4FK5A

Structure of the saga ubp8(s144n)/sgf11/sus1/sgf73 dub module
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
473
structure length
437
Chain Sequence
b'AAMSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGNTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALSTNRQTGFIYLLTCAWKINQQQDAHEFWQFIINQIHQSYVLDLPNAKEVSRANNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQCGECNSAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
publication title A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 132
structure length 437
sequence length 473
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4fk5A01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4fk5A02
2YREA 4L7XA 2IBIA 5H1VA 4G54A 1KXRA 3IEJA 2KWNA 1A6RA 1WGMA 3TNXA 3O70A 5A24A 2NQDB 1WEQA 2JRJA 5K16A 2HXZA 2HYED 3CBKA 2MD8C 4GNDA 2JQFR 2PADA 3CH2X 3T7LA 1MM2A 3V6EA 4FJCA 5PADA 1JM7A 2F7DA 2LGGA 4B7YC 2DZYA 3EB5A 4NN2A 1E4UA 2PREA 1AYUA 1X4IA 3PW3A 2YJ2A 2G8EA 1VJVA 2E02A 5TDRA 2NQGA 1MS6A 4YABA 2F6NA 4I7BA 5JH3A 3C9EA 3DQVR 2R9FA 3I3TA 5H9MA 3CBJA 1WEWA 4X3GA 1MIRA 4GNFA 1WEPA 3BC3A 4XUIA 2Y43A 2OXQC 3O34A 1WEEA 3ZNIA 1Z2QA 2MD7B 1Z6UA 2MNZA 2YW8A 4XI1A 5B79A 2E03A 4KLBA 2FRQA 3HHAA 2FTDA 2XU4A 1WESA 1NB5A 2FRAA 1BORA 4QRVA 2DC7A 3U5NA 3U5PA 2DJFB 1U9XA 2AIMA 3ZUAA 3PURA 3ZVZB 2YJBA 2ECWA 4Q8GA 1FH0A 3H7DA 2HDPA 5CHVA 4UP0A 1MM3A 4Q8HA 2DX8A 3E1ZB 3U5OA 4MSXA 2LV9A 3LQJA 4DMYA 1X4UA 2RSDA 1PCIA 1Y4HA 3RVXA 2DZZA 4X6IA 1ME3A 1PPNA 1U9VA 3KW9A 4AYCB 4X6HA 1WFKA 2NQIA 1WE9A 2YQLA 4YATA 3O7AA 3ERVA 1IWDA 1O0EA 3IV2A 2XU3A 3HWNA 3O35A 1K3BB 2L5UA 2MA6A 4BBQA 5B75A 4I7DA 1AYWA 1CTEA 3LQIA 4P5OB 1THEA 4N4FA 2FUDA 2I50A 5C13A 3LXSA 2ZETC 2F6JA 3ZVYA 5I3LA 2B1MA 2HH5A 2KGGA 5JG6A 1QOLA 2O6XA 3DF0A 2EGPA 2YJCA 2P0RA 1BP4A 1U5IA 1T1HA 2YHNA 2H7JA 3AI8A 2K16A 3WXGA 3MORA 3SOWA 2VJFB 3KX1A 3GL6A 5FPWA 1WEUA 1AYVA 1PIPA 2PBHA 4TKPB 1CS8A 4I05A 2YURA 4I07A 2IDAA 5KH3A 3CH3X 2XU5A 2M6MA 1POPA 3O1GA 4AP4A 4S3OC 4WZ0A 2MUMA 5FEYA 4ZUXU 2FUUA 5G0FA 2D8SA 1TL9A 2FO5A 1CQDA 4PPEA 3BOWA 3KKUA 1PADA 4X6JA 4K7CA 3HCUA 4A49A 3HHIA 2LXHC 1U6GB 2YT5A 2OZ2A 2UZGA 3VK6A 2VJEA 4UI9B 2CB5A 5CVOB 2XU1A 4BHWA 3GV4A 3OVZA 3HCSA 1GECE 2E00A 2CKLB 1N87A 1K2FA 5KH7A 2AUZA 1MEGA 1AIMA 1PPPA 3N9OA 5LKUA 2Y1NA 2F1GA 1KHPA 1ITOA 2JMDA 1NLJA 3P5XA 4MVTA 4QF3A 5TABA 3H6SA 2ATOA 3O37A 2AVWA 3ZTGA 3QJ3A 1SNKA 3O36A 3D6SA 3PDFA 2KE1A 3KSEA 1G25A 5TBNA 1YALA 1PXVA 2M3HA 4YVAA 2FUIA 2JMIA 3BWKA 2G7YA 4MZSA 4LJNA 2C2LA 4Q6FA 4YYUA 5CVMA 1QMYA 2YU4A 4BS5A 2PNSA 4MZOA 2XEUA 4W4UA 2LGLA 1X9YA 3P5WA 2LQ6A 4N4ZA 1NB3A 2YYRA 3MHHA 2QJ0A 5G05B 1JQPA 2R9CA 1NPZA 2AU1A 3LQHA 1WIMA 1QXPA 2KWKA 3N3GA 2QIZA 1WEMA 1EWPA 3O33A 5KH9A 1XKGA 2CSYA 3C6WA 5H1UA 1EWLA 4YV8A 3RVWA 1WEVA 3S3RA 4N3WA 1LDKC 1PE6A 5B76A 4O64A 2ACTA 1KHQA 2ECTA 1V87A 5C11A 2DCBA 1X4JA 1VYXA 2QICA 3V43A 3S3QA 2F42A 5J3XA 1U9QX 4QRGA 4OEMA 3SOXA 4B86C 2FT2A 4V3LC 2ARYA 2DCCA 1CJLA 5TRBA 3L1ZB 1ZBDB 4AXLA 9PAPA 4N8WA 4GNGA 1YK7A 1KFXL 1F2AA 3I06A 3O0UA 2E6SA 1TU6A 5G04B 2YSMA 2R6NA 4I04A 2MIQA 2PUYA 4YC9A 2GFOA 4AYCA 3OF9A 1F2CA 3N3KA 2LDRA 2KR4A 4YYWA 2XB1A 4FO9A 2DCAA 3P5UA 2ECJA 5FB1A 4A4BA 2L75A 1GMYA 2G43A 3N9NA 3H89A 3KV6A 5DINA 2PNXA 1YVBA 2M1RA 3N4CA 3DPLR 3LFYA 3SOUA 3OF8A 1WENA 2FSAA 2IPPB 3KWBX 4A0CD 2DC6A 3U8EA 3V6CA 2CSZA 5AITA 4CA1A 3I2DA 1YK8A 2KREA 1RMDA 2EA6A 3KFQA 5B8DA 3QZVA 4LKAA 4CZWA 3USVA 2VJFA 3N9MA 2YUCA 1VD4A 4PP1A 2H0DB 3IOQA 2K17A 1ZIVA 5FB0A 5D1LB 4BS6A 3IMAA 4CCGX 2K4DA 1MDWA 2Y5BA 4P6EA 2ECGA 4LK9A 3ZPV1 1Q6KA 3L1XA 2YHOA 3ASLA 4YYQA 5J94A 1TLOA 2LXPC 1SP4B 3OISA 1MEMA 4I7CA 1HUCB 2VPEA 3LRQA 6PADA 3F75A 4PI3A 4CDEB 3BCNA 2DCDA 1PPDA 1IYMA 2AYNA 4N79A 3B79A 2YSJA 1ME4A 1AU4A 4R8PK 4CDCB 2AS8A 2OP3A 4C9ZA 1YT7A 1DVPA 1STFE 3HD3A 4GB0A 4ZDTA 1MHWA 4YADA 4AVXA 2R9NA 3PNRA 3KQIA 1F62A 2YJ9A 1FP0A 2CKLA 2ECNA 1DF0A 4CDFB 4W5BA 2NQAA 4UP5A 5B77A 2C0YA 5CHTA 3WXEA 3M63A 3OVXA 4PTBA 2R9OA 5EF4A 4P6GA 4YYRA 1M6DA 4LADB 2KWOA 1AU3A 4FK5A 4GNEA 2JQGR 2P86A 3H8BA 2LRIC 1JM7B 2B1NA 2G6QA 2RI7A 2FQ9A 5JA7A 5F02A 2EODA 2MA5A 3N9PA 4ZQLA 5EYAF 2L80A 3NG2A 5CVNB 3RVVA 1S4VA 2WBFX 2ECVA 4A4CA 4QF2A 4XR7A 2AUXA 4WZ2A 4WA6A 1HYIA 4OELA 4YYSA 2BDZA 4CDDB 1HYJA 5FERA 1F29A 4IC3A 2P7UA 2KGIA 2MT5A 2FYEA 1LDJB 4AXMA 5TDWA 2G8JA 1CV8A 1XWHA 4QRXA 2L0BA 1NQCA 7PCKA 1NL6A 2E01A 2YQMA 2VNFA 2Y6EA 4WZ3B 2G6DA 1VFYA 1BY8A 2E6RA 4BPVA 1WEOA 3MHSA 2KWJA 3BPMA 1CHCA 4L58A 1JOCA 3T6RA 1VSNA 4IC2A 3K8UA 1F2BA 3HCTA 3KV5A 2DJGB 4F52B 2KIZA 2GHUA 1PPOA 2KYUA 1ZCMA 2AN6A 5B78A 5H1TA 2CIOA 8PCHA 5D1KB 1KFUL 3BPFA 3KNVA 3RPGB 4QH6A 1EWMA 3U5MA 1CB5A 3L11A 2C2VS 3H8CA 1AECA 3RPGC 2R9MA 1WILA 1AU0A 1DEUA 4W5CA 3RTRB 2VPDA 2VHFA 4YBTA 2M85A 1ATKA 1EF7A 3MTNA 4AUQB 4YAXA 3QT4A 2BAYA 3SHBA 4R7EA 2MNYA 1CPJA 5D1MB 2OULA 3EB6A 1BQIA 4DMXA 1FBVA 2VP7A 3K24A 1QDQA 4QBBA 2LN0A 2AYOA 3WXFA 1GCBA 5LKTA 5LCWB 5LKXA 4RY2A 5AIUA 4YYVA 4PP2E 4R2YA 1EWOA 3N9LA 1Y08A 3KWZA 2VPGA 4PADA 1CVZA 4HWYA 3M99A 2KFTA 5DKAA 2ECIA 1U9WA 2VPBA 4YBMA 3C5KA 1ICFA 3GCBA 1PBHA 4V3KC 3FL2A 2H0DA 4S3OB 2JMJA 2K1JA 3F5VA 3ZYQA 3PHDA 5LKZA 2BDLA 2LGVA 4FIPA 1Z60A 2G45A 3ZPVE 3HTKC 3NHEA 2CT2A 3PBHA 3QSDA 2YJ8A 2KU3A 2HHNA 1GLOA 3P5VA 3IUTA 3N9QA 2LGKA 2VJEB 4BQVA 2L43A 1AU2A 2DC9A 3M62A 3PUQA 1CSBB 2DC8A 4LLBA 2HD5A 2VHSA 3IHPA 4BSQA 1BGOA 2NAAA 5EGWA 2Y1MA 4YBSA 3K9MA
chains in the Genus database with same CATH superfamily
2YREA 4L7XA 2IBIA 5H1VA 4G54A 1KXRA 3IEJA 2KWNA 2XOZA 1A6RA 1WGMA 2DSMA 3TNXA 3O70A 5A24A 2NQDB 1WEQA 2CRWA 2JRJA 5K16A 3E2DA 2HXZA 2HYED 3CBKA 4BOZA 2MD8C 1YZBA 4GNDA 2JQFR 2PADA 3CH2X 3T7LA 1MM2A 3V6EA 4FJCA 3MTVA 5PADA 2CSVA 1JM7A 2F7DA 2LGGA 4B7YC 2DZYA 3EB5A 4NN2A 1E4UA 2PREA 1AYUA 1X4IA 3PW3A 2YJ2A 2G8EA 1VJVA 2E02A 5TDRA 2NQGA 1MS6A 4YABA 3SUBA 4REZA 2F6NA 4I7BA 5JH3A 3C9EA 3DQVR 2R9FA 3I3TA 5H9MA 3CBJA 1WEWA 4X3GA 1MIRA 4GNFA 1WEPA 3BC3A 4XUIA 2Y43A 2OXQC 3O34A 5SVIB 1WEEA 3ZNIA 1Z2QA 3LJUX 2MD7B 1Z6UA 2MNZA 2YW8A 4XI1A 5B79A 2E03A 4KLBA 3BB7A 2FRQA 3HHAA 2FTDA 2XU4A 1WESA 1NB5A 2FRAA 1BORA 4QRVA 2DC7A 3U5NA 3U5PA 2DJFB 2JTCA 1U9XA 1PVJA 2AIMA 3ZUAA 3PURA 3ZVZB 2FE8A 2ECWA 2YJBA 3LDYA 1FH0A 4Q8GA 3H7DA 2HDPA 5CHVA 4UP0A 1MM3A 5E6JA 3H7HA 4Q8HA 2DX8A 3E1ZB 3PHWA 3U5OA 4MSXA 2LV9A 3LQJA 4DMYA 1X4UA 2MKEA 2RSDA 4P16A 1PCIA 3W30A 1Y4HA 3RVXA 2DZZA 4X6IA 1ME3A 1PPNA 1U9VA 3KW9A 4AYCB 4X6HA 1WFKA 2NQIA 1WE9A 2YQLA 4YATA 3O7AA 4D8BA 3ERVA 1IWDA 1O0EA 3IV2A 2XU3A 3HWNA 3O35A 1K3BB 2L5UA 2MA6A 4BBQA 5B75A 4I7DA 1AYWA 1CTEA 3LQIA 4P5OB 1THEA 4N4FA 4BOQA 2FUDA 3DDTA 2I50A 5C13A 5EZQA 3LXSA 2ZETC 2D8UA 2JUNA 2F6JA 3ZVYA 5I3LA 2B1MA 2HH5A 1MBMA 2KGGA 5JG6A 1QOLA 2O6XA 3DF0A 2EGPA 2YJCA 2P0RA 1BP4A 2E61A 4O62A 1U5IA 1T1HA 2JRIA 2YHNA 2H7JA 3IFUA 3AI8A 2K16A 2HWKA 3WXGA 3MORA 3SOWA 2VJFB 3KX1A 3GL6A 5FPWA 1WEUA 1AYVA 1PIPA 2PBHA 4TKPB 1CS8A 4I05A 2YURA 4I07A 2IDAA 5KH3A 3CH3X 2XU5A 2M6MA 1POPA 3O1GA 4AP4A 4S3OC 4WZ0A 2MUMA 5FEYA 4ZUXU 3MP2A 2FUUA 5G0FA 2D8SA 1TL9A 4OW0A 4ZTBA 2FO5A 4IP3A 1CQDA 4PPEA 3BOWA 2J7QC 1PADA 3KKUA 4X6JA 2CONA 4K7CA 3HCUA 4A49A 3HHIA 4HXDB 2FD4A 2LXHC 1U6GB 2YT5A 2OZ2A 2UZGA 3VK6A 4OVZB 2VJEA 2KKXA 4UI9B 2CB5A 5CVOB 2XU1A 4BHWA 3GV4A 3OVZA 3HCSA 1GECE 2EGMA 4D8IA 2DOSA 2E00A 2CKLB 1N87A 1K2FA 5KH7A 2AUZA 1MEGA 1AIMA 1PPPA 3N9OA 5LKUA 2Y1NA 2F1GA 1KHPA 1ITOA 2JMDA 1NLJA 3P5XA 4MVTA 4QF3A 5TABA 3H6SA 2ATOA 4BOUA 3O37A 2AVWA 2OWAA 3ZTGA 3QJ3A 4RF1A 1SNKA 3O36A 3D6SA 3PDFA 2KE1A 3KSEA 1G25A 5TBNA 3LVQE 1YALA 1PXVA 2M3HA 4YVAA 2FUIA 2JMIA 3BWKA 2G7YA 4MZSA 4LJNA 2C2LA 4Q6FA 3E9SA 5CVMA 4YYUA 1QMYA 2YU4A 4BS5A 2PNSA 4MZOA 4GUAA 2XEUA 2BTWB 4W4UA 2LGLA 1X9YA 3P5WA 2LQ6A 4N4ZA 1NB3A 2YYRA 3MHHA 2QJ0A 5G05B 1JQPA 2R9CA 1NPZA 2AU1A 3LQHA 1WIMA 1QXPA 2KWKA 3N3GA 2QIZA 1WEMA 1EWPA 3O33A 4RF0A 5KH9A 1XKGA 2CSYA 3C6WA 5H1UA 1EWLA 4YV8A 3PT2A 3RVWA 1WEVA 4Z0OA 4N3WA 3S3RA 1LDKC 1PE6A 5B76A 5SVIA 4O64A 2ACTA 1KHQA 2ECTA 1V87A 2YVRA 5C11A 2DCBA 1X4JA 1VYXA 2QICA 3V43A 3S3QA 5JZEA 2F42A 5J3XA 2XOCA 1U9QX 4QRGA 4OEMA 3SOXA 4B86C 2FT2A 4V3LC 2ARYA 2DCCA 1CJLA 3PLWA 2FFWA 5TRBA 3PRPA 3L1ZB 1ZBDB 4OGEA 4AXLA 9PAPA 4N8WA 4GNGA 1YK7A 1KFXL 1F2AA 3I06A 3O0UA 2E6SA 2RR4A 5G04B 1TU6A 2YSMA 2AGAA 2R6NA 4I04A 2MIQA 2PUYA 4YC9A 2GFOA 4AYCA 3OF9A 1F2CA 3N3KA 4MM3B 2LDRA 2KR4A 4YYWA 2XB1A 4FO9A 2DCAA 1DKIA 3P5UA 2ECJA 3FANA 5FB1A 4A4BA 2L75A 3M7KA 1GMYA 2G43A 3N9NA 3H89A 3KV6A 3JUEA 5DINA 2PNXA 1YVBA 2M1RA 3N4CA 3DPLR 4QQ4A 3LFYA 3Q1DA 3SOUA 2UZJA 3OF8A 1WENA 2FSAA 2IPPB 3KWBX 4A0CD 2DC6A 3U8EA 3V6CA 2CSZA 3TMPA 4IUMA 2BU3A 5AITA 4CA1A 3I2DA 1YK8A 2KREA 1RMDA 2EA6A 3KFQA 5B8DA 3QZVA 4LKAA 4CZWA 3USVA 2VJFA 1DCQA 3N9MA 2YUCA 1VD4A 4R3DA 3RNVA 4PP1A 3BBAA 2H0DB 3IOQA 2K17A 1ZIVA 5FB0A 5D1LB 4BS6A 3IMAA 4CCGX 2K4DA 1MDWA 2Y5BA 4P6EA 2ECGA 4LK9A 3ZPV1 2Z84A 1Q6KA 3L1XA 2YHOA 3ASLA 2J7QA 3BY4A 1TLOA 5J94A 4YYQA 2LXPC 1SP4B 3OISA 1MEMA 4I7CA 4RNAA 4OGCA 1HUCB 2VPEA 3LRQA 6PADA 3F75A 4PI3A 4CDEB 3BCNA 2DCDA 1PPDA 1IYMA 2AYNA 4N79A 3LVRE 3ZNHA 3B79A 2YSJA 1ME4A 1AU4A 4R8PK 4OVZA 4CDCB 2AS8A 2OP3A 3PHUA 5K3QA 4C9ZA 1YT7A 1DVPA 1STFE 3HD3A 4GB0A 4ZDTA 1MHWA 4YADA 4AVXA 2R9NA 3PNRA 3KQIA 1F62A 2YJ9A 1FP0A 2CKLA 2ECNA 1DF0A 4CDFB 4W5BA 2NQAA 4UP5A 5B77A 2C0YA 5CHTA 3WXEA 3M63A 3OVXA 4PTBA 2R9OA 5EF4A 4P6GA 4YYRA 1M6DA 4LADB 2KWOA 1AU3A 4FK5A 4GNEA 2JQGR 2P86A 2XOYA 3H8BA 2LRIC 1JM7B 2B1NA 2G6QA 2RI7A 2FQ9A 5JA7A 5F02A 2EODA 2MA5A 3N9PA 4ZQLA 5EYAF 2L80A 3NG2A 5CVNB 3RVVA 1S4VA 5SVYA 2WBFX 3MJ5A 2EXUA 2ECVA 2BTWA 5EZSA 4A4CA 4QF2A 4XR7A 2AUXA 4WZ2A 4WA6A 1HYIA 3PHXA 4OELA 4YYSA 2BDZA 4CDDB 1HYJA 5FERA 1F29A 4IC3A 2P7UA 2KGIA 2MT5A 2FYEA 1LDJB 4AXMA 5TDWA 2G8JA 1CV8A 1XWHA 4QRXA 4H9DA 2L0BA 1NQCA 7PCKA 3PRMA 1NL6A 2E01A 2YQMA 2VNFA 2Y6EA 4WZ3B 3T9KA 2G6DA 1VFYA 1BY8A 2E6RA 4BPVA 1WEOA 3MHSA 2KWJA 3BPMA 1CHCA 4L58A 1JOCA 3T6RA 1VSNA 4IC2A 3K8UA 1F2BA 3HCTA 3KV5A 2DJGB 4F52B 3FEHA 2KIZA 2GHUA 1PPOA 2KYUA 1ZCMA 3FJUB 2AN6A 1UKFA 5B78A 5H1TA 2CIOA 8PCHA 5D1KB 1KFUL 3BPFA 3KNVA 3RPGB 4QH6A 3DWDA 4XZXA 4A5UA 1EWMA 3PSEA 2JM3A 3U5MA 1CB5A 4M0WA 2DJAA 2C2VS 3L11A 3H8CA 1AECA 3RPGC 2R9MA 1WILA 1AU0A 1DEUA 2XP0A 4W5CA 4D8EA 3RTRB 2VPDA 2VHFA 4YBTA 2M85A 1ATKA 1EF7A 3MTNA 4AUQB 4YAXA 3QT4A 2BAYA 4WURA 3SHBA 2CRRA 3KDEC 2KKYA 4R7EA 2MNYA 1CPJA 5D1MB 2OULA 3EB6A 3C0RA 1BQIA 4DMXA 1FBVA 2VP7A 3K24A 1QDQA 4QBBA 2LN0A 2AYOA 3WXFA 1GCBA 5LKTA 5LCWB 4F1PA 5LKXA 2LAUA 4RY2A 5AIUA 4YYVA 4PP2E 4R2YA 1EWOA 3N9LA 1Y08A 3KWZA 2VPGA 4PADA 1CVZA 4HWYA 5KO3A 3M99A 2KFTA 5DKAA 2ECIA 4PT5A 2B0OE 3OQCA 1U9WA 2VPBA 4YBMA 3C5KA 4BOPA 2M13A 1ICFA 3GCBA 1PBHA 4V3KC 4BOSA 3FL2A 2H0DA 4S3OB 2JMJA 2K1JA 3F5VA 3ZYQA 3PHDA 5LKZA 2BDLA 2LGVA 4FIPA 1Z60A 2G45A 3ZPVE 3HTKC 3NHEA 2CT2A 3PBHA 3QSDA 4Z0RA 2YJ8A 2KU3A 2HHNA 1GLOA 3P5VA 3IUTA 3N9QA 2LGKA 2VJEB 4BQVA 3FAOA 2P57A 4RKXA 2L43A 2L7PA 1AU2A 3W31A 3O47A 2DC9A 3M62A 5SVXA 3TRKA 3PUQA 1CSBB 2DC8A 4LLBA 2HD5A 3B21A 2VHSA 3IHPA 3FM8C 3MDBC 4BSQA 4MI7A 1BGOA 2NAAA 5EGWA 2Y1MA 4YBSA 2IQJA 3K9MA 3O65A
chains in the Genus database with same CATH topology
2YREA 4L7XA 2IBIA 5H1VA 4G54A 1KXRA 3IEJA 2KWNA 1A6RA 1WGMA 3TNXA 3O70A 5A24A 2NQDB 1WEQA 2JRJA 5K16A 2HXZA 2HYED 3CBKA 2MD8C 4GNDA 2JQFR 2PADA 3CH2X 3T7LA 1MM2A 3V6EA 4FJCA 5PADA 1JM7A 2F7DA 2LGGA 4B7YC 2DZYA 3EB5A 4NN2A 1E4UA 2PREA 1AYUA 1X4IA 3PW3A 2YJ2A 2G8EA 1VJVA 2E02A 5TDRA 2NQGA 1MS6A 4YABA 2F6NA 4I7BA 5JH3A 3C9EA 3DQVR 2R9FA 3I3TA 5H9MA 3CBJA 1WEWA 4X3GA 1MIRA 4GNFA 1WEPA 3BC3A 4XUIA 2Y43A 2OXQC 3O34A 1WEEA 3ZNIA 1Z2QA 3LTWA 2MD7B 1Z6UA 2MNZA 2YW8A 4XI1A 5B79A 2E03A 4KLBA 2FRQA 3HHAA 2FTDA 2XU4A 1WESA 1NB5A 2FRAA 1BORA 4QRVA 2DC7A 3U5NA 3U5PA 2DJFB 1U9XA 2AIMA 3ZUAA 3PURA 3ZVZB 2YJBA 2ECWA 4Q8GA 1FH0A 3H7DA 2HDPA 5CHVA 2VFCA 4UP0A 1MM3A 4Q8HA 2DX8A 3E1ZB 3U5OA 4MSXA 2LV9A 3LQJA 4DMYA 1X4UA 2RSDA 1PCIA 1Y4HA 3RVXA 2DZZA 4X6IA 1ME3A 1PPNA 1U9VA 3KW9A 4AYCB 4X6HA 1WFKA 2NQIA 1WE9A 2YQLA 4YATA 3O7AA 3ERVA 1IWDA 1O0EA 3IV2A 2XU3A 3HWNA 3O35A 1K3BB 2L5UA 2MA6A 4BBQA 5B75A 4I7DA 1AYWA 1CTEA 3LQIA 4P5OB 1THEA 4N4FA 2FUDA 2I50A 5C13A 3LXSA 2ZETC 2F6JA 3ZVYA 5I3LA 2B1MA 2HH5A 2KGGA 5JG6A 1QOLA 2O6XA 3DF0A 2EGPA 2YJCA 2P0RA 1BP4A 1U5IA 1T1HA 2YHNA 2H7JA 3AI8A 2K16A 3WXGA 3MORA 3SOWA 2VJFB 3KX1A 3GL6A 5FPWA 1WEUA 1AYVA 1PIPA 2PBHA 4TKPB 1CS8A 4I05A 2YURA 4I07A 2IDAA 5KH3A 2BSZA 3CH3X 2XU5A 2M6MA 1POPA 3O1GA 4AP4A 4S3OC 4WZ0A 2MUMA 5FEYA 4ZUXU 4BGFA 2FUUA 5G0FA 2D8SA 1TL9A 2FO5A 1CQDA 4PPEA 3BOWA 3KKUA 1PADA 4X6JA 4K7CA 3HCUA 4A49A 3HHIA 2LXHC 1U6GB 2YT5A 2OZ2A 2UZGA 3VK6A 4NV8A 2VJEA 4UI9B 2CB5A 5CVOB 2XU1A 4BHWA 3GV4A 3OVZA 3HCSA 1GECE 2E00A 2CKLB 1N87A 1K2FA 5KH7A 2AUZA 1MEGA 1AIMA 1PPPA 3N9OA 5LKUA 2Y1NA 2F1GA 1KHPA 1ITOA 2JMDA 1NLJA 3P5XA 4MVTA 4QF3A 5TABA 3H6SA 2ATOA 3O37A 2AVWA 3ZTGA 3QJ3A 1SNKA 3O36A 3D6SA 3PDFA 2KE1A 3KSEA 1G25A 5TBNA 2VFBA 1YALA 1PXVA 2M3HA 4YVAA 2FUIA 2JMIA 1W6FA 2G7YA 3BWKA 4MZSA 4LJNA 2C2LA 4Q6FA 4YYUA 5CVMA 1QMYA 2YU4A 4BS5A 2PNSA 4MZOA 2XEUA 4W4UA 2LGLA 1X9YA 3P5WA 2LQ6A 4N4ZA 1NB3A 2YYRA 3MHHA 2QJ0A 5G05B 1JQPA 2R9CA 1NPZA 2AU1A 3LQHA 1WIMA 1QXPA 2KWKA 3N3GA 2QIZA 1WEMA 1EWPA 3O33A 5KH9A 1XKGA 2CSYA 3C6WA 5H1UA 1EWLA 4YV8A 3RVWA 1WEVA 1W4TA 3S3RA 4N3WA 1LDKC 1PE6A 5B76A 4O64A 2ACTA 1KHQA 2ECTA 1V87A 5C11A 2DCBA 1X4JA 1VYXA 2QICA 3V43A 3S3QA 2F42A 5J3XA 1U9QX 4QRGA 4OEMA 3SOXA 4B86C 2FT2A 4V3LC 2ARYA 2DCCA 1CJLA 5TRBA 3L1ZB 1ZBDB 4AXLA 9PAPA 4N8WA 4GNGA 1YK7A 1KFXL 1F2AA 3I06A 3O0UA 2E6SA 1TU6A 5G04B 2YSMA 1E2TA 2R6NA 4I04A 2MIQA 2PUYA 4YC9A 2GFOA 4AYCA 3OF9A 1F2CA 3N3KA 2LDRA 2KR4A 4YYWA 2XB1A 4FO9A 4GUZA 2DCAA 3P5UA 2ECJA 5FB1A 4A4BA 2L75A 1GMYA 2G43A 3N9NA 3H89A 3KV6A 5DINA 2PNXA 1YVBA 2M1RA 3N4CA 3DPLR 3LFYA 3SOUA 3OF8A 1WENA 2FSAA 2IPPB 3KWBX 4A0CD 2DC6A 3U8EA 3V6CA 2CSZA 5AITA 4CA1A 3I2DA 1YK8A 2KREA 1RMDA 2EA6A 3KFQA 5B8DA 3QZVA 4LKAA 4CZWA 3USVA 2VJFA 3N9MA 2YUCA 1VD4A 4PP1A 2H0DB 3IOQA 1W5RA 2K17A 1ZIVA 5FB0A 5D1LB 4BS6A 3IMAA 4CCGX 2K4DA 1MDWA 2Y5BA 4P6EA 2ECGA 4LK9A 3ZPV1 1Q6KA 3L1XA 2YHOA 3ASLA 4YYQA 5J94A 1TLOA 2LXPC 1SP4B 3OISA 1MEMA 4I7CA 1HUCB 2VPEA 3LRQA 3D9WA 6PADA 3F75A 4PI3A 4CDEB 3BCNA 2DCDA 1PPDA 1IYMA 2AYNA 4N79A 3B79A 2YSJA 1ME4A 1AU4A 4R8PK 4CDCB 2AS8A 2OP3A 4C9ZA 1YT7A 1DVPA 1STFE 3HD3A 4GB0A 4ZDTA 1MHWA 4YADA 4AVXA 2R9NA 3PNRA 3KQIA 1F62A 2YJ9A 1FP0A 2CKLA 2ECNA 1DF0A 4CDFB 4W5BA 2NQAA 4UP5A 5B77A 2C0YA 5CHTA 3WXEA 3M63A 3OVXA 4PTBA 2R9OA 5EF4A 4P6GA 4YYRA 1M6DA 4NV7A 4LADB 2KWOA 1AU3A 4FK5A 4GNEA 2JQGR 2P86A 3H8BA 2LRIC 1JM7B 2B1NA 2G6QA 2RI7A 2FQ9A 5JA7A 5F02A 2EODA 2MA5A 3N9PA 4ZQLA 5EYAF 2L80A 3NG2A 5CVNB 3RVVA 1S4VA 2WBFX 2ECVA 4A4CA 4QF2A 4XR7A 2AUXA 4WZ2A 4WA6A 1HYIA 4OELA 4YYSA 2BDZA 4CDDB 1HYJA 5FERA 1F29A 4IC3A 2P7UA 2KGIA 2MT5A 2FYEA 1LDJB 4AXMA 5TDWA 2G8JA 1CV8A 1XWHA 4QRXA 2L0BA 1NQCA 7PCKA 1NL6A 2E01A 2YQMA 2VNFA 2Y6EA 4WZ3B 2G6DA 1VFYA 1BY8A 2E6RA 4BPVA 1WEOA 3MHSA 2KWJA 3BPMA 1CHCA 4L58A 1JOCA 3T6RA 1VSNA 4IC2A 3K8UA 1F2BA 3HCTA 3KV5A 2DJGB 4F52B 2KIZA 2GHUA 1PPOA 2KYUA 1ZCMA 2AN6A 5B78A 5H1TA 2CIOA 8PCHA 5D1KB 1KFUL 3BPFA 3KNVA 3RPGB 4QH6A 1EWMA 3U5MA 1CB5A 1GX3A 3L11A 2C2VS 3H8CA 1AECA 3RPGC 2R9MA 1WILA 1AU0A 1DEUA 4W5CA 3RTRB 2VPDA 2VHFA 4YBTA 2M85A 1ATKA 1EF7A 3MTNA 4AUQB 4YAXA 3QT4A 2BAYA 3SHBA 4R7EA 2MNYA 1CPJA 5D1MB 2OULA 3EB6A 1BQIA 4DMXA 1FBVA 2VP7A 3K24A 1QDQA 4QBBA 2LN0A 2AYOA 3WXFA 1GCBA 5LKTA 5LCWB 5LKXA 4RY2A 5AIUA 4YYVA 4PP2E 4R2YA 1EWOA 3N9LA 1Y08A 3KWZA 2VPGA 4PADA 1CVZA 4HWYA 3M99A 2KFTA 5DKAA 2ECIA 1U9WA 2VPBA 4YBMA 3C5KA 1ICFA 3GCBA 1PBHA 4V3KC 4B55A 3FL2A 4C5PA 2H0DA 4S3OB 2JMJA 2K1JA 3F5VA 3ZYQA 3PHDA 5LKZA 2BDLA 2LGVA 4FIPA 1Z60A 2G45A 3ZPVE 3HTKC 3NHEA 2CT2A 3PBHA 3QSDA 2YJ8A 2KU3A 2HHNA 1GLOA 3P5VA 3IUTA 3N9QA 2LGKA 2VJEB 4BQVA 2L43A 1AU2A 2DC9A 3M62A 3PUQA 1CSBB 2DC8A 4LLBA 2HD5A 2VHSA 3IHPA 4BSQA 1BGOA 2NAAA 5EGWA 2Y1MA 4YBSA 3K9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YRE A;  4L7X A;  2IBI A;  5H1V A;  4G54 A;  1KXR A;  3IEJ A;  2KWN A;  1A6R A;  1WGM A;  3TNX A;  3O70 A;  5A24 A;  2NQD B;  1WEQ A;  2JRJ A;  5K16 A;  2HXZ A;  2HYE D;  3CBK A;  2MD8 C;  4GND A;  2JQF R;  2PAD A;  3CH2 X;  3T7L A;  1MM2 A;  3V6E A;  4FJC A;  5PAD A;  1JM7 A;  2F7D A;  2LGG A;  4B7Y C;  2DZY A;  3EB5 A;  4NN2 A;  1E4U A;  2PRE A;  1AYU A;  1X4I A;  3PW3 A;  2YJ2 A;  2G8E A;  1VJV A;  2E02 A;  5TDR A;  2NQG A;  1MS6 A;  4YAB A;  2F6N A;  4I7B A;  5JH3 A;  3C9E A;  3DQV R;  2R9F A;  3I3T A;  5H9M A;  3CBJ A;  1WEW A;  4X3G A;  1MIR A;  4GNF A;  1WEP A;  3BC3 A;  4XUI A;  2Y43 A;  2OXQ C;  3O34 A;  1WEE A;  3ZNI A;  1Z2Q A;  2MD7 B;  1Z6U A;  2MNZ A;  2YW8 A;  4XI1 A;  5B79 A;  2E03 A;  4KLB A;  2FRQ A;  3HHA A;  2FTD A;  2XU4 A;  1WES A;  1NB5 A;  2FRA A;  1BOR A;  4QRV A;  2DC7 A;  3U5N A;  3U5P A;  2DJF B;  1U9X A;  2AIM A;  3ZUA A;  3PUR A;  3ZVZ B;  2YJB A;  2ECW A;  4Q8G A;  1FH0 A;  3H7D A;  2HDP A;  5CHV A;  4UP0 A;  1MM3 A;  4Q8H A;  2DX8 A;  3E1Z B;  3U5O A;  4MSX A;  2LV9 A;  3LQJ A;  4DMY A;  1X4U A;  2RSD A;  1PCI A;  1Y4H A;  3RVX A;  2DZZ A;  4X6I A;  1ME3 A;  1PPN A;  1U9V A;  3KW9 A;  4AYC B;  4X6H A;  1WFK A;  2NQI A;  1WE9 A;  2YQL A;  4YAT A;  3O7A A;  3ERV A;  1IWD A;  1O0E A;  3IV2 A;  2XU3 A;  3HWN A;  3O35 A;  1K3B B;  2L5U A;  2MA6 A;  4BBQ A;  5B75 A;  4I7D A;  1AYW A;  1CTE A;  3LQI A;  4P5O B;  1THE A;  4N4F A;  2FUD A;  2I50 A;  5C13 A;  3LXS A;  2ZET C;  2F6J A;  3ZVY A;  5I3L A;  2B1M A;  2HH5 A;  2KGG A;  5JG6 A;  1QOL A;  2O6X A;  3DF0 A;  2EGP A;  2YJC A;  2P0R A;  1BP4 A;  1U5I A;  1T1H A;  2YHN A;  2H7J A;  3AI8 A;  2K16 A;  3WXG A;  3MOR A;  3SOW A;  2VJF B;  3KX1 A;  3GL6 A;  5FPW A;  1WEU A;  1AYV A;  1PIP A;  2PBH A;  4TKP B;  1CS8 A;  4I05 A;  2YUR A;  4I07 A;  2IDA A;  5KH3 A;  3CH3 X;  2XU5 A;  2M6M A;  1POP A;  3O1G A;  4AP4 A;  4S3O C;  4WZ0 A;  2MUM A;  5FEY A;  4ZUX U;  2FUU A;  5G0F A;  2D8S A;  1TL9 A;  2FO5 A;  1CQD A;  4PPE A;  3BOW A;  3KKU A;  1PAD A;  4X6J A;  4K7C A;  3HCU A;  4A49 A;  3HHI A;  2LXH C;  1U6G B;  2YT5 A;  2OZ2 A;  2UZG A;  3VK6 A;  2VJE A;  4UI9 B;  2CB5 A;  5CVO B;  2XU1 A;  4BHW A;  3GV4 A;  3OVZ A;  3HCS A;  1GEC E;  2E00 A;  2CKL B;  1N87 A;  1K2F A;  5KH7 A;  2AUZ A;  1MEG A;  1AIM A;  1PPP A;  3N9O A;  5LKU A;  2Y1N A;  2F1G A;  1KHP A;  1ITO A;  2JMD A;  1NLJ A;  3P5X A;  4MVT A;  4QF3 A;  5TAB A;  3H6S A;  2ATO A;  3O37 A;  2AVW A;  3ZTG A;  3QJ3 A;  1SNK A;  3O36 A;  3D6S A;  3PDF A;  2KE1 A;  3KSE A;  1G25 A;  5TBN A;  1YAL A;  1PXV A;  2M3H A;  4YVA A;  2FUI A;  2JMI A;  3BWK A;  2G7Y A;  4MZS A;  4LJN A;  2C2L A;  4Q6F A;  4YYU A;  5CVM A;  1QMY A;  2YU4 A;  4BS5 A;  2PNS A;  4MZO A;  2XEU A;  4W4U A;  2LGL A;  1X9Y A;  3P5W A;  2LQ6 A;  4N4Z A;  1NB3 A;  2YYR A;  3MHH A;  2QJ0 A;  5G05 B;  1JQP A;  2R9C A;  1NPZ A;  2AU1 A;  3LQH A;  1WIM A;  1QXP A;  2KWK A;  3N3G A;  2QIZ A;  1WEM A;  1EWP A;  3O33 A;  5KH9 A;  1XKG A;  2CSY A;  3C6W A;  5H1U A;  1EWL A;  4YV8 A;  3RVW A;  1WEV A;  3S3R A;  4N3W A;  1LDK C;  1PE6 A;  5B76 A;  4O64 A;  2ACT A;  1KHQ A;  2ECT A;  1V87 A;  5C11 A;  2DCB A;  1X4J A;  1VYX A;  2QIC A;  3V43 A;  3S3Q A;  2F42 A;  5J3X A;  1U9Q X;  4QRG A;  4OEM A;  3SOX A;  4B86 C;  2FT2 A;  4V3L C;  2ARY A;  2DCC A;  1CJL A;  5TRB A;  3L1Z B;  1ZBD B;  4AXL A;  9PAP A;  4N8W A;  4GNG A;  1YK7 A;  1KFX L;  1F2A A;  3I06 A;  3O0U A;  2E6S A;  1TU6 A;  5G04 B;  2YSM A;  2R6N A;  4I04 A;  2MIQ A;  2PUY A;  4YC9 A;  2GFO A;  4AYC A;  3OF9 A;  1F2C A;  3N3K A;  2LDR A;  2KR4 A;  4YYW A;  2XB1 A;  4FO9 A;  2DCA A;  3P5U A;  2ECJ A;  5FB1 A;  4A4B A;  2L75 A;  1GMY A;  2G43 A;  3N9N A;  3H89 A;  3KV6 A;  5DIN A;  2PNX A;  1YVB A;  2M1R A;  3N4C A;  3DPL R;  3LFY A;  3SOU A;  3OF8 A;  1WEN A;  2FSA A;  2IPP B;  3KWB X;  4A0C D;  2DC6 A;  3U8E A;  3V6C A;  2CSZ A;  5AIT A;  4CA1 A;  3I2D A;  1YK8 A;  2KRE A;  1RMD A;  2EA6 A;  3KFQ A;  5B8D A;  3QZV A;  4LKA A;  4CZW A;  3USV A;  2VJF A;  3N9M A;  2YUC A;  1VD4 A;  4PP1 A;  2H0D B;  3IOQ A;  2K17 A;  1ZIV A;  5FB0 A;  5D1L B;  4BS6 A;  3IMA A;  4CCG X;  2K4D A;  1MDW A;  2Y5B A;  4P6E A;  2ECG A;  4LK9 A;  3ZPV 1;  1Q6K A;  3L1X A;  2YHO A;  3ASL A;  4YYQ A;  5J94 A;  1TLO A;  2LXP C;  1SP4 B;  3OIS A;  1MEM A;  4I7C A;  1HUC B;  2VPE A;  3LRQ A;  6PAD A;  3F75 A;  4PI3 A;  4CDE B;  3BCN A;  2DCD A;  1PPD A;  1IYM A;  2AYN A;  4N79 A;  3B79 A;  2YSJ A;  1ME4 A;  1AU4 A;  4R8P K;  4CDC B;  2AS8 A;  2OP3 A;  4C9Z A;  1YT7 A;  1DVP A;  1STF E;  3HD3 A;  4GB0 A;  4ZDT A;  1MHW A;  4YAD A;  4AVX A;  2R9N A;  3PNR A;  3KQI A;  1F62 A;  2YJ9 A;  1FP0 A;  2CKL A;  2ECN A;  1DF0 A;  4CDF B;  4W5B A;  2NQA A;  4UP5 A;  5B77 A;  2C0Y A;  5CHT A;  3WXE A;  3M63 A;  3OVX A;  4PTB A;  2R9O A;  5EF4 A;  4P6G A;  4YYR A;  1M6D A;  4LAD B;  2KWO A;  1AU3 A;  4FK5 A;  4GNE A;  2JQG R;  2P86 A;  3H8B A;  2LRI C;  1JM7 B;  2B1N A;  2G6Q A;  2RI7 A;  2FQ9 A;  5JA7 A;  5F02 A;  2EOD A;  2MA5 A;  3N9P A;  4ZQL A;  5EYA F;  2L80 A;  3NG2 A;  5CVN B;  3RVV A;  1S4V A;  2WBF X;  2ECV A;  4A4C A;  4QF2 A;  4XR7 A;  2AUX A;  4WZ2 A;  4WA6 A;  1HYI A;  4OEL A;  4YYS A;  2BDZ A;  4CDD B;  1HYJ A;  5FER A;  1F29 A;  4IC3 A;  2P7U A;  2KGI A;  2MT5 A;  2FYE A;  1LDJ B;  4AXM A;  5TDW A;  2G8J A;  1CV8 A;  1XWH A;  4QRX A;  2L0B A;  1NQC A;  7PCK A;  1NL6 A;  2E01 A;  2YQM A;  2VNF A;  2Y6E A;  4WZ3 B;  2G6D A;  1VFY A;  1BY8 A;  2E6R A;  4BPV A;  1WEO A;  3MHS A;  2KWJ A;  3BPM A;  1CHC A;  4L58 A;  1JOC A;  3T6R A;  1VSN A;  4IC2 A;  3K8U A;  1F2B A;  3HCT A;  3KV5 A;  2DJG B;  4F52 B;  2KIZ A;  2GHU A;  1PPO A;  2KYU A;  1ZCM A;  2AN6 A;  5B78 A;  5H1T A;  2CIO A;  8PCH A;  5D1K B;  1KFU L;  3BPF A;  3KNV A;  3RPG B;  4QH6 A;  1EWM A;  3U5M A;  1CB5 A;  3L11 A;  2C2V S;  3H8C A;  1AEC A;  3RPG C;  2R9M A;  1WIL A;  1AU0 A;  1DEU A;  4W5C A;  3RTR B;  2VPD A;  2VHF A;  4YBT A;  2M85 A;  1ATK A;  1EF7 A;  3MTN A;  4AUQ B;  4YAX A;  3QT4 A;  2BAY A;  3SHB A;  4R7E A;  2MNY A;  1CPJ A;  5D1M B;  2OUL A;  3EB6 A;  1BQI A;  4DMX A;  1FBV A;  2VP7 A;  3K24 A;  1QDQ A;  4QBB A;  2LN0 A;  2AYO A;  3WXF A;  1GCB A;  5LKT A;  5LCW B;  5LKX A;  4RY2 A;  5AIU A;  4YYV A;  4PP2 E;  4R2Y A;  1EWO A;  3N9L A;  1Y08 A;  3KWZ A;  2VPG A;  4PAD A;  1CVZ A;  4HWY A;  3M99 A;  2KFT A;  5DKA A;  2ECI A;  1U9W A;  2VPB A;  4YBM A;  3C5K A;  1ICF A;  3GCB A;  1PBH A;  4V3K C;  3FL2 A;  2H0D A;  4S3O B;  2JMJ A;  2K1J A;  3F5V A;  3ZYQ A;  3PHD A;  5LKZ A;  2BDL A;  2LGV A;  4FIP A;  1Z60 A;  2G45 A;  3ZPV E;  3HTK C;  3NHE A;  2CT2 A;  3PBH A;  3QSD A;  2YJ8 A;  2KU3 A;  2HHN A;  1GLO A;  3P5V A;  3IUT A;  3N9Q A;  2LGK A;  2VJE B;  4BQV A;  2L43 A;  1AU2 A;  2DC9 A;  3M62 A;  3PUQ A;  1CSB B;  2DC8 A;  4LLB A;  2HD5 A;  2VHS A;  3IHP A;  4BSQ A;  1BGO A;  2NAA A;  5EGW A;  2Y1M A;  4YBS A;  3K9M A; 
#chains in the Genus database with same CATH topology
 2YRE A;  4L7X A;  2IBI A;  5H1V A;  4G54 A;  1KXR A;  3IEJ A;  2KWN A;  2XOZ A;  1A6R A;  1WGM A;  2DSM A;  3TNX A;  3O70 A;  5A24 A;  2NQD B;  1WEQ A;  2CRW A;  2JRJ A;  5K16 A;  3E2D A;  2HXZ A;  2HYE D;  3CBK A;  4BOZ A;  2MD8 C;  1YZB A;  4GND A;  2JQF R;  2PAD A;  3CH2 X;  3T7L A;  1MM2 A;  3V6E A;  4FJC A;  3MTV A;  5PAD A;  2CSV A;  1JM7 A;  2F7D A;  2LGG A;  4B7Y C;  2DZY A;  3EB5 A;  4NN2 A;  1E4U A;  2PRE A;  1AYU A;  1X4I A;  3PW3 A;  2YJ2 A;  2G8E A;  1VJV A;  2E02 A;  5TDR A;  2NQG A;  1MS6 A;  4YAB A;  3SUB A;  4REZ A;  2F6N A;  4I7B A;  5JH3 A;  3C9E A;  3DQV R;  2R9F A;  3I3T A;  5H9M A;  3CBJ A;  1WEW A;  4X3G A;  1MIR A;  4GNF A;  1WEP A;  3BC3 A;  4XUI A;  2Y43 A;  2OXQ C;  3O34 A;  5SVI B;  1WEE A;  3ZNI A;  1Z2Q A;  3LJU X;  2MD7 B;  1Z6U A;  2MNZ A;  2YW8 A;  4XI1 A;  5B79 A;  2E03 A;  4KLB A;  3BB7 A;  2FRQ A;  3HHA A;  2FTD A;  2XU4 A;  1WES A;  1NB5 A;  2FRA A;  1BOR A;  4QRV A;  2DC7 A;  3U5N A;  3U5P A;  2DJF B;  2JTC A;  1U9X A;  1PVJ A;  2AIM A;  3ZUA A;  3PUR A;  3ZVZ B;  2FE8 A;  2ECW A;  2YJB A;  3LDY A;  1FH0 A;  4Q8G A;  3H7D A;  2HDP A;  5CHV A;  4UP0 A;  1MM3 A;  5E6J A;  3H7H A;  4Q8H A;  2DX8 A;  3E1Z B;  3PHW A;  3U5O A;  4MSX A;  2LV9 A;  3LQJ A;  4DMY A;  1X4U A;  2MKE A;  2RSD A;  4P16 A;  1PCI A;  3W30 A;  1Y4H A;  3RVX A;  2DZZ A;  4X6I A;  1ME3 A;  1PPN A;  1U9V A;  3KW9 A;  4AYC B;  4X6H A;  1WFK A;  2NQI A;  1WE9 A;  2YQL A;  4YAT A;  3O7A A;  4D8B A;  3ERV A;  1IWD A;  1O0E A;  3IV2 A;  2XU3 A;  3HWN A;  3O35 A;  1K3B B;  2L5U A;  2MA6 A;  4BBQ A;  5B75 A;  4I7D A;  1AYW A;  1CTE A;  3LQI A;  4P5O B;  1THE A;  4N4F A;  4BOQ A;  2FUD A;  3DDT A;  2I50 A;  5C13 A;  5EZQ A;  3LXS A;  2ZET C;  2D8U A;  2JUN A;  2F6J A;  3ZVY A;  5I3L A;  2B1M A;  2HH5 A;  1MBM A;  2KGG A;  5JG6 A;  1QOL A;  2O6X A;  3DF0 A;  2EGP A;  2YJC A;  2P0R A;  1BP4 A;  2E61 A;  4O62 A;  1U5I A;  1T1H A;  2JRI A;  2YHN A;  2H7J A;  3IFU A;  3AI8 A;  2K16 A;  2HWK A;  3WXG A;  3MOR A;  3SOW A;  2VJF B;  3KX1 A;  3GL6 A;  5FPW A;  1WEU A;  1AYV A;  1PIP A;  2PBH A;  4TKP B;  1CS8 A;  4I05 A;  2YUR A;  4I07 A;  2IDA A;  5KH3 A;  3CH3 X;  2XU5 A;  2M6M A;  1POP A;  3O1G A;  4AP4 A;  4S3O C;  4WZ0 A;  2MUM A;  5FEY A;  4ZUX U;  3MP2 A;  2FUU A;  5G0F A;  2D8S A;  1TL9 A;  4OW0 A;  4ZTB A;  2FO5 A;  4IP3 A;  1CQD A;  4PPE A;  3BOW A;  2J7Q C;  1PAD A;  3KKU A;  4X6J A;  2CON A;  4K7C A;  3HCU A;  4A49 A;  3HHI A;  4HXD B;  2FD4 A;  2LXH C;  1U6G B;  2YT5 A;  2OZ2 A;  2UZG A;  3VK6 A;  4OVZ B;  2VJE A;  2KKX A;  4UI9 B;  2CB5 A;  5CVO B;  2XU1 A;  4BHW A;  3GV4 A;  3OVZ A;  3HCS A;  1GEC E;  2EGM A;  4D8I A;  2DOS A;  2E00 A;  2CKL B;  1N87 A;  1K2F A;  5KH7 A;  2AUZ A;  1MEG A;  1AIM A;  1PPP A;  3N9O A;  5LKU A;  2Y1N A;  2F1G A;  1KHP A;  1ITO A;  2JMD A;  1NLJ A;  3P5X A;  4MVT A;  4QF3 A;  5TAB A;  3H6S A;  2ATO A;  4BOU A;  3O37 A;  2AVW A;  2OWA A;  3ZTG A;  3QJ3 A;  4RF1 A;  1SNK A;  3O36 A;  3D6S A;  3PDF A;  2KE1 A;  3KSE A;  1G25 A;  5TBN A;  3LVQ E;  1YAL A;  1PXV A;  2M3H A;  4YVA A;  2FUI A;  2JMI A;  3BWK A;  2G7Y A;  4MZS A;  4LJN A;  2C2L A;  4Q6F A;  3E9S A;  5CVM A;  4YYU A;  1QMY A;  2YU4 A;  4BS5 A;  2PNS A;  4MZO A;  4GUA A;  2XEU A;  2BTW B;  4W4U A;  2LGL A;  1X9Y A;  3P5W A;  2LQ6 A;  4N4Z A;  1NB3 A;  2YYR A;  3MHH A;  2QJ0 A;  5G05 B;  1JQP A;  2R9C A;  1NPZ A;  2AU1 A;  3LQH A;  1WIM A;  1QXP A;  2KWK A;  3N3G A;  2QIZ A;  1WEM A;  1EWP A;  3O33 A;  4RF0 A;  5KH9 A;  1XKG A;  2CSY A;  3C6W A;  5H1U A;  1EWL A;  4YV8 A;  3PT2 A;  3RVW A;  1WEV A;  4Z0O A;  4N3W A;  3S3R A;  1LDK C;  1PE6 A;  5B76 A;  5SVI A;  4O64 A;  2ACT A;  1KHQ A;  2ECT A;  1V87 A;  2YVR A;  5C11 A;  2DCB A;  1X4J A;  1VYX A;  2QIC A;  3V43 A;  3S3Q A;  5JZE A;  2F42 A;  5J3X A;  2XOC A;  1U9Q X;  4QRG A;  4OEM A;  3SOX A;  4B86 C;  2FT2 A;  4V3L C;  2ARY A;  2DCC A;  1CJL A;  3PLW A;  2FFW A;  5TRB A;  3PRP A;  3L1Z B;  1ZBD B;  4OGE A;  4AXL A;  9PAP A;  4N8W A;  4GNG A;  1YK7 A;  1KFX L;  1F2A A;  3I06 A;  3O0U A;  2E6S A;  2RR4 A;  5G04 B;  1TU6 A;  2YSM A;  2AGA A;  2R6N A;  4I04 A;  2MIQ A;  2PUY A;  4YC9 A;  2GFO A;  4AYC A;  3OF9 A;  1F2C A;  3N3K A;  4MM3 B;  2LDR A;  2KR4 A;  4YYW A;  2XB1 A;  4FO9 A;  2DCA A;  1DKI A;  3P5U A;  2ECJ A;  3FAN A;  5FB1 A;  4A4B A;  2L75 A;  3M7K A;  1GMY A;  2G43 A;  3N9N A;  3H89 A;  3KV6 A;  3JUE A;  5DIN A;  2PNX A;  1YVB A;  2M1R A;  3N4C A;  3DPL R;  4QQ4 A;  3LFY A;  3Q1D A;  3SOU A;  2UZJ A;  3OF8 A;  1WEN A;  2FSA A;  2IPP B;  3KWB X;  4A0C D;  2DC6 A;  3U8E A;  3V6C A;  2CSZ A;  3TMP A;  4IUM A;  2BU3 A;  5AIT A;  4CA1 A;  3I2D A;  1YK8 A;  2KRE A;  1RMD A;  2EA6 A;  3KFQ A;  5B8D A;  3QZV A;  4LKA A;  4CZW A;  3USV A;  2VJF A;  1DCQ A;  3N9M A;  2YUC A;  1VD4 A;  4R3D A;  3RNV A;  4PP1 A;  3BBA A;  2H0D B;  3IOQ A;  2K17 A;  1ZIV A;  5FB0 A;  5D1L B;  4BS6 A;  3IMA A;  4CCG X;  2K4D A;  1MDW A;  2Y5B A;  4P6E A;  2ECG A;  4LK9 A;  3ZPV 1;  2Z84 A;  1Q6K A;  3L1X A;  2YHO A;  3ASL A;  2J7Q A;  3BY4 A;  1TLO A;  5J94 A;  4YYQ A;  2LXP C;  1SP4 B;  3OIS A;  1MEM A;  4I7C A;  4RNA A;  4OGC A;  1HUC B;  2VPE A;  3LRQ A;  6PAD A;  3F75 A;  4PI3 A;  4CDE B;  3BCN A;  2DCD A;  1PPD A;  1IYM A;  2AYN A;  4N79 A;  3LVR E;  3ZNH A;  3B79 A;  2YSJ A;  1ME4 A;  1AU4 A;  4R8P K;  4OVZ A;  4CDC B;  2AS8 A;  2OP3 A;  3PHU A;  5K3Q A;  4C9Z A;  1YT7 A;  1DVP A;  1STF E;  3HD3 A;  4GB0 A;  4ZDT A;  1MHW A;  4YAD A;  4AVX A;  2R9N A;  3PNR A;  3KQI A;  1F62 A;  2YJ9 A;  1FP0 A;  2CKL A;  2ECN A;  1DF0 A;  4CDF B;  4W5B A;  2NQA A;  4UP5 A;  5B77 A;  2C0Y A;  5CHT A;  3WXE A;  3M63 A;  3OVX A;  4PTB A;  2R9O A;  5EF4 A;  4P6G A;  4YYR A;  1M6D A;  4LAD B;  2KWO A;  1AU3 A;  4FK5 A;  4GNE A;  2JQG R;  2P86 A;  2XOY A;  3H8B A;  2LRI C;  1JM7 B;  2B1N A;  2G6Q A;  2RI7 A;  2FQ9 A;  5JA7 A;  5F02 A;  2EOD A;  2MA5 A;  3N9P A;  4ZQL A;  5EYA F;  2L80 A;  3NG2 A;  5CVN B;  3RVV A;  1S4V A;  5SVY A;  2WBF X;  3MJ5 A;  2EXU A;  2ECV A;  2BTW A;  5EZS A;  4A4C A;  4QF2 A;  4XR7 A;  2AUX A;  4WZ2 A;  4WA6 A;  1HYI A;  3PHX A;  4OEL A;  4YYS A;  2BDZ A;  4CDD B;  1HYJ A;  5FER A;  1F29 A;  4IC3 A;  2P7U A;  2KGI A;  2MT5 A;  2FYE A;  1LDJ B;  4AXM A;  5TDW A;  2G8J A;  1CV8 A;  1XWH A;  4QRX A;  4H9D A;  2L0B A;  1NQC A;  7PCK A;  3PRM A;  1NL6 A;  2E01 A;  2YQM A;  2VNF A;  2Y6E A;  4WZ3 B;  3T9K A;  2G6D A;  1VFY A;  1BY8 A;  2E6R A;  4BPV A;  1WEO A;  3MHS A;  2KWJ A;  3BPM A;  1CHC A;  4L58 A;  1JOC A;  3T6R A;  1VSN A;  4IC2 A;  3K8U A;  1F2B A;  3HCT A;  3KV5 A;  2DJG B;  4F52 B;  3FEH A;  2KIZ A;  2GHU A;  1PPO A;  2KYU A;  1ZCM A;  3FJU B;  2AN6 A;  1UKF A;  5B78 A;  5H1T A;  2CIO A;  8PCH A;  5D1K B;  1KFU L;  3BPF A;  3KNV A;  3RPG B;  4QH6 A;  3DWD A;  4XZX A;  4A5U A;  1EWM A;  3PSE A;  2JM3 A;  3U5M A;  1CB5 A;  4M0W A;  2DJA A;  2C2V S;  3L11 A;  3H8C A;  1AEC A;  3RPG C;  2R9M A;  1WIL A;  1AU0 A;  1DEU A;  2XP0 A;  4W5C A;  4D8E A;  3RTR B;  2VPD A;  2VHF A;  4YBT A;  2M85 A;  1ATK A;  1EF7 A;  3MTN A;  4AUQ B;  4YAX A;  3QT4 A;  2BAY A;  4WUR A;  3SHB A;  2CRR A;  3KDE C;  2KKY A;  4R7E A;  2MNY A;  1CPJ A;  5D1M B;  2OUL A;  3EB6 A;  3C0R A;  1BQI A;  4DMX A;  1FBV A;  2VP7 A;  3K24 A;  1QDQ A;  4QBB A;  2LN0 A;  2AYO A;  3WXF A;  1GCB A;  5LKT A;  5LCW B;  4F1P A;  5LKX A;  2LAU A;  4RY2 A;  5AIU A;  4YYV A;  4PP2 E;  4R2Y A;  1EWO A;  3N9L A;  1Y08 A;  3KWZ A;  2VPG A;  4PAD A;  1CVZ A;  4HWY A;  5KO3 A;  3M99 A;  2KFT A;  5DKA A;  2ECI A;  4PT5 A;  2B0O E;  3OQC A;  1U9W A;  2VPB A;  4YBM A;  3C5K A;  4BOP A;  2M13 A;  1ICF A;  3GCB A;  1PBH A;  4V3K C;  4BOS A;  3FL2 A;  2H0D A;  4S3O B;  2JMJ A;  2K1J A;  3F5V A;  3ZYQ A;  3PHD A;  5LKZ A;  2BDL A;  2LGV A;  4FIP A;  1Z60 A;  2G45 A;  3ZPV E;  3HTK C;  3NHE A;  2CT2 A;  3PBH A;  3QSD A;  4Z0R A;  2YJ8 A;  2KU3 A;  2HHN A;  1GLO A;  3P5V A;  3IUT A;  3N9Q A;  2LGK A;  2VJE B;  4BQV A;  3FAO A;  2P57 A;  4RKX A;  2L43 A;  2L7P A;  1AU2 A;  3W31 A;  3O47 A;  2DC9 A;  3M62 A;  5SVX A;  3TRK A;  3PUQ A;  1CSB B;  2DC8 A;  4LLB A;  2HD5 A;  3B21 A;  2VHS A;  3IHP A;  3FM8 C;  3MDB C;  4BSQ A;  4MI7 A;  1BGO A;  2NAA A;  5EGW A;  2Y1M A;  4YBS A;  2IQJ A;  3K9M A;  3O65 A; 
#chains in the Genus database with same CATH homology
 2YRE A;  4L7X A;  2IBI A;  5H1V A;  4G54 A;  1KXR A;  3IEJ A;  2KWN A;  1A6R A;  1WGM A;  3TNX A;  3O70 A;  5A24 A;  2NQD B;  1WEQ A;  2JRJ A;  5K16 A;  2HXZ A;  2HYE D;  3CBK A;  2MD8 C;  4GND A;  2JQF R;  2PAD A;  3CH2 X;  3T7L A;  1MM2 A;  3V6E A;  4FJC A;  5PAD A;  1JM7 A;  2F7D A;  2LGG A;  4B7Y C;  2DZY A;  3EB5 A;  4NN2 A;  1E4U A;  2PRE A;  1AYU A;  1X4I A;  3PW3 A;  2YJ2 A;  2G8E A;  1VJV A;  2E02 A;  5TDR A;  2NQG A;  1MS6 A;  4YAB A;  2F6N A;  4I7B A;  5JH3 A;  3C9E A;  3DQV R;  2R9F A;  3I3T A;  5H9M A;  3CBJ A;  1WEW A;  4X3G A;  1MIR A;  4GNF A;  1WEP A;  3BC3 A;  4XUI A;  2Y43 A;  2OXQ C;  3O34 A;  1WEE A;  3ZNI A;  1Z2Q A;  3LTW A;  2MD7 B;  1Z6U A;  2MNZ A;  2YW8 A;  4XI1 A;  5B79 A;  2E03 A;  4KLB A;  2FRQ A;  3HHA A;  2FTD A;  2XU4 A;  1WES A;  1NB5 A;  2FRA A;  1BOR A;  4QRV A;  2DC7 A;  3U5N A;  3U5P A;  2DJF B;  1U9X A;  2AIM A;  3ZUA A;  3PUR A;  3ZVZ B;  2YJB A;  2ECW A;  4Q8G A;  1FH0 A;  3H7D A;  2HDP A;  5CHV A;  2VFC A;  4UP0 A;  1MM3 A;  4Q8H A;  2DX8 A;  3E1Z B;  3U5O A;  4MSX A;  2LV9 A;  3LQJ A;  4DMY A;  1X4U A;  2RSD A;  1PCI A;  1Y4H A;  3RVX A;  2DZZ A;  4X6I A;  1ME3 A;  1PPN A;  1U9V A;  3KW9 A;  4AYC B;  4X6H A;  1WFK A;  2NQI A;  1WE9 A;  2YQL A;  4YAT A;  3O7A A;  3ERV A;  1IWD A;  1O0E A;  3IV2 A;  2XU3 A;  3HWN A;  3O35 A;  1K3B B;  2L5U A;  2MA6 A;  4BBQ A;  5B75 A;  4I7D A;  1AYW A;  1CTE A;  3LQI A;  4P5O B;  1THE A;  4N4F A;  2FUD A;  2I50 A;  5C13 A;  3LXS A;  2ZET C;  2F6J A;  3ZVY A;  5I3L A;  2B1M A;  2HH5 A;  2KGG A;  5JG6 A;  1QOL A;  2O6X A;  3DF0 A;  2EGP A;  2YJC A;  2P0R A;  1BP4 A;  1U5I A;  1T1H A;  2YHN A;  2H7J A;  3AI8 A;  2K16 A;  3WXG A;  3MOR A;  3SOW A;  2VJF B;  3KX1 A;  3GL6 A;  5FPW A;  1WEU A;  1AYV A;  1PIP A;  2PBH A;  4TKP B;  1CS8 A;  4I05 A;  2YUR A;  4I07 A;  2IDA A;  5KH3 A;  2BSZ A;  3CH3 X;  2XU5 A;  2M6M A;  1POP A;  3O1G A;  4AP4 A;  4S3O C;  4WZ0 A;  2MUM A;  5FEY A;  4ZUX U;  4BGF A;  2FUU A;  5G0F A;  2D8S A;  1TL9 A;  2FO5 A;  1CQD A;  4PPE A;  3BOW A;  3KKU A;  1PAD A;  4X6J A;  4K7C A;  3HCU A;  4A49 A;  3HHI A;  2LXH C;  1U6G B;  2YT5 A;  2OZ2 A;  2UZG A;  3VK6 A;  4NV8 A;  2VJE A;  4UI9 B;  2CB5 A;  5CVO B;  2XU1 A;  4BHW A;  3GV4 A;  3OVZ A;  3HCS A;  1GEC E;  2E00 A;  2CKL B;  1N87 A;  1K2F A;  5KH7 A;  2AUZ A;  1MEG A;  1AIM A;  1PPP A;  3N9O A;  5LKU A;  2Y1N A;  2F1G A;  1KHP A;  1ITO A;  2JMD A;  1NLJ A;  3P5X A;  4MVT A;  4QF3 A;  5TAB A;  3H6S A;  2ATO A;  3O37 A;  2AVW A;  3ZTG A;  3QJ3 A;  1SNK A;  3O36 A;  3D6S A;  3PDF A;  2KE1 A;  3KSE A;  1G25 A;  5TBN A;  2VFB A;  1YAL A;  1PXV A;  2M3H A;  4YVA A;  2FUI A;  2JMI A;  1W6F A;  2G7Y A;  3BWK A;  4MZS A;  4LJN A;  2C2L A;  4Q6F A;  4YYU A;  5CVM A;  1QMY A;  2YU4 A;  4BS5 A;  2PNS A;  4MZO A;  2XEU A;  4W4U A;  2LGL A;  1X9Y A;  3P5W A;  2LQ6 A;  4N4Z A;  1NB3 A;  2YYR A;  3MHH A;  2QJ0 A;  5G05 B;  1JQP A;  2R9C A;  1NPZ A;  2AU1 A;  3LQH A;  1WIM A;  1QXP A;  2KWK A;  3N3G A;  2QIZ A;  1WEM A;  1EWP A;  3O33 A;  5KH9 A;  1XKG A;  2CSY A;  3C6W A;  5H1U A;  1EWL A;  4YV8 A;  3RVW A;  1WEV A;  1W4T A;  3S3R A;  4N3W A;  1LDK C;  1PE6 A;  5B76 A;  4O64 A;  2ACT A;  1KHQ A;  2ECT A;  1V87 A;  5C11 A;  2DCB A;  1X4J A;  1VYX A;  2QIC A;  3V43 A;  3S3Q A;  2F42 A;  5J3X A;  1U9Q X;  4QRG A;  4OEM A;  3SOX A;  4B86 C;  2FT2 A;  4V3L C;  2ARY A;  2DCC A;  1CJL A;  5TRB A;  3L1Z B;  1ZBD B;  4AXL A;  9PAP A;  4N8W A;  4GNG A;  1YK7 A;  1KFX L;  1F2A A;  3I06 A;  3O0U A;  2E6S A;  1TU6 A;  5G04 B;  2YSM A;  1E2T A;  2R6N A;  4I04 A;  2MIQ A;  2PUY A;  4YC9 A;  2GFO A;  4AYC A;  3OF9 A;  1F2C A;  3N3K A;  2LDR A;  2KR4 A;  4YYW A;  2XB1 A;  4FO9 A;  4GUZ A;  2DCA A;  3P5U A;  2ECJ A;  5FB1 A;  4A4B A;  2L75 A;  1GMY A;  2G43 A;  3N9N A;  3H89 A;  3KV6 A;  5DIN A;  2PNX A;  1YVB A;  2M1R A;  3N4C A;  3DPL R;  3LFY A;  3SOU A;  3OF8 A;  1WEN A;  2FSA A;  2IPP B;  3KWB X;  4A0C D;  2DC6 A;  3U8E A;  3V6C A;  2CSZ A;  5AIT A;  4CA1 A;  3I2D A;  1YK8 A;  2KRE A;  1RMD A;  2EA6 A;  3KFQ A;  5B8D A;  3QZV A;  4LKA A;  4CZW A;  3USV A;  2VJF A;  3N9M A;  2YUC A;  1VD4 A;  4PP1 A;  2H0D B;  3IOQ A;  1W5R A;  2K17 A;  1ZIV A;  5FB0 A;  5D1L B;  4BS6 A;  3IMA A;  4CCG X;  2K4D A;  1MDW A;  2Y5B A;  4P6E A;  2ECG A;  4LK9 A;  3ZPV 1;  1Q6K A;  3L1X A;  2YHO A;  3ASL A;  4YYQ A;  5J94 A;  1TLO A;  2LXP C;  1SP4 B;  3OIS A;  1MEM A;  4I7C A;  1HUC B;  2VPE A;  3LRQ A;  3D9W A;  6PAD A;  3F75 A;  4PI3 A;  4CDE B;  3BCN A;  2DCD A;  1PPD A;  1IYM A;  2AYN A;  4N79 A;  3B79 A;  2YSJ A;  1ME4 A;  1AU4 A;  4R8P K;  4CDC B;  2AS8 A;  2OP3 A;  4C9Z A;  1YT7 A;  1DVP A;  1STF E;  3HD3 A;  4GB0 A;  4ZDT A;  1MHW A;  4YAD A;  4AVX A;  2R9N A;  3PNR A;  3KQI A;  1F62 A;  2YJ9 A;  1FP0 A;  2CKL A;  2ECN A;  1DF0 A;  4CDF B;  4W5B A;  2NQA A;  4UP5 A;  5B77 A;  2C0Y A;  5CHT A;  3WXE A;  3M63 A;  3OVX A;  4PTB A;  2R9O A;  5EF4 A;  4P6G A;  4YYR A;  1M6D A;  4NV7 A;  4LAD B;  2KWO A;  1AU3 A;  4FK5 A;  4GNE A;  2JQG R;  2P86 A;  3H8B A;  2LRI C;  1JM7 B;  2B1N A;  2G6Q A;  2RI7 A;  2FQ9 A;  5JA7 A;  5F02 A;  2EOD A;  2MA5 A;  3N9P A;  4ZQL A;  5EYA F;  2L80 A;  3NG2 A;  5CVN B;  3RVV A;  1S4V A;  2WBF X;  2ECV A;  4A4C A;  4QF2 A;  4XR7 A;  2AUX A;  4WZ2 A;  4WA6 A;  1HYI A;  4OEL A;  4YYS A;  2BDZ A;  4CDD B;  1HYJ A;  5FER A;  1F29 A;  4IC3 A;  2P7U A;  2KGI A;  2MT5 A;  2FYE A;  1LDJ B;  4AXM A;  5TDW A;  2G8J A;  1CV8 A;  1XWH A;  4QRX A;  2L0B A;  1NQC A;  7PCK A;  1NL6 A;  2E01 A;  2YQM A;  2VNF A;  2Y6E A;  4WZ3 B;  2G6D A;  1VFY A;  1BY8 A;  2E6R A;  4BPV A;  1WEO A;  3MHS A;  2KWJ A;  3BPM A;  1CHC A;  4L58 A;  1JOC A;  3T6R A;  1VSN A;  4IC2 A;  3K8U A;  1F2B A;  3HCT A;  3KV5 A;  2DJG B;  4F52 B;  2KIZ A;  2GHU A;  1PPO A;  2KYU A;  1ZCM A;  2AN6 A;  5B78 A;  5H1T A;  2CIO A;  8PCH A;  5D1K B;  1KFU L;  3BPF A;  3KNV A;  3RPG B;  4QH6 A;  1EWM A;  3U5M A;  1CB5 A;  1GX3 A;  3L11 A;  2C2V S;  3H8C A;  1AEC A;  3RPG C;  2R9M A;  1WIL A;  1AU0 A;  1DEU A;  4W5C A;  3RTR B;  2VPD A;  2VHF A;  4YBT A;  2M85 A;  1ATK A;  1EF7 A;  3MTN A;  4AUQ B;  4YAX A;  3QT4 A;  2BAY A;  3SHB A;  4R7E A;  2MNY A;  1CPJ A;  5D1M B;  2OUL A;  3EB6 A;  1BQI A;  4DMX A;  1FBV A;  2VP7 A;  3K24 A;  1QDQ A;  4QBB A;  2LN0 A;  2AYO A;  3WXF A;  1GCB A;  5LKT A;  5LCW B;  5LKX A;  4RY2 A;  5AIU A;  4YYV A;  4PP2 E;  4R2Y A;  1EWO A;  3N9L A;  1Y08 A;  3KWZ A;  2VPG A;  4PAD A;  1CVZ A;  4HWY A;  3M99 A;  2KFT A;  5DKA A;  2ECI A;  1U9W A;  2VPB A;  4YBM A;  3C5K A;  1ICF A;  3GCB A;  1PBH A;  4V3K C;  4B55 A;  3FL2 A;  4C5P A;  2H0D A;  4S3O B;  2JMJ A;  2K1J A;  3F5V A;  3ZYQ A;  3PHD A;  5LKZ A;  2BDL A;  2LGV A;  4FIP A;  1Z60 A;  2G45 A;  3ZPV E;  3HTK C;  3NHE A;  2CT2 A;  3PBH A;  3QSD A;  2YJ8 A;  2KU3 A;  2HHN A;  1GLO A;  3P5V A;  3IUT A;  3N9Q A;  2LGK A;  2VJE B;  4BQV A;  2L43 A;  1AU2 A;  2DC9 A;  3M62 A;  3PUQ A;  1CSB B;  2DC8 A;  4LLB A;  2HD5 A;  2VHS A;  3IHP A;  4BSQ A;  1BGO A;  2NAA A;  5EGW A;  2Y1M A;  4YBS A;  3K9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...