 4WURA 5SVIA 3N3KA 3MP2A 2M13A 3GL6A 4YBMA 2VHFA 4NN2A 5H9MA 4F1PA 3LRQA 4UP0A 2XB1A 5B77A 4B7YC 1TU6A 2GHUA 5CHTA 2JM3A 4LLBA 2HYED 4MI7A 2C0YA 4MZOA 4BPVA 3BOWA 3PRMA 3DPLR 3ZYQA 3ZVYA 3BPFA 4P6GA 4QRXA 2L43A 2AUXA 1AIMA 4I7DA 4QBBA 2CIOA 4YYQA 1NB3A 1WFKA 2KWNA 2YHNA 4A0CD 1WEEA 3MHHA 5A24A 3PHUA 3WXFA 2FRAA 1LDJB 2EA6A 2VNFA 1CV8A 4UP5A 2G45A 2KR4A 5EF4A 3LVRE 1XKGA 2NQDB 1M6DA 4W5BA 3C9EA 2BU3A 2M6MA 2ZETC 3B21A 2XU4A 2NQIA 2MA6A 1CVZA 3U5OA 1EWMA 4WZ3B 5AITA 4QQ4A 1GCBA 1S4VA 2PNSA 4UI9B 4X6HA 3OF9A 3CH3X 1AU2A 1F2AA 1GLOA 2MNYA 2MNZA 5B75A 5C13A 2IBIA 4RKXA 1VFYA 2EGPA 4IC2A 1YT7A 2AUZA 4PP2E 3AI8A 3HTKC 5B8DA 3H8CA 4RNAA 1CSBB 5B76A 4PP1A 2KGGA 3GCBA 2MT5A 5EZQA 1HYJA 3KWBX 2DJAA 2ECIA 5H1VA 4G54A 2R9OA 3HHIA 2Y5BA 2ATOA 3TRKA 5LCWB 1T1HA 3KW9A 4RY2A 2P7UA 4YYVA 3MTNA 2LXHC 2VJFA 1YVBA 3L11A 3N9PA 1PBHA 3C0RA 3P5VA 5KO3A 4C9ZA 1WEUA 2KWKA 3TNXA 1KHQA 4B86C 4LKAA 4YATA 3W31A 3H7HA 1PE6A 3FAOA 3KSEA 3M63A 2HXZA 1AYWA 1ICFA 5FB1A 2AU1A 3DDTA 4Q6FA 2NQGA 4Z0OA 2AGAA 1MEGA 3C5KA 3KKUA 4IC3A 3V43A 3RPGC 5JH3A 1Z2QA 4ZQLA 3N3GA 3E1ZB 5F02A 5SVYA 5TRBA 1JOCA 3SUBA 2FTDA 2XP0A 4N3WA 2FUIA 3T9KA 4CZWA 4ZUXU 3O36A 2PUYA 5TABA 2E03A 3PT2A 2CB5A 4YVAA 1U6GB 1AU4A 1F2BA 2M1RA 4R3DA 2E61A 1PPPA 4QRVA 3U8EA 5SVIB 2JQGR 4DMYA 4A49A 3T6RA 2UZGA 2G8EA 2AYOA 3HHAA 2YQLA 3T7LA 1CPJA 2G43A 2B1NA 3S3QA 2XU1A 2LAUA 3NG2A 1IWDA 3FM8C 7PCKA 1Z60A 2AN6A 2ECNA 1E4UA 4LADB 2OZ2A 3KV5A 1VYXA 5KH9A 2YYRA 3BWKA 2DCBA 4WA6A 3USVA 2CSYA 4YYSA 3NHEA 3Q1DA 3OF8A 5C11A 3LVQE 2LQ6A 1F2CA 1PPNA 4WZ2A 3SOWA 4OW0A 4FIPA 4YC9A 1WEOA 2LGVA 2MA5A 1PXVA 3N9NA 4Q8GA 5FPWA 3O70A 4N4ZA 3FANA 3BC3A 4XZXA 1Y08A 3CH2X 4YYWA 3V6CA 1LDKC 4FK5A 3H89A 3RNVA 2O6XA 1CHCA 2HHNA 2CSVA 4OGEA 2OULA 4BS5A 4LJNA 1YZBA 2G7YA 1BORA 4ZTBA 2MUMA 3LDYA 1KHPA 2LRIC 4BOUA 4BSQA 5K3QA 3MORA 3U5MA 4WZ0A 2F6JA 4XR7A 4LK9A 4ZDTA 2R9FA 1X4IA 2B1MA 2VPDA 5FB0A 1ATKA 3EB6A 1MHWA 3ERVA 4S3OC 4R2YA 2F7DA 1THEA 4BHWA 2KKXA 1CB5A 1BQIA 2K4DA 3BCNA 3E9SA 3C6WA 2BAYA 3O34A 3IHPA 2YREA 1KXRA 4IUMA 3QSDA 2DZYA 2XOYA 4OGCA 3OVZA 4YADA 2DSMA 4BOZA 3MHSA 3N9LA 5SVXA 2HDPA 4CA1A 2VPGA 3K8UA 1CJLA 1KFXL 4YYRA 2WBFX 2LDRA 3M99A 1F62A 2E6RA 4OVZA 2R9MA 2J7QA 4A5UA 4YAXA 4YYUA 3L1ZB 1TL9A 3IMAA 5LKUA 2LGKA 1NL6A 3K24A 4DMXA 4MSXA 5G05B 1EWLA 2XU5A 4AYCA 3LQJA 2GFOA 5TDRA 2AS8A 4FO9A 1AU3A 2XOZA 3LQHA 1BY8A 4A4CA 4FJCA 2KFTA 3HCSA 3O47A 3P5UA 2K16A 2RR4A 2Y1MA 2CKLA 3ASLA 5G04B 2L7PA 1AYUA 1Z6UA 3KFQA 2K1JA 5FERA 1JM7B 3QT4A 2VJEA 4AXLA 1K3BB 2DCCA 3OISA 5LKXA 1AECA 2LN0A 2R6NA 5FEYA 2YHOA 4BBQA 2XU3A 4D8EA 2C2LA 3VK6A 3BBAA 4N79A 4L58A 3SOXA 3LQIA 1TLOA 2DCAA 4X6IA 4P6EA 5JA7A 2JUNA 4GNGA 3PLWA 2BTWA 4PI3A 4AUQB 1CQDA 1WEMA 1DCQA 2FUUA 2CT2A 2Z84A 9PAPA 2FUDA 3KDEC 1HYIA 4M0WA 2YJ8A 4XUIA 3HCTA 3OQCA 5JZEA 3SOUA 2DCDA 3HD3A 2M3HA 4W4UA 1YK7A 4YBSA 4PADA 2NQAA 1WGMA 2YQMA 2P57A 1PIPA 2NAAA 1STFE 1Y4HA 1NPZA 3H6SA 1VJVA 4R8PK 1PCIA 3PDFA 1U9VA 2AYNA 2F42A 4HXDB 2EODA 3QZVA 2Y1NA 1GMYA 2Y43A 1X9YA 1KFUL 1POPA 4GUAA 3F5VA 3LFYA 4PPEA 4N4FA 2K17A 1VD4A 2QIZA 3O33A 2QJ0A 3U5NA 3IUTA 1F29A 1VSNA 2DC9A 2XEUA 1WESA 3PSEA 2E6SA 2KYUA 2RI7A 3DWDA 4S3OB 4KLBA 4PT5A 2L75A 4AYCB 8PCHA 4YABA 5CVMA 3LJUX 1YK8A 3FEHA 2Y6EA 1U9XA 5EYAF 1RMDA 3ZTGA 1WE9A 2L0BA 2LXPC 5TBNA 2YSMA 3H7DA 2KREA 4W5CA 2EGMA 1QDQA 4QF3A 3KV6A 5B79A 5JG6A 2BDZA 2FYEA 4K7CA 4A4BA 1X4UA 2ECJA 2IPPB 2PREA 1PADA 1A6RA 3MTVA 2G6QA 2UZJA 3KWZA 3V6EA 2YJCA 1AU0A 2DC8A 1WEWA 1FH0A 2RSDA 4YV8A 3KQIA 2JMIA 4OVZB
chains in the Genus database with same CATH topology
4QH6A 3HWNA 3RTRB 2QICA 1SP4B 2YU4A 2JMDA 1G25A 2VP7A 3O37A 1DVPA 4QRGA 3O35A 1ME3A 2LV9A 1NB5A 2KIZA 5TDWA 2YT5A 4V3LC 3WXGA 4X3GA 4MVTA 1ZCMA 3WXEA 1K2FA 2KE1A 3SHBA 5H1UA 1QOLA 1O0EA 1Q6KA 5D1LB 4Q8HA 4X6JA 1JM7A 3QJ3A 2HD5A 1EF7A 5PADA 3M62A 2CSZA 2M85A 3P5XA 4CDCB 3D6SA 3ZPVE 3PW3A 1WEVA 3K9MA 2E01A 2YURA 2E02A 2YUCA 1MM2A 1CS8A 1NLJA 5CVNB 2DX8A 4F52B 3DQVR 4OEMA 1HUCB 2OXQC 5I3LA 3PBHA 2G6DA 4YBTA 5LKTA 5G0FA 5KH7A 3IOQA 2C2VS 3I3TA 3KX1A 3BPMA 1V87A 3ZNIA 2YSJA 3N9MA 4TKPB 1DF0A 2HH5A 1PPOA 2H0DB 3GV4A 2LGGA 2MD8C 3RVWA 3F75A 5H1TA 1YALA 5K16A 2VPBA 5DKAA 2YW8A 3CBJA 4XI1A 4BQVA 2ARYA 2R9NA 4GNDA 1JQPA 1X4JA 1CTEA 3DF0A 4I07A 3RVXA 1QXPA 2L80A 3O7AA 2OP3A 4CDFB 3L1XA 4CDDB 2PNXA 4CDEB 2KWJA 5CHVA 2AIMA 4QF2A 2BDLA 3EB5A 4I7BA 6PADA 2KU3A 3HCUA 2ECVA 4GNEA 2DJGB 3U5PA 3H8BA 3P5WA 5LKZA 4P5OB 3LTWA 4N8WA 2FSAA 5J94A 4BGFA 1WILA 3IEJA 2G8JA 4AVXA 1MEMA 3I2DA 2FT2A 2DC6A 5EGWA 1U9QX 2YJ2A 2L5UA 2DC7A 3RVVA 3S3RA 3N9QA 4L7XA 1MM3A 5J3XA 2LGLA 2VJEB 5KH3A 1EWOA 1MS6A 2ECWA 5B78A 2DZZA 2JRJA 1ZIVA 2P86A 1EWPA 3I06A 1MIRA 3IV2A 2I50A 2JQFR 4CCGX 4OELA 4GNFA 2DJFB 5CVOB 2FQ9A 1GECE 2JMJA 1NQCA 2E00A 3LXSA 3O1GA 3D9WA 3CBKA 3ZVZB 3PHDA 2ACTA 2ECGA 2ECTA 1U5IA 2VJFB 3FL2A 2H7JA 2D8SA 2PADA 1AYVA 3PUQA 5D1MB 2AVWA 3N9OA 2YJ9A 2FO5A 1WIMA 1WEQA 2F6NA 1IYMA 1WEPA 1WENA 5AIUA 2CKLB 1BP4A 4I7CA 2P0RA 4GB0A 4NV8A 5D1KB 5DINA 2MIQA 1FBVA 2H0DA 1ITOA 1QMYA 4R7EA 4HWYA 1XWHA 4V3KC 3O0UA 3B79A 4MZSA 2MD7B 3PNRA 1SNKA 1BGOA 1ME4A 4BS6A 2VHSA 2R9CA 3RPGB 1PPDA 3PURA 2F1GA 3N4CA 3ZPV1 1MDWA 4O64A 3ZUAA 3OVXA 4NV7A 2YJBA 2PBHA 2KGIA 4AP4A 2KWOA 2VPEA 4I05A 4PTBA 1ZBDB 2IDAA 4AXMA 3KNVA 1N87A 1U9WA 2FRQA 1FP0A 4I04A 1DEUA 3N3KA 3GL6A 4YBMA 2VHFA 4NN2A 5H9MA 5B77A 3LRQA 4UP0A 2XB1A 4B7YC 1TU6A 2GHUA 5CHTA 4LLBA 2HYED 2C0YA 4MZOA 4BPVA 3BOWA 3DPLR 3ZYQA 3ZVYA 3BPFA 4P6GA 4QRXA 2L43A 2AUXA 1AIMA 4I7DA 4QBBA 2CIOA 4YYQA 4B55A 1NB3A 1WFKA 2KWNA 2YHNA 4A0CD 1WEEA 3MHHA 5A24A 3WXFA 2FRAA 1LDJB 2EA6A 2VNFA 1CV8A 4UP5A 2G45A 2KR4A 5EF4A 1XKGA 2NQDB 1M6DA 4W5BA 3C9EA 2M6MA 2ZETC 2XU4A 2NQIA 2MA6A 1CVZA 3U5OA 1EWMA 4WZ3B 5AITA 1GCBA 1S4VA 2PNSA 4UI9B 4X6HA 3OF9A 3CH3X 1AU2A 1F2AA 1GLOA 2MNYA 2MNZA 5B75A 5C13A 1E2TA 2VFBA 2IBIA 1VFYA 2EGPA 4IC2A 1YT7A 2AUZA 4GUZA 4PP2E 3AI8A 3HTKC 5B8DA 3H8CA 1CSBB 5B76A 4PP1A 2KGGA 3GCBA 2MT5A 1W5RA 1HYJA 3KWBX 2ECIA 5H1VA 1GX3A 4G54A 2R9OA 3HHIA 2Y5BA 2ATOA 5LCWB 1T1HA 3KW9A 4RY2A 2P7UA 4YYVA 3MTNA 2LXHC 2VJFA 1YVBA 3L11A 3N9PA 1PBHA 3P5VA 4C9ZA 1WEUA 2KWKA 3TNXA 1KHQA 4B86C 4LKAA 4YATA 1PE6A 3KSEA 3M63A 2HXZA 1AYWA 1ICFA 5FB1A 2AU1A 4Q6FA 2NQGA 1MEGA 3C5KA 3KKUA 4IC3A 3V43A 3RPGC 5JH3A 1Z2QA 4ZQLA 3N3GA 3E1ZB 5F02A 5TRBA 1JOCA 2FTDA 4N3WA 2FUIA 4CZWA 4ZUXU 3O36A 2PUYA 5TABA 2E03A 2CB5A 4YVAA 1U6GB 1AU4A 1F2BA 2M1RA 1PPPA 4QRVA 3U8EA 2JQGR 4DMYA 4A49A 3T6RA 2UZGA 2G8EA 2AYOA 3HHAA 2YQLA 3T7LA 1CPJA 2G43A 2B1NA 3S3QA 2XU1A 3NG2A 1IWDA 7PCKA 1Z60A 2AN6A 2ECNA 1E4UA 4LADB 2OZ2A 3KV5A 1VYXA 5KH9A 2YYRA 3BWKA 2DCBA 4WA6A 3USVA 2CSYA 4YYSA 3NHEA 3OF8A 5C11A 2BSZA 2LQ6A 1F2CA 1PPNA 4WZ2A 3SOWA 4FIPA 4YC9A 1WEOA 2LGVA 2MA5A 1PXVA 1W6FA 3N9NA 4Q8GA 5FPWA 3O70A 4N4ZA 3BC3A 1Y08A 3CH2X 4YYWA 3V6CA 1LDKC 4FK5A 3H89A 2O6XA 1CHCA 2HHNA 2OULA 4BS5A 4LJNA 2G7YA 1BORA 2MUMA 2VFCA 1KHPA 2LRIC 4BSQA 3MORA 3U5MA 4WZ0A 2F6JA 4XR7A 4LK9A 4ZDTA 2R9FA 1X4IA 2B1MA 4C5PA 2VPDA 5FB0A 1ATKA 3EB6A 1MHWA 3ERVA 4S3OC 4R2YA 2F7DA 1THEA 4BHWA 1CB5A 1BQIA 2K4DA 3BCNA 1W4TA 3C6WA 2BAYA 3O34A 3IHPA 2YREA 1KXRA 3QSDA 2DZYA 3OVZA 4YADA 3MHSA 3N9LA 2HDPA 4CA1A 2VPGA 3K8UA 1CJLA 1KFXL 4YYRA 2WBFX 2LDRA 3M99A 1F62A 2E6RA 2R9MA 4YAXA 4YYUA 3L1ZB 1TL9A 3IMAA 5LKUA 2LGKA 1NL6A 3K24A 4DMXA 4MSXA 5G05B 1EWLA 2XU5A 4AYCA 3LQJA 2GFOA 5TDRA 2AS8A 4FO9A 1AU3A 3LQHA 1BY8A 4A4CA 4FJCA 2KFTA 3HCSA 3P5UA 2K16A 5G04B 2Y1MA 2CKLA 3ASLA 1AYUA 3KFQA 1Z6UA 2K1JA 5FERA 1JM7B 3QT4A 2VJEA 4AXLA 1K3BB 2DCCA 3OISA 5LKXA 1AECA 2LN0A 2R6NA 5FEYA 2YHOA 4BBQA 2XU3A 2C2LA 3VK6A 4N79A 4L58A 3SOXA 3LQIA 1TLOA 2DCAA 4X6IA 4P6EA 5JA7A 4GNGA 4AUQB 1CQDA 1WEMA 2FUUA 2CT2A 9PAPA 2FUDA 1HYIA 2YJ8A 4XUIA 3HCTA 3SOUA 2DCDA 3HD3A 2M3HA 4W4UA 1YK7A 4YBSA 4PADA 2NQAA 1WGMA 2YQMA 1PIPA 2NAAA 1STFE 1Y4HA 1NPZA 3H6SA 1VJVA 4R8PK 1PCIA 3PDFA 1U9VA 2AYNA 2F42A 2EODA 3QZVA 2Y1NA 1GMYA 2Y43A 1X9YA 1KFUL 1POPA 3F5VA 3LFYA 4PPEA 4N4FA 2K17A 1VD4A 2QIZA 3O33A 2QJ0A 3U5NA 3IUTA 1F29A 1VSNA 2DC9A 2XEUA 1WESA 2E6SA 2KYUA 2RI7A 4S3OB 4KLBA 4AYCB 2L75A 8PCHA 4YABA 5CVMA 1YK8A 2Y6EA 1U9XA 5EYAF 1RMDA 3ZTGA 1WE9A 2L0BA 2LXPC 5TBNA 2YSMA 3H7DA 2KREA 4W5CA 1QDQA 4QF3A 3KV6A 5B79A 5JG6A 2BDZA 2FYEA 4K7CA 4A4BA 1X4UA 2ECJA 2IPPB 2PREA 1PADA 1A6RA 2G6QA 3KWZA 3V6EA 2YJCA 1AU0A 2DC8A 1WEWA 1FH0A 2RSDA 4YV8A 3KQIA 2JMIA 4PI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QH6 A;  3HWN A;  3RTR B;  2QIC A;  1SP4 B;  2YU4 A;  2JMD A;  1G25 A;  2VP7 A;  3O37 A;  1DVP A;  4QRG A;  3O35 A;  1ME3 A;  2LV9 A;  1NB5 A;  2KIZ A;  5TDW A;  2YT5 A;  4V3L C;  3WXG A;  4X3G A;  4MVT A;  1ZCM A;  3WXE A;  1K2F A;  2KE1 A;  3SHB A;  5H1U A;  1QOL A;  1O0E A;  1Q6K A;  5D1L B;  4Q8H A;  4X6J A;  1JM7 A;  3QJ3 A;  2HD5 A;  1EF7 A;  5PAD A;  3M62 A;  2CSZ A;  2M85 A;  3P5X A;  4CDC B;  3D6S A;  3ZPV E;  3PW3 A;  1WEV A;  3K9M A;  2E01 A;  2YUR A;  2E02 A;  2YUC A;  1MM2 A;  1CS8 A;  1NLJ A;  5CVN B;  2DX8 A;  4F52 B;  3DQV R;  4OEM A;  1HUC B;  2OXQ C;  5I3L A;  3PBH A;  2G6D A;  4YBT A;  5LKT A;  5G0F A;  5KH7 A;  3IOQ A;  2C2V S;  3I3T A;  3KX1 A;  3BPM A;  1V87 A;  3ZNI A;  2YSJ A;  3N9M A;  4TKP B;  1DF0 A;  2HH5 A;  1PPO A;  2H0D B;  3GV4 A;  2LGG A;  2MD8 C;  3RVW A;  3F75 A;  5H1T A;  1YAL A;  5K16 A;  2VPB A;  5DKA A;  2YW8 A;  3CBJ A;  4XI1 A;  4BQV A;  2ARY A;  2R9N A;  4GND A;  1JQP A;  1X4J A;  1CTE A;  3DF0 A;  4I07 A;  3RVX A;  1QXP A;  2L80 A;  3O7A A;  2OP3 A;  4CDF B;  3L1X A;  4CDD B;  2PNX A;  4CDE B;  2KWJ A;  5CHV A;  2AIM A;  4QF2 A;  2BDL A;  3EB5 A;  4I7B A;  6PAD A;  2KU3 A;  3HCU A;  2ECV A;  4GNE A;  2DJG B;  3U5P A;  3H8B A;  3P5W A;  5LKZ A;  4P5O B;  4N8W A;  2FSA A;  5J94 A;  1WIL A;  3IEJ A;  2G8J A;  4AVX A;  1MEM A;  3I2D A;  2FT2 A;  2DC6 A;  5EGW A;  1U9Q X;  2YJ2 A;  2L5U A;  2DC7 A;  3RVV A;  3S3R A;  3N9Q A;  4L7X A;  1MM3 A;  5J3X A;  2LGL A;  2VJE B;  5KH3 A;  1EWO A;  1MS6 A;  2ECW A;  5B78 A;  2DZZ A;  2JRJ A;  1ZIV A;  2P86 A;  1EWP A;  3I06 A;  1MIR A;  3IV2 A;  2I50 A;  2JQF R;  4CCG X;  4OEL A;  4GNF A;  2DJF B;  5CVO B;  2FQ9 A;  1GEC E;  2JMJ A;  1NQC A;  2E00 A;  3LXS A;  3O1G A;  3CBK A;  3ZVZ B;  3PHD A;  2ACT A;  2ECG A;  2ECT A;  1U5I A;  2VJF B;  3FL2 A;  2H7J A;  2D8S A;  2PAD A;  1AYV A;  3PUQ A;  5D1M B;  2AVW A;  3N9O A;  2YJ9 A;  2FO5 A;  1WIM A;  1WEQ A;  2F6N A;  1IYM A;  1WEP A;  1WEN A;  5AIU A;  2CKL B;  1BP4 A;  4I7C A;  2P0R A;  4GB0 A;  5D1K B;  5DIN A;  2MIQ A;  1FBV A;  2H0D A;  1ITO A;  1QMY A;  4R7E A;  4HWY A;  1XWH A;  4V3K C;  3O0U A;  3B79 A;  4MZS A;  2MD7 B;  3PNR A;  1SNK A;  1BGO A;  1ME4 A;  4BS6 A;  2VHS A;  2R9C A;  3RPG B;  1PPD A;  3PUR A;  2F1G A;  3N4C A;  3ZPV 1;  1MDW A;  4O64 A;  3ZUA A;  3OVX A;  2YJB A;  2PBH A;  2KGI A;  4AP4 A;  2KWO A;  2VPE A;  4I05 A;  4PTB A;  1ZBD B;  2IDA A;  4AXM A;  3KNV A;  1N87 A;  1U9W A;  2FRQ A;  1FP0 A;  4I04 A;  1DEU A;  3N3K A;  3GL6 A;  4YBM A;  2VHF A;  4NN2 A;  5H9M A;  5B77 A;  3LRQ A;  4UP0 A;  2XB1 A;  4B7Y C;  1TU6 A;  2GHU A;  5CHT A;  4LLB A;  2HYE D;  2C0Y A;  4MZO A;  4BPV A;  3BOW A;  3DPL R;  3ZYQ A;  3ZVY A;  3BPF A;  4P6G A;  4QRX A;  2L43 A;  2AUX A;  1AIM A;  4I7D A;  4QBB A;  2CIO A;  4YYQ A;  1NB3 A;  1WFK A;  2KWN A;  2YHN A;  4A0C D;  1WEE A;  3MHH A;  5A24 A;  3WXF A;  2FRA A;  1LDJ B;  2EA6 A;  2VNF A;  1CV8 A;  4UP5 A;  2G45 A;  2KR4 A;  5EF4 A;  1XKG A;  2NQD B;  1M6D A;  4W5B A;  3C9E A;  2M6M A;  2ZET C;  2XU4 A;  2NQI A;  2MA6 A;  1CVZ A;  3U5O A;  1EWM A;  4WZ3 B;  5AIT A;  1GCB A;  1S4V A;  2PNS A;  4UI9 B;  4X6H A;  3OF9 A;  3CH3 X;  1AU2 A;  1F2A A;  1GLO A;  2MNY A;  2MNZ A;  5B75 A;  5C13 A;  2IBI A;  1VFY A;  2EGP A;  4IC2 A;  1YT7 A;  2AUZ A;  4PP2 E;  3AI8 A;  3HTK C;  5B8D A;  3H8C A;  1CSB B;  5B76 A;  4PP1 A;  2KGG A;  3GCB A;  2MT5 A;  1HYJ A;  3KWB X;  2ECI A;  5H1V A;  4G54 A;  2R9O A;  3HHI A;  2Y5B A;  2ATO A;  5LCW B;  1T1H A;  3KW9 A;  4RY2 A;  2P7U A;  4YYV A;  3MTN A;  2LXH C;  2VJF A;  1YVB A;  3L11 A;  3N9P A;  1PBH A;  3P5V A;  4C9Z A;  1WEU A;  2KWK A;  3TNX A;  1KHQ A;  4B86 C;  4LKA A;  4YAT A;  1PE6 A;  3KSE A;  3M63 A;  2HXZ A;  1AYW A;  1ICF A;  5FB1 A;  2AU1 A;  4Q6F A;  2NQG A;  1MEG A;  3C5K A;  3KKU A;  4IC3 A;  3V43 A;  3RPG C;  5JH3 A;  1Z2Q A;  4ZQL A;  3N3G A;  3E1Z B;  5F02 A;  5TRB A;  1JOC A;  2FTD A;  4N3W A;  2FUI A;  4CZW A;  4ZUX U;  3O36 A;  2PUY A;  5TAB A;  2E03 A;  2CB5 A;  4YVA A;  1U6G B;  1AU4 A;  1F2B A;  2M1R A;  1PPP A;  4QRV A;  3U8E A;  2JQG R;  4DMY A;  4A49 A;  3T6R A;  2UZG A;  2G8E A;  2AYO A;  3HHA A;  2YQL A;  3T7L A;  1CPJ A;  2G43 A;  2B1N A;  3S3Q A;  2XU1 A;  3NG2 A;  1IWD A;  7PCK A;  1Z60 A;  2AN6 A;  2ECN A;  1E4U A;  4LAD B;  2OZ2 A;  3KV5 A;  1VYX A;  5KH9 A;  2YYR A;  3BWK A;  2DCB A;  4WA6 A;  3USV A;  2CSY A;  4YYS A;  3NHE A;  3OF8 A;  5C11 A;  2LQ6 A;  1F2C A;  1PPN A;  4WZ2 A;  3SOW A;  4FIP A;  4YC9 A;  1WEO A;  2LGV A;  2MA5 A;  1PXV A;  3N9N A;  4Q8G A;  5FPW A;  3O70 A;  4N4Z A;  3BC3 A;  1Y08 A;  3CH2 X;  4YYW A;  3V6C A;  1LDK C;  4FK5 A;  3H89 A;  2O6X A;  1CHC A;  2HHN A;  2OUL A;  4BS5 A;  4LJN A;  2G7Y A;  1BOR A;  2MUM A;  1KHP A;  2LRI C;  4BSQ A;  3MOR A;  3U5M A;  4WZ0 A;  2F6J A;  4XR7 A;  4LK9 A;  4ZDT A;  2R9F A;  1X4I A;  2B1M A;  2VPD A;  5FB0 A;  1ATK A;  3EB6 A;  1MHW A;  3ERV A;  4S3O C;  4R2Y A;  2F7D A;  1THE A;  4BHW A;  1CB5 A;  1BQI A;  2K4D A;  3BCN A;  3C6W A;  2BAY A;  3O34 A;  3IHP A;  2YRE A;  1KXR A;  3QSD A;  2DZY A;  3OVZ A;  4YAD A;  3MHS A;  3N9L A;  2HDP A;  4CA1 A;  2VPG A;  3K8U A;  1CJL A;  1KFX L;  4YYR A;  2WBF X;  2LDR A;  3M99 A;  1F62 A;  2E6R A;  2R9M A;  4YAX A;  4YYU A;  3L1Z B;  1TL9 A;  3IMA A;  5LKU A;  2LGK A;  1NL6 A;  3K24 A;  4DMX A;  4MSX A;  5G05 B;  1EWL A;  2XU5 A;  4AYC A;  3LQJ A;  2GFO A;  5TDR A;  2AS8 A;  4FO9 A;  1AU3 A;  3LQH A;  1BY8 A;  4A4C A;  4FJC A;  2KFT A;  3HCS A;  3P5U A;  2K16 A;  5G04 B;  2Y1M A;  2CKL A;  3ASL A;  1AYU A;  3KFQ A;  1Z6U A;  2K1J A;  5FER A;  1JM7 B;  3QT4 A;  2VJE A;  4AXL A;  1K3B B;  2DCC A;  3OIS A;  5LKX A;  1AEC A;  2LN0 A;  2R6N A;  5FEY A;  2YHO A;  4BBQ A;  2XU3 A;  2C2L A;  3VK6 A;  4N79 A;  4L58 A;  3SOX A;  3LQI A;  1TLO A;  2DCA A;  4X6I A;  4P6E A;  5JA7 A;  4GNG A;  4AUQ B;  1CQD A;  1WEM A;  2FUU A;  2CT2 A;  9PAP A;  2FUD A;  1HYI A;  2YJ8 A;  4XUI A;  3HCT A;  3SOU A;  2DCD A;  3HD3 A;  2M3H A;  4W4U A;  1YK7 A;  4YBS A;  4PAD A;  2NQA A;  1WGM A;  2YQM A;  1PIP A;  2NAA A;  1STF E;  1Y4H A;  1NPZ A;  3H6S A;  1VJV A;  4R8P K;  1PCI A;  3PDF A;  1U9V A;  2AYN A;  2F42 A;  2EOD A;  3QZV A;  2Y1N A;  1GMY A;  2Y43 A;  1X9Y A;  1KFU L;  1POP A;  3F5V A;  3LFY A;  4PPE A;  4N4F A;  2K17 A;  1VD4 A;  2QIZ A;  3O33 A;  2QJ0 A;  3U5N A;  3IUT A;  1F29 A;  1VSN A;  2DC9 A;  2XEU A;  1WES A;  2E6S A;  2KYU A;  2RI7 A;  4S3O B;  4KLB A;  4AYC B;  2L75 A;  8PCH A;  4YAB A;  5CVM A;  1YK8 A;  2Y6E A;  1U9X A;  5EYA F;  1RMD A;  3ZTG A;  1WE9 A;  2L0B A;  2LXP C;  5TBN A;  2YSM A;  3H7D A;  2KRE A;  4W5C A;  1QDQ A;  4QF3 A;  3KV6 A;  5B79 A;  5JG6 A;  2BDZ A;  2FYE A;  4K7C A;  4A4B A;  1X4U A;  2ECJ A;  2IPP B;  2PRE A;  1PAD A;  1A6R A;  2G6Q A;  3KWZ A;  3V6E A;  2YJC A;  1AU0 A;  2DC8 A;  1WEW A;  1FH0 A;  2RSD A;  4YV8 A;  3KQI A;  2JMI A;  4PI3 A; 
#chains in the Genus database with same CATH topology
 4QH6 A;  3HWN A;  4D8B A;  3RTR B;  3IFU A;  2CRW A;  2QIC A;  3JUE A;  2YU4 A;  1SP4 B;  2JMD A;  1G25 A;  2VP7 A;  3O37 A;  1DVP A;  4QRG A;  3O35 A;  4RF1 A;  1ME3 A;  2LV9 A;  4BOP A;  1NB5 A;  2KIZ A;  2OWA A;  5TDW A;  2YT5 A;  4V3L C;  2JRI A;  4X3G A;  3PRP A;  4MVT A;  3WXG A;  1ZCM A;  3PHX A;  3WXE A;  1K2F A;  2KE1 A;  3SHB A;  5H1U A;  1QOL A;  1O0E A;  1Q6K A;  5D1L B;  4Q8H A;  4X6J A;  3BY4 A;  1JM7 A;  3QJ3 A;  2HD5 A;  1DKI A;  1EF7 A;  5PAD A;  3M62 A;  4IP3 A;  2CSZ A;  2M85 A;  3P5X A;  4CDC B;  3D6S A;  3ZPV E;  3PW3 A;  1WEV A;  3K9M A;  2HWK A;  4O62 A;  3TMP A;  2BTW B;  2E01 A;  2YUR A;  2E02 A;  2YUC A;  1MM2 A;  1CS8 A;  1NLJ A;  5CVN B;  2DX8 A;  4F52 B;  4Z0R A;  3DQV R;  4OEM A;  1HUC B;  2OXQ C;  5I3L A;  3PBH A;  2G6D A;  4YBT A;  5LKT A;  5G0F A;  2MKE A;  5KH7 A;  3IOQ A;  2C2V S;  3FJU B;  3I3T A;  3KX1 A;  3BPM A;  1V87 A;  3ZNI A;  2YSJ A;  3N9M A;  4TKP B;  1DF0 A;  4BOQ A;  2HH5 A;  4RF0 A;  1PPO A;  4MM3 B;  2H0D B;  3GV4 A;  2LGG A;  1UKF A;  2MD8 C;  3RVW A;  3F75 A;  5H1T A;  1YAL A;  5K16 A;  2VPB A;  5DKA A;  2YW8 A;  3CBJ A;  4XI1 A;  4BQV A;  2ARY A;  2B0O E;  2DOS A;  2R9N A;  4GND A;  1JQP A;  1X4J A;  1CTE A;  3DF0 A;  4I07 A;  3RVX A;  1QXP A;  2L80 A;  3O7A A;  2OP3 A;  4CDF B;  3L1X A;  4CDD B;  2PNX A;  4CDE B;  2KWJ A;  5CHV A;  2AIM A;  4QF2 A;  2BDL A;  3EB5 A;  4I7B A;  6PAD A;  2KU3 A;  3HCU A;  2ECV A;  4GNE A;  2DJG B;  5EZS A;  3U5P A;  3H8B A;  3P5W A;  5LKZ A;  2EXU A;  4P5O B;  4N8W A;  2FSA A;  5J94 A;  1WIL A;  3IEJ A;  2G8J A;  4AVX A;  3PHW A;  1MEM A;  2CRR A;  3I2D A;  2FT2 A;  2DC6 A;  5EGW A;  1U9Q X;  2YJ2 A;  2L5U A;  2DC7 A;  3RVV A;  3S3R A;  3N9Q A;  4L7X A;  1MM3 A;  5J3X A;  2LGL A;  2VJE B;  5KH3 A;  1EWO A;  1MS6 A;  2ECW A;  5B78 A;  2DZZ A;  2JRJ A;  1ZIV A;  2P86 A;  1EWP A;  2CON A;  3I06 A;  1MIR A;  3IV2 A;  2I50 A;  2JQF R;  4CCG X;  4OEL A;  4GNF A;  2DJF B;  5CVO B;  2FQ9 A;  1GEC E;  2JMJ A;  1NQC A;  2E00 A;  2JTC A;  3LXS A;  3O1G A;  4BOS A;  2IQJ A;  3CBK A;  3ZVZ B;  2XOC A;  3MDB C;  3PHD A;  2YVR A;  2ACT A;  2ECG A;  2ECT A;  2D8U A;  1U5I A;  2VJF B;  3O65 A;  3FL2 A;  2H7J A;  2D8S A;  2PAD A;  1AYV A;  3PUQ A;  5D1M B;  2AVW A;  3N9O A;  2FD4 A;  2FO5 A;  2YJ9 A;  1WIM A;  1WEQ A;  2KKY A;  2F6N A;  2FE8 A;  3W30 A;  1IYM A;  1WEP A;  1WEN A;  4H9D A;  5AIU A;  2CKL B;  1BP4 A;  4I7C A;  2P0R A;  4GB0 A;  3BB7 A;  5D1K B;  5DIN A;  2MIQ A;  1FBV A;  2H0D A;  1ITO A;  3E2D A;  1QMY A;  4R7E A;  4HWY A;  4REZ A;  1XWH A;  4V3K C;  3O0U A;  3B79 A;  4MZS A;  3M7K A;  2MD7 B;  3PNR A;  1SNK A;  1PVJ A;  1BGO A;  1ME4 A;  4BS6 A;  2VHS A;  2R9C A;  3RPG B;  1PPD A;  3PUR A;  2F1G A;  2FFW A;  3N4C A;  3MJ5 A;  3ZPV 1;  1MDW A;  4O64 A;  4D8I A;  3ZUA A;  5E6J A;  2J7Q C;  3OVX A;  2YJB A;  2PBH A;  2KGI A;  4AP4 A;  3ZNH A;  2KWO A;  2VPE A;  4I05 A;  4P16 A;  4PTB A;  1ZBD B;  2IDA A;  1MBM A;  4AXM A;  3KNV A;  1N87 A;  1U9W A;  2FRQ A;  1FP0 A;  4I04 A;  1DEU A;  4WUR A;  5SVI A;  3N3K A;  3MP2 A;  2M13 A;  3GL6 A;  4YBM A;  2VHF A;  4NN2 A;  5H9M A;  4F1P A;  3LRQ A;  4UP0 A;  2XB1 A;  5B77 A;  4B7Y C;  1TU6 A;  2GHU A;  5CHT A;  2JM3 A;  4LLB A;  2HYE D;  4MI7 A;  2C0Y A;  4MZO A;  4BPV A;  3BOW A;  3PRM A;  3DPL R;  3ZYQ A;  3ZVY A;  3BPF A;  4P6G A;  4QRX A;  2L43 A;  2AUX A;  1AIM A;  4I7D A;  4QBB A;  2CIO A;  4YYQ A;  1NB3 A;  1WFK A;  2KWN A;  2YHN A;  4A0C D;  1WEE A;  3MHH A;  5A24 A;  3PHU A;  3WXF A;  2FRA A;  1LDJ B;  2EA6 A;  2VNF A;  1CV8 A;  4UP5 A;  2G45 A;  2KR4 A;  5EF4 A;  3LVR E;  1XKG A;  2NQD B;  1M6D A;  4W5B A;  3C9E A;  2BU3 A;  2M6M A;  2ZET C;  3B21 A;  2XU4 A;  2NQI A;  2MA6 A;  1CVZ A;  3U5O A;  1EWM A;  4WZ3 B;  5AIT A;  4QQ4 A;  1GCB A;  1S4V A;  2PNS A;  4UI9 B;  4X6H A;  3OF9 A;  3CH3 X;  1AU2 A;  1F2A A;  1GLO A;  2MNY A;  2MNZ A;  5B75 A;  5C13 A;  2IBI A;  4RKX A;  1VFY A;  2EGP A;  4IC2 A;  1YT7 A;  2AUZ A;  4PP2 E;  3AI8 A;  3HTK C;  5B8D A;  3H8C A;  4RNA A;  1CSB B;  5B76 A;  4PP1 A;  2KGG A;  3GCB A;  2MT5 A;  5EZQ A;  1HYJ A;  3KWB X;  2DJA A;  2ECI A;  5H1V A;  4G54 A;  2R9O A;  3HHI A;  2Y5B A;  2ATO A;  3TRK A;  5LCW B;  1T1H A;  3KW9 A;  4RY2 A;  2P7U A;  4YYV A;  3MTN A;  2LXH C;  2VJF A;  1YVB A;  3L11 A;  3N9P A;  1PBH A;  3C0R A;  3P5V A;  5KO3 A;  4C9Z A;  1WEU A;  2KWK A;  3TNX A;  1KHQ A;  4B86 C;  4LKA A;  4YAT A;  3W31 A;  3H7H A;  1PE6 A;  3FAO A;  3KSE A;  3M63 A;  2HXZ A;  1AYW A;  1ICF A;  5FB1 A;  2AU1 A;  3DDT A;  4Q6F A;  2NQG A;  4Z0O A;  2AGA A;  1MEG A;  3C5K A;  3KKU A;  4IC3 A;  3V43 A;  3RPG C;  5JH3 A;  1Z2Q A;  4ZQL A;  3N3G A;  3E1Z B;  5F02 A;  5SVY A;  5TRB A;  1JOC A;  3SUB A;  2FTD A;  2XP0 A;  4N3W A;  2FUI A;  3T9K A;  4CZW A;  4ZUX U;  3O36 A;  2PUY A;  5TAB A;  2E03 A;  3PT2 A;  2CB5 A;  4YVA A;  1U6G B;  1AU4 A;  1F2B A;  2M1R A;  4R3D A;  2E61 A;  1PPP A;  4QRV A;  3U8E A;  5SVI B;  2JQG R;  4DMY A;  4A49 A;  3T6R A;  2UZG A;  2G8E A;  2AYO A;  3HHA A;  2YQL A;  3T7L A;  1CPJ A;  2G43 A;  2B1N A;  3S3Q A;  2XU1 A;  2LAU A;  3NG2 A;  1IWD A;  3FM8 C;  7PCK A;  1Z60 A;  2AN6 A;  2ECN A;  1E4U A;  4LAD B;  2OZ2 A;  3KV5 A;  1VYX A;  5KH9 A;  2YYR A;  3BWK A;  2DCB A;  4WA6 A;  3USV A;  2CSY A;  4YYS A;  3NHE A;  3Q1D A;  3OF8 A;  5C11 A;  3LVQ E;  2LQ6 A;  1F2C A;  1PPN A;  4WZ2 A;  3SOW A;  4OW0 A;  4FIP A;  4YC9 A;  1WEO A;  2LGV A;  2MA5 A;  1PXV A;  3N9N A;  4Q8G A;  5FPW A;  3O70 A;  4N4Z A;  3FAN A;  3BC3 A;  4XZX A;  1Y08 A;  3CH2 X;  4YYW A;  3V6C A;  1LDK C;  4FK5 A;  3H89 A;  3RNV A;  2O6X A;  1CHC A;  2HHN A;  2CSV A;  4OGE A;  2OUL A;  4BS5 A;  4LJN A;  1YZB A;  2G7Y A;  1BOR A;  4ZTB A;  2MUM A;  3LDY A;  1KHP A;  2LRI C;  4BOU A;  4BSQ A;  5K3Q A;  3MOR A;  3U5M A;  4WZ0 A;  2F6J A;  4XR7 A;  4LK9 A;  4ZDT A;  2R9F A;  1X4I A;  2B1M A;  2VPD A;  5FB0 A;  1ATK A;  3EB6 A;  1MHW A;  3ERV A;  4S3O C;  4R2Y A;  2F7D A;  1THE A;  4BHW A;  2KKX A;  1CB5 A;  1BQI A;  2K4D A;  3BCN A;  3E9S A;  3C6W A;  2BAY A;  3O34 A;  3IHP A;  2YRE A;  1KXR A;  4IUM A;  3QSD A;  2DZY A;  2XOY A;  4OGC A;  3OVZ A;  4YAD A;  2DSM A;  4BOZ A;  3MHS A;  3N9L A;  5SVX A;  2HDP A;  4CA1 A;  2VPG A;  3K8U A;  1CJL A;  1KFX L;  4YYR A;  2WBF X;  2LDR A;  3M99 A;  1F62 A;  2E6R A;  4OVZ A;  2R9M A;  2J7Q A;  4A5U A;  4YAX A;  4YYU A;  3L1Z B;  1TL9 A;  3IMA A;  5LKU A;  2LGK A;  1NL6 A;  3K24 A;  4DMX A;  4MSX A;  5G05 B;  1EWL A;  2XU5 A;  4AYC A;  3LQJ A;  2GFO A;  5TDR A;  2AS8 A;  4FO9 A;  1AU3 A;  2XOZ A;  3LQH A;  1BY8 A;  4A4C A;  4FJC A;  2KFT A;  3HCS A;  3O47 A;  3P5U A;  2K16 A;  2RR4 A;  2Y1M A;  2CKL A;  3ASL A;  5G04 B;  2L7P A;  1AYU A;  1Z6U A;  3KFQ A;  2K1J A;  5FER A;  1JM7 B;  3QT4 A;  2VJE A;  4AXL A;  1K3B B;  2DCC A;  3OIS A;  5LKX A;  1AEC A;  2LN0 A;  2R6N A;  5FEY A;  2YHO A;  4BBQ A;  2XU3 A;  4D8E A;  2C2L A;  3VK6 A;  3BBA A;  4N79 A;  4L58 A;  3SOX A;  3LQI A;  1TLO A;  2DCA A;  4X6I A;  4P6E A;  5JA7 A;  2JUN A;  4GNG A;  3PLW A;  2BTW A;  4PI3 A;  4AUQ B;  1CQD A;  1WEM A;  1DCQ A;  2FUU A;  2CT2 A;  2Z84 A;  9PAP A;  2FUD A;  3KDE C;  1HYI A;  4M0W A;  2YJ8 A;  4XUI A;  3HCT A;  3OQC A;  5JZE A;  3SOU A;  2DCD A;  3HD3 A;  2M3H A;  4W4U A;  1YK7 A;  4YBS A;  4PAD A;  2NQA A;  1WGM A;  2YQM A;  2P57 A;  1PIP A;  2NAA A;  1STF E;  1Y4H A;  1NPZ A;  3H6S A;  1VJV A;  4R8P K;  1PCI A;  3PDF A;  1U9V A;  2AYN A;  2F42 A;  4HXD B;  2EOD A;  3QZV A;  2Y1N A;  1GMY A;  2Y43 A;  1X9Y A;  1KFU L;  1POP A;  4GUA A;  3F5V A;  3LFY A;  4PPE A;  4N4F A;  2K17 A;  1VD4 A;  2QIZ A;  3O33 A;  2QJ0 A;  3U5N A;  3IUT A;  1F29 A;  1VSN A;  2DC9 A;  2XEU A;  1WES A;  3PSE A;  2E6S A;  2KYU A;  2RI7 A;  3DWD A;  4S3O B;  4KLB A;  4PT5 A;  2L75 A;  4AYC B;  8PCH A;  4YAB A;  5CVM A;  3LJU X;  1YK8 A;  3FEH A;  2Y6E A;  1U9X A;  5EYA F;  1RMD A;  3ZTG A;  1WE9 A;  2L0B A;  2LXP C;  5TBN A;  2YSM A;  3H7D A;  2KRE A;  4W5C A;  2EGM A;  1QDQ A;  4QF3 A;  3KV6 A;  5B79 A;  5JG6 A;  2BDZ A;  2FYE A;  4K7C A;  4A4B A;  1X4U A;  2ECJ A;  2IPP B;  2PRE A;  1PAD A;  1A6R A;  3MTV A;  2G6Q A;  2UZJ A;  3KWZ A;  3V6E A;  2YJC A;  1AU0 A;  2DC8 A;  1WEW A;  1FH0 A;  2RSD A;  4YV8 A;  3KQI A;  2JMI A;  4OVZ B; 
#chains in the Genus database with same CATH homology
 4QH6 A;  3HWN A;  3RTR B;  2QIC A;  1SP4 B;  2YU4 A;  2JMD A;  1G25 A;  2VP7 A;  3O37 A;  1DVP A;  4QRG A;  3O35 A;  1ME3 A;  2LV9 A;  1NB5 A;  2KIZ A;  5TDW A;  2YT5 A;  4V3L C;  3WXG A;  4X3G A;  4MVT A;  1ZCM A;  3WXE A;  1K2F A;  2KE1 A;  3SHB A;  5H1U A;  1QOL A;  1O0E A;  1Q6K A;  5D1L B;  4Q8H A;  4X6J A;  1JM7 A;  3QJ3 A;  2HD5 A;  1EF7 A;  5PAD A;  3M62 A;  2CSZ A;  2M85 A;  3P5X A;  4CDC B;  3D6S A;  3ZPV E;  3PW3 A;  1WEV A;  3K9M A;  2E01 A;  2YUR A;  2E02 A;  2YUC A;  1MM2 A;  1CS8 A;  1NLJ A;  5CVN B;  2DX8 A;  4F52 B;  3DQV R;  4OEM A;  1HUC B;  2OXQ C;  5I3L A;  3PBH A;  2G6D A;  4YBT A;  5LKT A;  5G0F A;  5KH7 A;  3IOQ A;  2C2V S;  3I3T A;  3KX1 A;  3BPM A;  1V87 A;  3ZNI A;  2YSJ A;  3N9M A;  4TKP B;  1DF0 A;  2HH5 A;  1PPO A;  2H0D B;  3GV4 A;  2LGG A;  2MD8 C;  3RVW A;  3F75 A;  5H1T A;  1YAL A;  5K16 A;  2VPB A;  5DKA A;  2YW8 A;  3CBJ A;  4XI1 A;  4BQV A;  2ARY A;  2R9N A;  4GND A;  1JQP A;  1X4J A;  1CTE A;  3DF0 A;  4I07 A;  3RVX A;  1QXP A;  2L80 A;  3O7A A;  2OP3 A;  4CDF B;  3L1X A;  4CDD B;  2PNX A;  4CDE B;  2KWJ A;  5CHV A;  2AIM A;  4QF2 A;  2BDL A;  3EB5 A;  4I7B A;  6PAD A;  2KU3 A;  3HCU A;  2ECV A;  4GNE A;  2DJG B;  3U5P A;  3H8B A;  3P5W A;  5LKZ A;  4P5O B;  3LTW A;  4N8W A;  2FSA A;  5J94 A;  4BGF A;  1WIL A;  3IEJ A;  2G8J A;  4AVX A;  1MEM A;  3I2D A;  2FT2 A;  2DC6 A;  5EGW A;  1U9Q X;  2YJ2 A;  2L5U A;  2DC7 A;  3RVV A;  3S3R A;  3N9Q A;  4L7X A;  1MM3 A;  5J3X A;  2LGL A;  2VJE B;  5KH3 A;  1EWO A;  1MS6 A;  2ECW A;  5B78 A;  2DZZ A;  2JRJ A;  1ZIV A;  2P86 A;  1EWP A;  3I06 A;  1MIR A;  3IV2 A;  2I50 A;  2JQF R;  4CCG X;  4OEL A;  4GNF A;  2DJF B;  5CVO B;  2FQ9 A;  1GEC E;  2JMJ A;  1NQC A;  2E00 A;  3LXS A;  3O1G A;  3D9W A;  3CBK A;  3ZVZ B;  3PHD A;  2ACT A;  2ECG A;  2ECT A;  1U5I A;  2VJF B;  3FL2 A;  2H7J A;  2D8S A;  2PAD A;  1AYV A;  3PUQ A;  5D1M B;  2AVW A;  3N9O A;  2YJ9 A;  2FO5 A;  1WIM A;  1WEQ A;  2F6N A;  1IYM A;  1WEP A;  1WEN A;  5AIU A;  2CKL B;  1BP4 A;  4I7C A;  2P0R A;  4GB0 A;  4NV8 A;  5D1K B;  5DIN A;  2MIQ A;  1FBV A;  2H0D A;  1ITO A;  1QMY A;  4R7E A;  4HWY A;  1XWH A;  4V3K C;  3O0U A;  3B79 A;  4MZS A;  2MD7 B;  3PNR A;  1SNK A;  1BGO A;  1ME4 A;  4BS6 A;  2VHS A;  2R9C A;  3RPG B;  1PPD A;  3PUR A;  2F1G A;  3N4C A;  3ZPV 1;  1MDW A;  4O64 A;  3ZUA A;  3OVX A;  4NV7 A;  2YJB A;  2PBH A;  2KGI A;  4AP4 A;  2KWO A;  2VPE A;  4I05 A;  4PTB A;  1ZBD B;  2IDA A;  4AXM A;  3KNV A;  1N87 A;  1U9W A;  2FRQ A;  1FP0 A;  4I04 A;  1DEU A;  3N3K A;  3GL6 A;  4YBM A;  2VHF A;  4NN2 A;  5H9M A;  5B77 A;  3LRQ A;  4UP0 A;  2XB1 A;  4B7Y C;  1TU6 A;  2GHU A;  5CHT A;  4LLB A;  2HYE D;  2C0Y A;  4MZO A;  4BPV A;  3BOW A;  3DPL R;  3ZYQ A;  3ZVY A;  3BPF A;  4P6G A;  4QRX A;  2L43 A;  2AUX A;  1AIM A;  4I7D A;  4QBB A;  2CIO A;  4YYQ A;  4B55 A;  1NB3 A;  1WFK A;  2KWN A;  2YHN A;  4A0C D;  1WEE A;  3MHH A;  5A24 A;  3WXF A;  2FRA A;  1LDJ B;  2EA6 A;  2VNF A;  1CV8 A;  4UP5 A;  2G45 A;  2KR4 A;  5EF4 A;  1XKG A;  2NQD B;  1M6D A;  4W5B A;  3C9E A;  2M6M A;  2ZET C;  2XU4 A;  2NQI A;  2MA6 A;  1CVZ A;  3U5O A;  1EWM A;  4WZ3 B;  5AIT A;  1GCB A;  1S4V A;  2PNS A;  4UI9 B;  4X6H A;  3OF9 A;  3CH3 X;  1AU2 A;  1F2A A;  1GLO A;  2MNY A;  2MNZ A;  5B75 A;  5C13 A;  1E2T A;  2VFB A;  2IBI A;  1VFY A;  2EGP A;  4IC2 A;  1YT7 A;  2AUZ A;  4GUZ A;  4PP2 E;  3AI8 A;  3HTK C;  5B8D A;  3H8C A;  1CSB B;  5B76 A;  4PP1 A;  2KGG A;  3GCB A;  2MT5 A;  1W5R A;  1HYJ A;  3KWB X;  2ECI A;  5H1V A;  1GX3 A;  4G54 A;  2R9O A;  3HHI A;  2Y5B A;  2ATO A;  5LCW B;  1T1H A;  3KW9 A;  4RY2 A;  2P7U A;  4YYV A;  3MTN A;  2LXH C;  2VJF A;  1YVB A;  3L11 A;  3N9P A;  1PBH A;  3P5V A;  4C9Z A;  1WEU A;  2KWK A;  3TNX A;  1KHQ A;  4B86 C;  4LKA A;  4YAT A;  1PE6 A;  3KSE A;  3M63 A;  2HXZ A;  1AYW A;  1ICF A;  5FB1 A;  2AU1 A;  4Q6F A;  2NQG A;  1MEG A;  3C5K A;  3KKU A;  4IC3 A;  3V43 A;  3RPG C;  5JH3 A;  1Z2Q A;  4ZQL A;  3N3G A;  3E1Z B;  5F02 A;  5TRB A;  1JOC A;  2FTD A;  4N3W A;  2FUI A;  4CZW A;  4ZUX U;  3O36 A;  2PUY A;  5TAB A;  2E03 A;  2CB5 A;  4YVA A;  1U6G B;  1AU4 A;  1F2B A;  2M1R A;  1PPP A;  4QRV A;  3U8E A;  2JQG R;  4DMY A;  4A49 A;  3T6R A;  2UZG A;  2G8E A;  2AYO A;  3HHA A;  2YQL A;  3T7L A;  1CPJ A;  2G43 A;  2B1N A;  3S3Q A;  2XU1 A;  3NG2 A;  1IWD A;  7PCK A;  1Z60 A;  2AN6 A;  2ECN A;  1E4U A;  4LAD B;  2OZ2 A;  3KV5 A;  1VYX A;  5KH9 A;  2YYR A;  3BWK A;  2DCB A;  4WA6 A;  3USV A;  2CSY A;  4YYS A;  3NHE A;  3OF8 A;  5C11 A;  2BSZ A;  2LQ6 A;  1F2C A;  1PPN A;  4WZ2 A;  3SOW A;  4FIP A;  4YC9 A;  1WEO A;  2LGV A;  2MA5 A;  1PXV A;  1W6F A;  3N9N A;  4Q8G A;  5FPW A;  3O70 A;  4N4Z A;  3BC3 A;  1Y08 A;  3CH2 X;  4YYW A;  3V6C A;  1LDK C;  4FK5 A;  3H89 A;  2O6X A;  1CHC A;  2HHN A;  2OUL A;  4BS5 A;  4LJN A;  2G7Y A;  1BOR A;  2MUM A;  2VFC A;  1KHP A;  2LRI C;  4BSQ A;  3MOR A;  3U5M A;  4WZ0 A;  2F6J A;  4XR7 A;  4LK9 A;  4ZDT A;  2R9F A;  1X4I A;  2B1M A;  4C5P A;  2VPD A;  5FB0 A;  1ATK A;  3EB6 A;  1MHW A;  3ERV A;  4S3O C;  4R2Y A;  2F7D A;  1THE A;  4BHW A;  1CB5 A;  1BQI A;  2K4D A;  3BCN A;  1W4T A;  3C6W A;  2BAY A;  3O34 A;  3IHP A;  2YRE A;  1KXR A;  3QSD A;  2DZY A;  3OVZ A;  4YAD A;  3MHS A;  3N9L A;  2HDP A;  4CA1 A;  2VPG A;  3K8U A;  1CJL A;  1KFX L;  4YYR A;  2WBF X;  2LDR A;  3M99 A;  1F62 A;  2E6R A;  2R9M A;  4YAX A;  4YYU A;  3L1Z B;  1TL9 A;  3IMA A;  5LKU A;  2LGK A;  1NL6 A;  3K24 A;  4DMX A;  4MSX A;  5G05 B;  1EWL A;  2XU5 A;  4AYC A;  3LQJ A;  2GFO A;  5TDR A;  2AS8 A;  4FO9 A;  1AU3 A;  3LQH A;  1BY8 A;  4A4C A;  4FJC A;  2KFT A;  3HCS A;  3P5U A;  2K16 A;  5G04 B;  2Y1M A;  2CKL A;  3ASL A;  1AYU A;  3KFQ A;  1Z6U A;  2K1J A;  5FER A;  1JM7 B;  3QT4 A;  2VJE A;  4AXL A;  1K3B B;  2DCC A;  3OIS A;  5LKX A;  1AEC A;  2LN0 A;  2R6N A;  5FEY A;  2YHO A;  4BBQ A;  2XU3 A;  2C2L A;  3VK6 A;  4N79 A;  4L58 A;  3SOX A;  3LQI A;  1TLO A;  2DCA A;  4X6I A;  4P6E A;  5JA7 A;  4GNG A;  4AUQ B;  1CQD A;  1WEM A;  2FUU A;  2CT2 A;  9PAP A;  2FUD A;  1HYI A;  2YJ8 A;  4XUI A;  3HCT A;  3SOU A;  2DCD A;  3HD3 A;  2M3H A;  4W4U A;  1YK7 A;  4YBS A;  4PAD A;  2NQA A;  1WGM A;  2YQM A;  1PIP A;  2NAA A;  1STF E;  1Y4H A;  1NPZ A;  3H6S A;  1VJV A;  4R8P K;  1PCI A;  3PDF A;  1U9V A;  2AYN A;  2F42 A;  2EOD A;  3QZV A;  2Y1N A;  1GMY A;  2Y43 A;  1X9Y A;  1KFU L;  1POP A;  3F5V A;  3LFY A;  4PPE A;  4N4F A;  2K17 A;  1VD4 A;  2QIZ A;  3O33 A;  2QJ0 A;  3U5N A;  3IUT A;  1F29 A;  1VSN A;  2DC9 A;  2XEU A;  1WES A;  2E6S A;  2KYU A;  2RI7 A;  4S3O B;  4KLB A;  4AYC B;  2L75 A;  8PCH A;  4YAB A;  5CVM A;  1YK8 A;  2Y6E A;  1U9X A;  5EYA F;  1RMD A;  3ZTG A;  1WE9 A;  2L0B A;  2LXP C;  5TBN A;  2YSM A;  3H7D A;  2KRE A;  4W5C A;  1QDQ A;  4QF3 A;  3KV6 A;  5B79 A;  5JG6 A;  2BDZ A;  2FYE A;  4K7C A;  4A4B A;  1X4U A;  2ECJ A;  2IPP B;  2PRE A;  1PAD A;  1A6R A;  2G6Q A;  3KWZ A;  3V6E A;  2YJC A;  1AU0 A;  2DC8 A;  1WEW A;  1FH0 A;  2RSD A;  4YV8 A;  3KQI A;  2JMI A;  4PI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...