4FK5A

Structure of the saga ubp8(s144n)/sgf11/sus1/sgf73 dub module
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
473
structure length
437
Chain Sequence
AAMSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGNTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALSTNRQTGFIYLLTCAWKINQQQDAHEFWQFIINQIHQSYVLDLPNAKEVSRANNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQCGECNSAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
publication title A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 132
structure length 437
sequence length 473
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4fk5A01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4fk5A02
4A49A 1YK8A 4YBMA 3KV6A 1IWDA 2KWKA 2HH5A 1Z6UA 1WESA 2CT2A 2R9NA 2VPBA 5G05B 3LQHA 1GMYA 1K2FA 2HHNA 2YSMA 2JQFR 2AYOA 4YAXA 4AYCB 2IBIA 3D6SA 4WZ0A 1JQPA 4G54A 4I07A 2Y5BA 1CTEA 5CVNB 1SNKA 4S3OC 4PTBA 1Y08A 2KU3A 4PI3A 3GL6A 2M3HA 4X6HA 2BDLA 3O35A 2E00A 3CBKA 3ASLA 1XWHA 1JM7A 2K17A 2ECWA 2OZ2A 3ZPVE 4W5CA 5TBNA 5PADA 5F02A 4WZ2A 5H1VA 4HWYA 2F6JA 3N3KA 2C2LA 2PNSA 2FSAA 4OEMA 4CDCB 1ME3A 2YUCA 3N3GA 1VYXA 4N8WA 3SOXA 4AXLA 2FUUA 2MD8C 1EWOA 1WEUA 5CHVA 3BWKA 3O34A 2ARYA 2DCAA 4AP4A 3U5NA 2KGGA 2DC8A 1AYUA 3O37A 1F62A 2YW8A 3QZVA 5FERA 1AU2A 2YJ9A 2O6XA 3H8BA 4YYRA 4MSXA 4WA6A 2B1MA 2WBFX 2AS8A 1JM7B 2DJGB 4I7DA 3U5PA 4V3KC 3ZUAA 1U9QX 2Y6EA 3H89A 2D8SA 4YBSA 4O64A 4QF3A 2VPEA 7PCKA 2G6QA 3H8CA 3ZTGA 2JQGR 2VJEA 2P0RA 1U9WA 2E03A 2CSYA 1LDJB 4CCGX 3M63A 3PNRA 2Y43A 3K8UA 4NN2A 1BORA 1NB5A 4DMXA 1O0EA 5H1TA 3P5VA 4QH6A 1ATKA 1EWLA 3T6RA 2JMIA 1MM2A 2ACTA 2ECTA 3KSEA 4QF2A 3F75A 1PBHA 2PNXA 2XB1A 1CPJA 4KLBA 2AN6A 2LGLA 4AXMA 1F2CA 3I3TA 3KWZA 4ZQLA 1CVZA 2RSDA 3RPGB 3GV4A 2C2VS 1NPZA 5J94A 2YYRA 2JMJA 2VJEB 1KFXL 2LN0A 2KFTA 2YSJA 2GFOA 2YJ8A 1TL9A 3B79A 3ZVZB 3ERVA 3L1ZB 2MUMA 3TNXA 1BP4A 4YADA 1QXPA 3H6SA 4R8PK 2QIZA 2F1GA 3PBHA 2L43A 1U5IA 3KWBX 3O1GA 1K3BB 4LLBA 2R9OA 3RVWA 4QRGA 3IEJA 1GCBA 5B78A 2LGKA 1MHWA 4PADA 1Z60A 1MEMA 3SHBA 3C6WA 2G7YA 1X9YA 5TDWA 2VP7A 2BDZA 2KREA 2I50A 5H1UA 1E4UA 3HD3A 2MA6A 4GB0A 1ICFA 2AUZA 4BBQA 4UP5A 4YBTA 3OF8A 5TDRA 2AVWA 5KH3A 4CDDB 2YJBA 4UI9B 2DCDA 2YJ2A 3M99A 4YYVA 2KIZA 4FJCA 2FTDA 3O70A 1Q6KA 4N4ZA 4Q8HA 4AUQB 3ZVYA 4X6JA 2YQMA 1NQCA 2MD7B 2FQ9A 2HXZA 3OISA 3PURA 2LQ6A 1WEPA 4YVAA 1MIRA 3PHDA 2G8JA 2IPPB 2R9MA 1MM3A 1GLOA 2IDAA 5H9MA 3T7LA 4CA1A 3P5UA 5EGWA 1VD4A 4L7XA 1DVPA 2R6NA 2LGVA 1X4IA 2M1RA 2K16A 1CJLA 1SP4B 2EA6A 2DJFB 3MHSA 3CH2X 2MT5A 2MNYA 3HCUA 4I7CA 1YK7A 4K7CA 4CDEB 3MTNA 2FRQA 3WXFA 3LFYA 2YREA 2HDPA 2LRIC 5AIUA 4R7EA 1EWMA 3N9QA 1PCIA 2ATOA 2E02A 5CVOB 1AYWA 1HYIA 1RMDA 1CB5A 5D1KB 2HD5A 2P7UA 2H7JA 2FUIA 2UZGA 4FK5A 4BS5A 2Y1MA 3KW9A 5D1MB 2L75A 2CKLA 5LKZA 1IYMA 1FH0A 5AITA 3PW3A 1EF7A 1XKGA 3IHPA 1CHCA 2DCCA 1DEUA 3OVZA 2FUDA 1MEGA 1NB3A 4V3LC 1U9VA 1ME4A 4BQVA 4FIPA 1PE6A 2KWNA 3KQIA 5JA7A 4WZ3B 3FL2A 4UP0A 3LXSA 3BPFA 1AIMA 1F29A 4BS6A 5JG6A 2KYUA 4PP2E 4X3GA 2G45A 5LKXA 1AU0A 4RY2A 4YYQA 4R2YA 2DC9A 1PADA 2L80A 2CKLB 2CSZA 1WFKA 5DKAA 2LDRA 2FO5A 4YYWA 2K1JA 4A0CD 1AU4A 4P6EA 1WEEA 2CB5A 1KFUL 4AVXA 4X6IA 3RVXA 3C5KA 3CH3X 4N4FA 4TKPB 4LADB 4PPEA 4S3OB 3M62A 3L11A 2GHUA 1HYJA 1VSNA 2DC7A 2XU1A 5EF4A 1EWPA 4BSQA 1U6GB 1V87A 2KGIA 4A4CA 3U5MA 1BY8A 1MS6A 2LV9A 3O36A 3IMAA 3I2DA 3IV2A 3LQIA 5EYAF 2ECNA 2FYEA 2KWOA 2QJ0A 5B77A 5LKTA 2FRAA 1MDWA 2PADA 2C0YA 4YYUA 3NHEA 1WIMA 5FB1A 4BPVA 2R9CA 5C13A 4GNFA 3K24A 5A24A 3SOWA 2PUYA 4IC3A 3O0UA 1ITOA 4I05A 3P5WA 2KR4A 1T1HA 3BCNA 3GCBA 4L58A 5B75A 4W4UA 4C9ZA 1TU6A 2MNZA 2EGPA 3PUQA 3V43A 2YHNA 2K4DA 4MZSA 5B8DA 2ECIA 3ZYQA 1NL6A 1F2BA 4YATA 2XU5A 2DCBA 1WENA 3EB5A 4OELA 3IUTA 2OP3A 4YYSA 8PCHA 2VPDA 3KNVA 3S3QA 3RVVA 4I04A 5B76A 2DX8A 3HTKC 5G0FA 4P6GA 5FPWA 1G25A 3L1XA 4DMYA 2OXQC 1M6DA 1X4JA 3KKUA 5B79A 4B7YC 1GECE 1PIPA 1AU3A 3RTRB 2G43A 2NQIA 4QBBA 3USVA 4LK9A 4MVTA 1YALA 3NG2A 3PDFA 3RPGC 2YJCA 1FP0A 1THEA 2VHFA 3HCSA 2YU4A 5C11A 2DZZA 2L0BA 2NAAA 1PPOA 2XEUA 3HWNA 1QMYA 3DF0A 2M6MA 3I06A 4XI1A 1HUCB 2NQGA 4FO9A 2ZETC 5LCWB 2G6DA 3V6CA 1WEWA 4QRVA 2M85A 1POPA 3BC3A 1BQIA 1Y4HA 2ECGA 3SOUA 2YT5A 3IOQA 3WXEA 3V6EA 4LJNA 3KX1A 2VNFA 1U9XA 5FB0A 1YT7A 2VJFA 1QDQA 2B1NA 3DPLR 1STFE 2H0DA 4LKAA 1PPPA 4MZOA 1ZIVA 4ZUXU 3WXGA 1WE9A 2VPGA 4F52B 1KHPA 1CSBB 2L5UA 2R9FA 5J3XA 5KH9A 5FEYA 3HCTA 5K16A 4N79A 3DQVR 3MORA 4YC9A 2F6NA 2RI7A 3U5OA 2ECJA 2FT2A 2NQAA 5CVMA 3QSDA 5I3LA 1PPDA 1PPNA 3P5XA 2JMDA 2G8EA 1ZBDB 1WGMA 1WEOA 2YHOA 1X4UA 2EODA 2KE1A 2YURA 5D1LB 3O33A 3VK6A 1FBVA 3N9OA 3KFQA 2MIQA 2AU1A 2DC6A 3AI8A 2YQLA 4N3WA 3LQJA 2VJFB 3ZNIA 1BGOA 3O7AA 2KWJA 4A4BA 5KH7A 2H0DB 3N9MA 4Q8GA 4YABA 5CHTA 6PADA 1WEMA 5TRBA 4BHWA 3CBJA 1Z2QA 3N9PA 2PBHA 3QJ3A 1AYVA 4B86C 3C9EA 2Y1NA 3E1ZB 1KHQA 2NQDB 1CS8A 4PP1A 4XUIA 1CQDA 2F7DA 4XR7A 1AECA 3N4CA 9PAPA 2LGGA 1JOCA 3HHIA 2CIOA 3F5VA 1WEQA 3N9NA 2BAYA 2E6SA 2XU4A 4GNEA 3KV5A 5TABA 1VFYA 1KXRA 2AIMA 5JH3A 4CZWA 3ZPV1 2F42A 1QOLA 1NLJA 1CV8A 4ZDTA 2QICA 2PREA 2VHSA 3S3RA 1A6RA 3BOWA 5G04B 3BPMA 3K9MA 3OF9A 2LXHC 2ECVA 4YV8A 2AUXA 3HHAA 3EB6A 1VJVA 2HYED 1F2AA 2AYNA 2XU3A 4Q6FA 1S4VA 1WEVA 1YVBA 1TLOA 1WILA 2OULA 4GNDA 1N87A 1DF0A 4W5BA 2E6RA 2JRJA 2E01A 3MHHA 2MA5A 4AYCA 2DZYA 5LKUA 3H7DA 5DINA 4IC2A 3OVXA 3LRQA 4P5OB 4CDFB 4QRXA 3N9LA 2LXPC 1LDKC 4I7BA 3QT4A 1PXVA 4GNGA 1ZCMA 2P86A 3U8EA
chains in the Genus database with same CATH superfamily
4WURA 4A49A 1YK8A 4YBMA 3KV6A 1IWDA 2KWKA 2HH5A 1Z6UA 1WESA 2CT2A 2R9NA 2VPBA 5G05B 3T9KA 4OGEA 3LQHA 1GMYA 1K2FA 2HHNA 2YSMA 2JQFR 2AYOA 4YAXA 4AYCB 2IBIA 3D6SA 4WZ0A 1JQPA 4G54A 4I07A 2Y5BA 1CTEA 3PHXA 5CVNB 3E2DA 3PLWA 1SNKA 4S3OC 4PTBA 3OQCA 1Y08A 2KU3A 4PI3A 1MBMA 3GL6A 4RF0A 2M3HA 4X6HA 2BDLA 3O35A 2E00A 3CBKA 3ASLA 1XWHA 1JM7A 2K17A 3ZNHA 2ECWA 2OZ2A 3ZPVE 4W5CA 5TBNA 5PADA 5E6JA 3MDBC 5F02A 4WZ2A 5H1VA 4HWYA 2F6JA 3N3KA 2C2LA 2PNSA 4OVZA 2FSAA 1YZBA 4OEMA 4CDCB 2EXUA 1ME3A 2YUCA 3N3GA 1VYXA 4N8WA 3SOXA 4MM3B 4AXLA 3MJ5A 2FUUA 2MD8C 1EWOA 1WEUA 5CHVA 3BWKA 3O34A 2ARYA 2DCAA 4AP4A 3U5NA 2KGGA 4XZXA 2DC8A 1AYUA 3O37A 1F62A 2YW8A 3QZVA 5FERA 1AU2A 2YJ9A 2O6XA 3H8BA 4YYRA 4MSXA 4WA6A 2B1MA 2WBFX 2AS8A 1JM7B 2DJGB 4I7DA 3U5PA 4V3KC 3ZUAA 1U9QX 2Y6EA 3BB7A 4Z0OA 3H89A 2D8SA 4YBSA 4O64A 4QF3A 4OVZB 2VPEA 7PCKA 2G6QA 3H8CA 3ZTGA 2JQGR 2VJEA 2P0RA 1U9WA 3DDTA 2E03A 2CSYA 1LDJB 4CCGX 3M63A 3PNRA 2Y43A 3K8UA 4NN2A 1BORA 1NB5A 1PVJA 4DMXA 1O0EA 5H1TA 3B21A 3BY4A 3P5VA 4QH6A 1ATKA 1EWLA 3T6RA 2JMIA 1MM2A 2ACTA 2ECTA 3KSEA 4QF2A 3F75A 1PBHA 2PNXA 2XB1A 1CPJA 4KLBA 2AN6A 2LGLA 5EZSA 4AXMA 2LAUA 1F2CA 3I3TA 2XOCA 3KWZA 4ZQLA 1CVZA 2RSDA 3RPGB 3GV4A 2C2VS 1NPZA 3PT2A 5J94A 3LJUX 2YYRA 2JMJA 2VJEB 1KFXL 2LN0A 2KFTA 4OW0A 2YSJA 2UZJA 2GFOA 2YJ8A 1TL9A 3B79A 3ZVZB 3ERVA 4MI7A 3L1ZB 2MUMA 3TNXA 1BP4A 4YADA 1QXPA 3H6SA 4R8PK 2QIZA 2F1GA 3PBHA 4D8EA 2L43A 1U5IA 2CRWA 3KWBX 3O1GA 2KKXA 4LLBA 1K3BB 2J7QC 2R9OA 3RVWA 4QRGA 3IEJA 1GCBA 5B78A 2LGKA 1MHWA 4PADA 1Z60A 1MEMA 4QQ4A 2DJAA 3SHBA 3C6WA 4P16A 2G7YA 3SUBA 1X9YA 5TDWA 2VP7A 2BDZA 2KREA 2I50A 5H1UA 3M7KA 1E4UA 3HD3A 2MA6A 4GB0A 1ICFA 2AUZA 3JUEA 4BBQA 4UP5A 1UKFA 4YBTA 3OF8A 5TDRA 2AVWA 5KH3A 4CDDB 2YJBA 4UI9B 2DCDA 2YJ2A 1DKIA 2CSVA 3M99A 5KO3A 4YYVA 4Z0RA 2KIZA 4FJCA 2FTDA 3O70A 1Q6KA 4N4ZA 4Q8HA 4AUQB 3ZVYA 4X6JA 2YQMA 2FFWA 1NQCA 2MD7B 2FQ9A 2HXZA 3OISA 3PURA 2LQ6A 1WEPA 2XOYA 4YVAA 1MIRA 3PHDA 2G8JA 2IPPB 2R9MA 1MM3A 4BOSA 1GLOA 2DSMA 2IDAA 5H9MA 3T7LA 4CA1A 3P5UA 5EGWA 2M13A 1VD4A 4L7XA 2IQJA 1DVPA 2R6NA 2Z84A 2LGVA 1X4IA 2M1RA 2DOSA 2HWKA 2K16A 3FM8C 1CJLA 1SP4B 2EA6A 2DJFB 3MHSA 3CH2X 2MT5A 2MNYA 5SVYA 3HCUA 4I7CA 1YK7A 4K7CA 4BOUA 4CDEB 2XP0A 3MTNA 2FRQA 3WXFA 3LFYA 4REZA 2YREA 2HDPA 2LRIC 5AIUA 4R7EA 1EWMA 3N9QA 5K3QA 1PCIA 2ATOA 2E02A 2EGMA 4HXDB 5CVOB 1AYWA 3TRKA 1HYIA 1RMDA 1CB5A 3Q1DA 5D1KB 2HD5A 2P7UA 2H7JA 2FUIA 2UZGA 4FK5A 4BS5A 2Y1MA 3KW9A 5D1MB 2L75A 2CKLA 5LKZA 1IYMA 2JTCA 1FH0A 5AITA 3PW3A 1EF7A 1XKGA 3IHPA 1CHCA 2DCCA 3IFUA 3O47A 1DEUA 3OVZA 3TMPA 2FUDA 1MEGA 1NB3A 4V3LC 1U9VA 1ME4A 4BQVA 4FIPA 1PE6A 2KWNA 3KQIA 5JA7A 4WZ3B 3FL2A 4UP0A 3LXSA 3BPFA 1AIMA 1F29A 3RNVA 4BS6A 4RKXA 5JG6A 2KYUA 4BOZA 3DWDA 4X3GA 4PP2E 2G45A 3W31A 5LKXA 1AU0A 4RY2A 4YYQA 1DCQA 4R2YA 2DC9A 1PADA 2L80A 2CKLB 2CSZA 4RF1A 1WFKA 5DKAA 2LDRA 2FO5A 4YYWA 2K1JA 4A0CD 1AU4A 3PHWA 1WEEA 4P6EA 2CB5A 1KFUL 4AVXA 4X6IA 3RVXA 3C5KA 3CH3X 4N4FA 4TKPB 4LADB 2CRRA 4PPEA 4S3OB 3M62A 3L11A 2B0OE 4H9DA 1HYJA 2GHUA 1VSNA 2DC7A 2XU1A 5SVIA 3FJUB 4F1PA 1EWPA 5EF4A 1U6GB 4BSQA 1V87A 2KGIA 4A4CA 3U5MA 1BY8A 1MS6A 2LV9A 5JZEA 3O36A 3IMAA 3I2DA 3IV2A 3LQIA 5EYAF 2ECNA 2FYEA 2KWOA 2QJ0A 5B77A 5LKTA 2FRAA 1MDWA 2PADA 5EZQA 2C0YA 4YYUA 3NHEA 1WIMA 5FB1A 4BPVA 2R9CA 5C13A 3KDEC 4GNFA 3K24A 5A24A 3SOWA 2PUYA 4IC3A 3O0UA 1ITOA 4I05A 3P5WA 2KR4A 1T1HA 3BCNA 4IP3A 3GCBA 4L58A 5B75A 4W4UA 4C9ZA 1TU6A 2MNZA 4R3DA 3W30A 2EGPA 3FAOA 3PUQA 2E61A 3V43A 2YHNA 5SVIB 2K4DA 2BTWB 4MZSA 5B8DA 3E9SA 2ECIA 3ZYQA 1NL6A 1F2BA 4YATA 3BBAA 2XU5A 2DCBA 1WENA 3EB5A 4BOQA 4OELA 3IUTA 3LVRE 2OP3A 4YYSA 8PCHA 2VPDA 3KNVA 3S3QA 3RVVA 4I04A 2FE8A 5B76A 2BU3A 2DX8A 4PT5A 3HTKC 2P57A 4O62A 5G0FA 4P6GA 5FPWA 1G25A 3L1XA 4DMYA 4M0WA 2OXQC 1M6DA 1X4JA 3KKUA 5B79A 4B7YC 1GECE 1PIPA 1AU3A 2G43A 3RTRB 2NQIA 4QBBA 3USVA 4LK9A 4A5UA 4MVTA 1YALA 3NG2A 3PDFA 3RPGC 2YJCA 4IUMA 4D8BA 1FP0A 1THEA 4GUAA 2J7QA 2VHFA 3C0RA 3PSEA 3HCSA 2YU4A 5C11A 2DZZA 2L0BA 2JM3A 2NAAA 1PPOA 2XEUA 3HWNA 1QMYA 2FD4A 3DF0A 2M6MA 3I06A 4XI1A 1HUCB 2NQGA 4FO9A 2ZETC 5LCWB 2G6DA 3V6CA 1WEWA 4QRVA 2M85A 1POPA 3BC3A 1BQIA 1Y4HA 2ECGA 3SOUA 2YT5A 3IOQA 3WXEA 3V6EA 4LJNA 3KX1A 2VNFA 1U9XA 5FB0A 1YT7A 3H7HA 3PHUA 4D8IA 2VJFA 1QDQA 2B1NA 2CONA 3LVQE 3DPLR 1STFE 2JRIA 3FANA 2H0DA 4LKAA 1PPPA 4MZOA 1ZIVA 4ZUXU 3WXGA 1WE9A 2VPGA 4F52B 1KHPA 1CSBB 2OWAA 2L5UA 2R9FA 5J3XA 5KH9A 5FEYA 3HCTA 5K16A 4N79A 3DQVR 3MORA 4YC9A 3U8EA 2F6NA 2RI7A 3U5OA 2ECJA 2FT2A 2NQAA 5CVMA 3QSDA 5I3LA 1PPDA 2L7PA 1PPNA 3P5XA 2JMDA 2G8EA 2YHOA 1ZBDB 1WGMA 1WEOA 1X4UA 2EODA 2KE1A 2D8UA 2YURA 3O33A 5D1LB 1FBVA 3N9OA 3VK6A 2MIQA 2AU1A 2DC6A 3AI8A 2YQLA 4N3WA 3KFQA 3LQJA 2VJFB 2AGAA 3ZNIA 1BGOA 3O7AA 2KWJA 3FEHA 4A4BA 5KH7A 2H0DB 3N9MA 4Q8GA 4YABA 5CHTA 6PADA 1WEMA 5TRBA 4BHWA 3CBJA 1Z2QA 3N9PA 2PBHA 3QJ3A 5SVXA 1AYVA 4B86C 3C9EA 2Y1NA 3E1ZB 2YVRA 4ZTBA 1KHQA 2JUNA 1CS8A 2NQDB 3MP2A 1CQDA 2F7DA 4PP1A 4XUIA 4XR7A 2RR4A 1AECA 2XOZA 3N4CA 9PAPA 2LGGA 1JOCA 2BTWA 3HHIA 2CIOA 3F5VA 1WEQA 3N9NA 2BAYA 2E6SA 2XU4A 4GNEA 3MTVA 3KV5A 5TABA 1VFYA 2MKEA 1KXRA 2AIMA 4CZWA 3ZPV1 5JH3A 2F42A 1QOLA 1NLJA 1CV8A 4ZDTA 2QICA 2PREA 2VHSA 3PRMA 1A6RA 3BOWA 3S3RA 5G04B 3BPMA 3K9MA 3O65A 3OF9A 2LXHC 3LDYA 2ECVA 4YV8A 2AUXA 3HHAA 3EB6A 1VJVA 2HYED 1F2AA 2AYNA 2XU3A 4Q6FA 2KKYA 1S4VA 1WEVA 1YVBA 1TLOA 1WILA 2OULA 4GNDA 1N87A 1DF0A 3PRPA 4W5BA 4RNAA 2E6RA 2JRJA 2E01A 3MHHA 2MA5A 4AYCA 2DZYA 5LKUA 3H7DA 5DINA 4IC2A 3OVXA 4BOPA 3LRQA 4P5OB 4CDFB 4QRXA 3N9LA 2LXPC 1LDKC 4I7BA 3QT4A 1PXVA 4GNGA 1ZCMA 2P86A 4OGCA
chains in the Genus database with same CATH topology
4A49A 1YK8A 4YBMA 3KV6A 1IWDA 2KWKA 2HH5A 1Z6UA 1WESA 2CT2A 2R9NA 2VPBA 5G05B 3LQHA 1GMYA 1K2FA 2HHNA 2YSMA 2JQFR 2AYOA 4YAXA 4AYCB 2IBIA 3D6SA 4WZ0A 1JQPA 4G54A 4I07A 2Y5BA 1CTEA 5CVNB 1SNKA 4S3OC 4PTBA 1Y08A 2KU3A 4PI3A 3GL6A 2M3HA 4X6HA 2BDLA 3O35A 2E00A 3CBKA 3ASLA 1XWHA 1JM7A 2K17A 2ECWA 2OZ2A 3ZPVE 4W5CA 5TBNA 5PADA 5F02A 4WZ2A 5H1VA 4HWYA 2F6JA 3N3KA 2C2LA 2PNSA 2FSAA 4OEMA 4CDCB 1ME3A 2YUCA 3N3GA 1VYXA 4N8WA 3SOXA 4AXLA 2FUUA 2MD8C 1EWOA 1WEUA 5CHVA 3BWKA 3O34A 2ARYA 2DCAA 4AP4A 3U5NA 2KGGA 1W6FA 2DC8A 1AYUA 3O37A 1F62A 2YW8A 3QZVA 5FERA 1AU2A 2YJ9A 2O6XA 3H8BA 4YYRA 4MSXA 4WA6A 2B1MA 2WBFX 2AS8A 1JM7B 2DJGB 4I7DA 3U5PA 4V3KC 3ZUAA 1U9QX 2Y6EA 3H89A 2D8SA 4YBSA 4O64A 4QF3A 2VPEA 7PCKA 2G6QA 3H8CA 1GX3A 3ZTGA 2JQGR 2VJEA 2P0RA 1U9WA 2E03A 2CSYA 1LDJB 4CCGX 3M63A 3PNRA 2Y43A 3K8UA 4NN2A 1BORA 1NB5A 4DMXA 1O0EA 5H1TA 3P5VA 4QH6A 1ATKA 1EWLA 3T6RA 2JMIA 1MM2A 2ACTA 2ECTA 3KSEA 4QF2A 3F75A 1PBHA 2PNXA 2XB1A 1CPJA 4KLBA 2AN6A 2LGLA 4AXMA 1F2CA 3I3TA 3KWZA 4ZQLA 1CVZA 2RSDA 3RPGB 3GV4A 2C2VS 1NPZA 5J94A 2YYRA 2JMJA 2VJEB 1KFXL 2LN0A 2KFTA 2YSJA 2GFOA 2YJ8A 1TL9A 3B79A 3ZVZB 3ERVA 3L1ZB 2MUMA 3TNXA 3LTWA 1BP4A 4YADA 1QXPA 3H6SA 4R8PK 2QIZA 2F1GA 3PBHA 2L43A 1U5IA 3KWBX 3O1GA 1K3BB 4LLBA 2R9OA 3RVWA 4QRGA 3IEJA 1GCBA 5B78A 2LGKA 1MHWA 4PADA 1Z60A 1MEMA 3SHBA 3C6WA 2G7YA 1X9YA 5TDWA 2VP7A 2BDZA 2KREA 2I50A 5H1UA 1E4UA 3HD3A 2MA6A 4GB0A 1ICFA 2AUZA 4BBQA 4UP5A 4YBTA 3OF8A 5TDRA 2AVWA 5KH3A 4CDDB 2YJBA 4UI9B 2DCDA 2YJ2A 3M99A 4YYVA 2KIZA 4FJCA 2FTDA 3O70A 1Q6KA 4N4ZA 4Q8HA 4AUQB 3ZVYA 4X6JA 2YQMA 1NQCA 2MD7B 2FQ9A 2HXZA 3OISA 3PURA 2LQ6A 1WEPA 4YVAA 1MIRA 3PHDA 2G8JA 2IPPB 2R9MA 1MM3A 1GLOA 2IDAA 5H9MA 3T7LA 4CA1A 3P5UA 5EGWA 1VD4A 4L7XA 1DVPA 2R6NA 2LGVA 1X4IA 2M1RA 2K16A 1CJLA 1SP4B 2EA6A 2DJFB 3MHSA 3CH2X 2MT5A 2MNYA 3HCUA 4I7CA 1YK7A 4K7CA 4CDEB 3MTNA 2FRQA 3WXFA 3LFYA 2YREA 2HDPA 2LRIC 5AIUA 4R7EA 1EWMA 4C5PA 3N9QA 1PCIA 2ATOA 2E02A 5CVOB 1AYWA 1W5RA 1HYIA 1RMDA 1CB5A 5D1KB 2HD5A 2P7UA 2H7JA 2FUIA 2UZGA 4FK5A 4BS5A 2Y1MA 3KW9A 5D1MB 2L75A 2CKLA 5LKZA 1IYMA 1FH0A 5AITA 3PW3A 1EF7A 1XKGA 3IHPA 1CHCA 2DCCA 1DEUA 3OVZA 2FUDA 1MEGA 1NB3A 4V3LC 1U9VA 1ME4A 4BQVA 4FIPA 1PE6A 2KWNA 3KQIA 5JA7A 4WZ3B 3FL2A 4UP0A 3LXSA 3BPFA 1AIMA 1F29A 4BS6A 5JG6A 2KYUA 4PP2E 4X3GA 2G45A 5LKXA 1AU0A 4RY2A 4YYQA 4R2YA 2DC9A 1PADA 2L80A 2CKLB 2CSZA 1WFKA 5DKAA 2LDRA 2FO5A 4YYWA 2K1JA 4A0CD 1AU4A 4P6EA 1WEEA 2CB5A 1KFUL 4AVXA 4X6IA 3RVXA 3C5KA 3CH3X 4N4FA 4TKPB 4LADB 4PPEA 4S3OB 3M62A 3L11A 2GHUA 1HYJA 1VSNA 2DC7A 2XU1A 5EF4A 1EWPA 4BSQA 1U6GB 1V87A 2KGIA 4A4CA 3U5MA 1BY8A 1MS6A 2LV9A 3O36A 3IMAA 3I2DA 3IV2A 3LQIA 5EYAF 2ECNA 2FYEA 2KWOA 2QJ0A 5B77A 5LKTA 2FRAA 1MDWA 2PADA 2C0YA 4YYUA 3NHEA 1WIMA 5FB1A 4BPVA 2R9CA 5C13A 4GNFA 3K24A 5A24A 3SOWA 2PUYA 4IC3A 3O0UA 1ITOA 4I05A 3P5WA 2KR4A 1T1HA 3BCNA 3GCBA 4L58A 5B75A 4W4UA 4C9ZA 1TU6A 2MNZA 2EGPA 3PUQA 3V43A 2YHNA 2K4DA 4MZSA 5B8DA 2ECIA 3ZYQA 1NL6A 1F2BA 4YATA 2XU5A 2DCBA 1WENA 3EB5A 4OELA 3IUTA 2OP3A 4YYSA 8PCHA 2VPDA 3KNVA 3S3QA 3RVVA 4I04A 5B76A 2DX8A 3HTKC 3D9WA 5G0FA 4P6GA 5FPWA 1G25A 3L1XA 4DMYA 2OXQC 1M6DA 1X4JA 3KKUA 5B79A 4B7YC 1GECE 1PIPA 1AU3A 3RTRB 2G43A 2NQIA 4QBBA 3USVA 4LK9A 4MVTA 1YALA 3NG2A 3PDFA 3RPGC 2YJCA 1FP0A 1THEA 2VHFA 3HCSA 2YU4A 5C11A 2DZZA 2L0BA 2NAAA 1PPOA 2XEUA 3HWNA 1QMYA 3DF0A 2M6MA 3I06A 4XI1A 1HUCB 2NQGA 4FO9A 2ZETC 5LCWB 2G6DA 3V6CA 1WEWA 4QRVA 2M85A 1POPA 3BC3A 1BQIA 1Y4HA 2ECGA 3SOUA 4B55A 2YT5A 3IOQA 3WXEA 3V6EA 4LJNA 3KX1A 2VNFA 1U9XA 5FB0A 1YT7A 2VJFA 1QDQA 2B1NA 3DPLR 1STFE 2H0DA 4LKAA 1PPPA 4MZOA 1ZIVA 4ZUXU 3WXGA 1WE9A 2VPGA 4F52B 1KHPA 1CSBB 2VFCA 2L5UA 2R9FA 5J3XA 5KH9A 5FEYA 3HCTA 5K16A 4N79A 3DQVR 3MORA 4YC9A 2F6NA 2RI7A 3U5OA 2ECJA 2FT2A 2NQAA 5CVMA 3QSDA 5I3LA 1PPDA 1PPNA 3P5XA 2BSZA 2JMDA 2G8EA 1ZBDB 1WGMA 1WEOA 2YHOA 1X4UA 2EODA 2KE1A 2YURA 5D1LB 3O33A 3VK6A 1FBVA 3N9OA 3KFQA 2MIQA 2AU1A 2DC6A 3AI8A 2YQLA 4N3WA 4GUZA 3LQJA 2VJFB 3ZNIA 1BGOA 3O7AA 2KWJA 4A4BA 5KH7A 2H0DB 3N9MA 4Q8GA 4YABA 5CHTA 6PADA 1WEMA 5TRBA 4BHWA 4BGFA 3CBJA 1Z2QA 3N9PA 2PBHA 3QJ3A 1AYVA 4B86C 3C9EA 2Y1NA 3E1ZB 1KHQA 2NQDB 1CS8A 4PP1A 4XUIA 1CQDA 2F7DA 4XR7A 1AECA 3N4CA 9PAPA 2LGGA 1JOCA 3HHIA 2CIOA 3F5VA 1WEQA 3N9NA 2BAYA 2E6SA 2XU4A 4GNEA 3KV5A 5TABA 1VFYA 1KXRA 2AIMA 5JH3A 4CZWA 3ZPV1 2F42A 1QOLA 1NLJA 1CV8A 4ZDTA 2QICA 2PREA 2VHSA 4NV8A 4NV7A 3S3RA 1A6RA 3BOWA 5G04B 1E2TA 3BPMA 3K9MA 3OF9A 2LXHC 2ECVA 4YV8A 2AUXA 3HHAA 3EB6A 1VJVA 2HYED 1F2AA 2AYNA 2XU3A 2VFBA 4Q6FA 1S4VA 1WEVA 1YVBA 1TLOA 1WILA 2OULA 1W4TA 4GNDA 1N87A 1DF0A 4W5BA 2E6RA 2JRJA 2E01A 3MHHA 2MA5A 4AYCA 2DZYA 5LKUA 3H7DA 5DINA 4IC2A 3OVXA 3LRQA 4P5OB 4CDFB 4QRXA 3N9LA 2LXPC 1LDKC 4I7BA 3QT4A 1PXVA 4GNGA 1ZCMA 2P86A 3U8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A49 A;  1YK8 A;  4YBM A;  3KV6 A;  1IWD A;  2KWK A;  2HH5 A;  1Z6U A;  1WES A;  2CT2 A;  2R9N A;  2VPB A;  5G05 B;  3LQH A;  1GMY A;  1K2F A;  2HHN A;  2YSM A;  2JQF R;  2AYO A;  4YAX A;  4AYC B;  2IBI A;  3D6S A;  4WZ0 A;  1JQP A;  4G54 A;  4I07 A;  2Y5B A;  1CTE A;  5CVN B;  1SNK A;  4S3O C;  4PTB A;  1Y08 A;  2KU3 A;  4PI3 A;  3GL6 A;  2M3H A;  4X6H A;  2BDL A;  3O35 A;  2E00 A;  3CBK A;  3ASL A;  1XWH A;  1JM7 A;  2K17 A;  2ECW A;  2OZ2 A;  3ZPV E;  4W5C A;  5TBN A;  5PAD A;  5F02 A;  4WZ2 A;  5H1V A;  4HWY A;  2F6J A;  3N3K A;  2C2L A;  2PNS A;  2FSA A;  4OEM A;  4CDC B;  1ME3 A;  2YUC A;  3N3G A;  1VYX A;  4N8W A;  3SOX A;  4AXL A;  2FUU A;  2MD8 C;  1EWO A;  1WEU A;  5CHV A;  3BWK A;  3O34 A;  2ARY A;  2DCA A;  4AP4 A;  3U5N A;  2KGG A;  2DC8 A;  1AYU A;  3O37 A;  1F62 A;  2YW8 A;  3QZV A;  5FER A;  1AU2 A;  2YJ9 A;  2O6X A;  3H8B A;  4YYR A;  4MSX A;  4WA6 A;  2B1M A;  2WBF X;  2AS8 A;  1JM7 B;  2DJG B;  4I7D A;  3U5P A;  4V3K C;  3ZUA A;  1U9Q X;  2Y6E A;  3H89 A;  2D8S A;  4YBS A;  4O64 A;  4QF3 A;  2VPE A;  7PCK A;  2G6Q A;  3H8C A;  3ZTG A;  2JQG R;  2VJE A;  2P0R A;  1U9W A;  2E03 A;  2CSY A;  1LDJ B;  4CCG X;  3M63 A;  3PNR A;  2Y43 A;  3K8U A;  4NN2 A;  1BOR A;  1NB5 A;  4DMX A;  1O0E A;  5H1T A;  3P5V A;  4QH6 A;  1ATK A;  1EWL A;  3T6R A;  2JMI A;  1MM2 A;  2ACT A;  2ECT A;  3KSE A;  4QF2 A;  3F75 A;  1PBH A;  2PNX A;  2XB1 A;  1CPJ A;  4KLB A;  2AN6 A;  2LGL A;  4AXM A;  1F2C A;  3I3T A;  3KWZ A;  4ZQL A;  1CVZ A;  2RSD A;  3RPG B;  3GV4 A;  2C2V S;  1NPZ A;  5J94 A;  2YYR A;  2JMJ A;  2VJE B;  1KFX L;  2LN0 A;  2KFT A;  2YSJ A;  2GFO A;  2YJ8 A;  1TL9 A;  3B79 A;  3ZVZ B;  3ERV A;  3L1Z B;  2MUM A;  3TNX A;  1BP4 A;  4YAD A;  1QXP A;  3H6S A;  4R8P K;  2QIZ A;  2F1G A;  3PBH A;  2L43 A;  1U5I A;  3KWB X;  3O1G A;  1K3B B;  4LLB A;  2R9O A;  3RVW A;  4QRG A;  3IEJ A;  1GCB A;  5B78 A;  2LGK A;  1MHW A;  4PAD A;  1Z60 A;  1MEM A;  3SHB A;  3C6W A;  2G7Y A;  1X9Y A;  5TDW A;  2VP7 A;  2BDZ A;  2KRE A;  2I50 A;  5H1U A;  1E4U A;  3HD3 A;  2MA6 A;  4GB0 A;  1ICF A;  2AUZ A;  4BBQ A;  4UP5 A;  4YBT A;  3OF8 A;  5TDR A;  2AVW A;  5KH3 A;  4CDD B;  2YJB A;  4UI9 B;  2DCD A;  2YJ2 A;  3M99 A;  4YYV A;  2KIZ A;  4FJC A;  2FTD A;  3O70 A;  1Q6K A;  4N4Z A;  4Q8H A;  4AUQ B;  3ZVY A;  4X6J A;  2YQM A;  1NQC A;  2MD7 B;  2FQ9 A;  2HXZ A;  3OIS A;  3PUR A;  2LQ6 A;  1WEP A;  4YVA A;  1MIR A;  3PHD A;  2G8J A;  2IPP B;  2R9M A;  1MM3 A;  1GLO A;  2IDA A;  5H9M A;  3T7L A;  4CA1 A;  3P5U A;  5EGW A;  1VD4 A;  4L7X A;  1DVP A;  2R6N A;  2LGV A;  1X4I A;  2M1R A;  2K16 A;  1CJL A;  1SP4 B;  2EA6 A;  2DJF B;  3MHS A;  3CH2 X;  2MT5 A;  2MNY A;  3HCU A;  4I7C A;  1YK7 A;  4K7C A;  4CDE B;  3MTN A;  2FRQ A;  3WXF A;  3LFY A;  2YRE A;  2HDP A;  2LRI C;  5AIU A;  4R7E A;  1EWM A;  3N9Q A;  1PCI A;  2ATO A;  2E02 A;  5CVO B;  1AYW A;  1HYI A;  1RMD A;  1CB5 A;  5D1K B;  2HD5 A;  2P7U A;  2H7J A;  2FUI A;  2UZG A;  4FK5 A;  4BS5 A;  2Y1M A;  3KW9 A;  5D1M B;  2L75 A;  2CKL A;  5LKZ A;  1IYM A;  1FH0 A;  5AIT A;  3PW3 A;  1EF7 A;  1XKG A;  3IHP A;  1CHC A;  2DCC A;  1DEU A;  3OVZ A;  2FUD A;  1MEG A;  1NB3 A;  4V3L C;  1U9V A;  1ME4 A;  4BQV A;  4FIP A;  1PE6 A;  2KWN A;  3KQI A;  5JA7 A;  4WZ3 B;  3FL2 A;  4UP0 A;  3LXS A;  3BPF A;  1AIM A;  1F29 A;  4BS6 A;  5JG6 A;  2KYU A;  4PP2 E;  4X3G A;  2G45 A;  5LKX A;  1AU0 A;  4RY2 A;  4YYQ A;  4R2Y A;  2DC9 A;  1PAD A;  2L80 A;  2CKL B;  2CSZ A;  1WFK A;  5DKA A;  2LDR A;  2FO5 A;  4YYW A;  2K1J A;  4A0C D;  1AU4 A;  4P6E A;  1WEE A;  2CB5 A;  1KFU L;  4AVX A;  4X6I A;  3RVX A;  3C5K A;  3CH3 X;  4N4F A;  4TKP B;  4LAD B;  4PPE A;  4S3O B;  3M62 A;  3L11 A;  2GHU A;  1HYJ A;  1VSN A;  2DC7 A;  2XU1 A;  5EF4 A;  1EWP A;  4BSQ A;  1U6G B;  1V87 A;  2KGI A;  4A4C A;  3U5M A;  1BY8 A;  1MS6 A;  2LV9 A;  3O36 A;  3IMA A;  3I2D A;  3IV2 A;  3LQI A;  5EYA F;  2ECN A;  2FYE A;  2KWO A;  2QJ0 A;  5B77 A;  5LKT A;  2FRA A;  1MDW A;  2PAD A;  2C0Y A;  4YYU A;  3NHE A;  1WIM A;  5FB1 A;  4BPV A;  2R9C A;  5C13 A;  4GNF A;  3K24 A;  5A24 A;  3SOW A;  2PUY A;  4IC3 A;  3O0U A;  1ITO A;  4I05 A;  3P5W A;  2KR4 A;  1T1H A;  3BCN A;  3GCB A;  4L58 A;  5B75 A;  4W4U A;  4C9Z A;  1TU6 A;  2MNZ A;  2EGP A;  3PUQ A;  3V43 A;  2YHN A;  2K4D A;  4MZS A;  5B8D A;  2ECI A;  3ZYQ A;  1NL6 A;  1F2B A;  4YAT A;  2XU5 A;  2DCB A;  1WEN A;  3EB5 A;  4OEL A;  3IUT A;  2OP3 A;  4YYS A;  8PCH A;  2VPD A;  3KNV A;  3S3Q A;  3RVV A;  4I04 A;  5B76 A;  2DX8 A;  3HTK C;  5G0F A;  4P6G A;  5FPW A;  1G25 A;  3L1X A;  4DMY A;  2OXQ C;  1M6D A;  1X4J A;  3KKU A;  5B79 A;  4B7Y C;  1GEC E;  1PIP A;  1AU3 A;  3RTR B;  2G43 A;  2NQI A;  4QBB A;  3USV A;  4LK9 A;  4MVT A;  1YAL A;  3NG2 A;  3PDF A;  3RPG C;  2YJC A;  1FP0 A;  1THE A;  2VHF A;  3HCS A;  2YU4 A;  5C11 A;  2DZZ A;  2L0B A;  2NAA A;  1PPO A;  2XEU A;  3HWN A;  1QMY A;  3DF0 A;  2M6M A;  3I06 A;  4XI1 A;  1HUC B;  2NQG A;  4FO9 A;  2ZET C;  5LCW B;  2G6D A;  3V6C A;  1WEW A;  4QRV A;  2M85 A;  1POP A;  3BC3 A;  1BQI A;  1Y4H A;  2ECG A;  3SOU A;  2YT5 A;  3IOQ A;  3WXE A;  3V6E A;  4LJN A;  3KX1 A;  2VNF A;  1U9X A;  5FB0 A;  1YT7 A;  2VJF A;  1QDQ A;  2B1N A;  3DPL R;  1STF E;  2H0D A;  4LKA A;  1PPP A;  4MZO A;  1ZIV A;  4ZUX U;  3WXG A;  1WE9 A;  2VPG A;  4F52 B;  1KHP A;  1CSB B;  2L5U A;  2R9F A;  5J3X A;  5KH9 A;  5FEY A;  3HCT A;  5K16 A;  4N79 A;  3DQV R;  3MOR A;  4YC9 A;  2F6N A;  2RI7 A;  3U5O A;  2ECJ A;  2FT2 A;  2NQA A;  5CVM A;  3QSD A;  5I3L A;  1PPD A;  1PPN A;  3P5X A;  2JMD A;  2G8E A;  1ZBD B;  1WGM A;  1WEO A;  2YHO A;  1X4U A;  2EOD A;  2KE1 A;  2YUR A;  5D1L B;  3O33 A;  3VK6 A;  1FBV A;  3N9O A;  3KFQ A;  2MIQ A;  2AU1 A;  2DC6 A;  3AI8 A;  2YQL A;  4N3W A;  3LQJ A;  2VJF B;  3ZNI A;  1BGO A;  3O7A A;  2KWJ A;  4A4B A;  5KH7 A;  2H0D B;  3N9M A;  4Q8G A;  4YAB A;  5CHT A;  6PAD A;  1WEM A;  5TRB A;  4BHW A;  3CBJ A;  1Z2Q A;  3N9P A;  2PBH A;  3QJ3 A;  1AYV A;  4B86 C;  3C9E A;  2Y1N A;  3E1Z B;  1KHQ A;  2NQD B;  1CS8 A;  4PP1 A;  4XUI A;  1CQD A;  2F7D A;  4XR7 A;  1AEC A;  3N4C A;  9PAP A;  2LGG A;  1JOC A;  3HHI A;  2CIO A;  3F5V A;  1WEQ A;  3N9N A;  2BAY A;  2E6S A;  2XU4 A;  4GNE A;  3KV5 A;  5TAB A;  1VFY A;  1KXR A;  2AIM A;  5JH3 A;  4CZW A;  3ZPV 1;  2F42 A;  1QOL A;  1NLJ A;  1CV8 A;  4ZDT A;  2QIC A;  2PRE A;  2VHS A;  3S3R A;  1A6R A;  3BOW A;  5G04 B;  3BPM A;  3K9M A;  3OF9 A;  2LXH C;  2ECV A;  4YV8 A;  2AUX A;  3HHA A;  3EB6 A;  1VJV A;  2HYE D;  1F2A A;  2AYN A;  2XU3 A;  4Q6F A;  1S4V A;  1WEV A;  1YVB A;  1TLO A;  1WIL A;  2OUL A;  4GND A;  1N87 A;  1DF0 A;  4W5B A;  2E6R A;  2JRJ A;  2E01 A;  3MHH A;  2MA5 A;  4AYC A;  2DZY A;  5LKU A;  3H7D A;  5DIN A;  4IC2 A;  3OVX A;  3LRQ A;  4P5O B;  4CDF B;  4QRX A;  3N9L A;  2LXP C;  1LDK C;  4I7B A;  3QT4 A;  1PXV A;  4GNG A;  1ZCM A;  2P86 A;  3U8E A; 
#chains in the Genus database with same CATH topology
 4WUR A;  4A49 A;  1YK8 A;  4YBM A;  3KV6 A;  1IWD A;  2KWK A;  2HH5 A;  1Z6U A;  1WES A;  2CT2 A;  2R9N A;  2VPB A;  5G05 B;  3T9K A;  4OGE A;  3LQH A;  1GMY A;  1K2F A;  2HHN A;  2YSM A;  2JQF R;  2AYO A;  4YAX A;  4AYC B;  2IBI A;  3D6S A;  4WZ0 A;  1JQP A;  4G54 A;  4I07 A;  2Y5B A;  1CTE A;  3PHX A;  5CVN B;  3E2D A;  3PLW A;  1SNK A;  4S3O C;  4PTB A;  3OQC A;  1Y08 A;  2KU3 A;  4PI3 A;  1MBM A;  3GL6 A;  4RF0 A;  2M3H A;  4X6H A;  2BDL A;  3O35 A;  2E00 A;  3CBK A;  3ASL A;  1XWH A;  1JM7 A;  2K17 A;  3ZNH A;  2ECW A;  2OZ2 A;  3ZPV E;  4W5C A;  5TBN A;  5PAD A;  5E6J A;  3MDB C;  5F02 A;  4WZ2 A;  5H1V A;  4HWY A;  2F6J A;  3N3K A;  2C2L A;  2PNS A;  4OVZ A;  2FSA A;  1YZB A;  4OEM A;  4CDC B;  2EXU A;  1ME3 A;  2YUC A;  3N3G A;  1VYX A;  4N8W A;  3SOX A;  4MM3 B;  4AXL A;  3MJ5 A;  2FUU A;  2MD8 C;  1EWO A;  1WEU A;  5CHV A;  3BWK A;  3O34 A;  2ARY A;  2DCA A;  4AP4 A;  3U5N A;  2KGG A;  4XZX A;  2DC8 A;  1AYU A;  3O37 A;  1F62 A;  2YW8 A;  3QZV A;  5FER A;  1AU2 A;  2YJ9 A;  2O6X A;  3H8B A;  4YYR A;  4MSX A;  4WA6 A;  2B1M A;  2WBF X;  2AS8 A;  1JM7 B;  2DJG B;  4I7D A;  3U5P A;  4V3K C;  3ZUA A;  1U9Q X;  2Y6E A;  3BB7 A;  4Z0O A;  3H89 A;  2D8S A;  4YBS A;  4O64 A;  4QF3 A;  4OVZ B;  2VPE A;  7PCK A;  2G6Q A;  3H8C A;  3ZTG A;  2JQG R;  2VJE A;  2P0R A;  1U9W A;  3DDT A;  2E03 A;  2CSY A;  1LDJ B;  4CCG X;  3M63 A;  3PNR A;  2Y43 A;  3K8U A;  4NN2 A;  1BOR A;  1NB5 A;  1PVJ A;  4DMX A;  1O0E A;  5H1T A;  3B21 A;  3BY4 A;  3P5V A;  4QH6 A;  1ATK A;  1EWL A;  3T6R A;  2JMI A;  1MM2 A;  2ACT A;  2ECT A;  3KSE A;  4QF2 A;  3F75 A;  1PBH A;  2PNX A;  2XB1 A;  1CPJ A;  4KLB A;  2AN6 A;  2LGL A;  5EZS A;  4AXM A;  2LAU A;  1F2C A;  3I3T A;  2XOC A;  3KWZ A;  4ZQL A;  1CVZ A;  2RSD A;  3RPG B;  3GV4 A;  2C2V S;  1NPZ A;  3PT2 A;  5J94 A;  3LJU X;  2YYR A;  2JMJ A;  2VJE B;  1KFX L;  2LN0 A;  2KFT A;  4OW0 A;  2YSJ A;  2UZJ A;  2GFO A;  2YJ8 A;  1TL9 A;  3B79 A;  3ZVZ B;  3ERV A;  4MI7 A;  3L1Z B;  2MUM A;  3TNX A;  1BP4 A;  4YAD A;  1QXP A;  3H6S A;  4R8P K;  2QIZ A;  2F1G A;  3PBH A;  4D8E A;  2L43 A;  1U5I A;  2CRW A;  3KWB X;  3O1G A;  2KKX A;  4LLB A;  1K3B B;  2J7Q C;  2R9O A;  3RVW A;  4QRG A;  3IEJ A;  1GCB A;  5B78 A;  2LGK A;  1MHW A;  4PAD A;  1Z60 A;  1MEM A;  4QQ4 A;  2DJA A;  3SHB A;  3C6W A;  4P16 A;  2G7Y A;  3SUB A;  1X9Y A;  5TDW A;  2VP7 A;  2BDZ A;  2KRE A;  2I50 A;  5H1U A;  3M7K A;  1E4U A;  3HD3 A;  2MA6 A;  4GB0 A;  1ICF A;  2AUZ A;  3JUE A;  4BBQ A;  4UP5 A;  1UKF A;  4YBT A;  3OF8 A;  5TDR A;  2AVW A;  5KH3 A;  4CDD B;  2YJB A;  4UI9 B;  2DCD A;  2YJ2 A;  1DKI A;  2CSV A;  3M99 A;  5KO3 A;  4YYV A;  4Z0R A;  2KIZ A;  4FJC A;  2FTD A;  3O70 A;  1Q6K A;  4N4Z A;  4Q8H A;  4AUQ B;  3ZVY A;  4X6J A;  2YQM A;  2FFW A;  1NQC A;  2MD7 B;  2FQ9 A;  2HXZ A;  3OIS A;  3PUR A;  2LQ6 A;  1WEP A;  2XOY A;  4YVA A;  1MIR A;  3PHD A;  2G8J A;  2IPP B;  2R9M A;  1MM3 A;  4BOS A;  1GLO A;  2DSM A;  2IDA A;  5H9M A;  3T7L A;  4CA1 A;  3P5U A;  5EGW A;  2M13 A;  1VD4 A;  4L7X A;  2IQJ A;  1DVP A;  2R6N A;  2Z84 A;  2LGV A;  1X4I A;  2M1R A;  2DOS A;  2HWK A;  2K16 A;  3FM8 C;  1CJL A;  1SP4 B;  2EA6 A;  2DJF B;  3MHS A;  3CH2 X;  2MT5 A;  2MNY A;  5SVY A;  3HCU A;  4I7C A;  1YK7 A;  4K7C A;  4BOU A;  4CDE B;  2XP0 A;  3MTN A;  2FRQ A;  3WXF A;  3LFY A;  4REZ A;  2YRE A;  2HDP A;  2LRI C;  5AIU A;  4R7E A;  1EWM A;  3N9Q A;  5K3Q A;  1PCI A;  2ATO A;  2E02 A;  2EGM A;  4HXD B;  5CVO B;  1AYW A;  3TRK A;  1HYI A;  1RMD A;  1CB5 A;  3Q1D A;  5D1K B;  2HD5 A;  2P7U A;  2H7J A;  2FUI A;  2UZG A;  4FK5 A;  4BS5 A;  2Y1M A;  3KW9 A;  5D1M B;  2L75 A;  2CKL A;  5LKZ A;  1IYM A;  2JTC A;  1FH0 A;  5AIT A;  3PW3 A;  1EF7 A;  1XKG A;  3IHP A;  1CHC A;  2DCC A;  3IFU A;  3O47 A;  1DEU A;  3OVZ A;  3TMP A;  2FUD A;  1MEG A;  1NB3 A;  4V3L C;  1U9V A;  1ME4 A;  4BQV A;  4FIP A;  1PE6 A;  2KWN A;  3KQI A;  5JA7 A;  4WZ3 B;  3FL2 A;  4UP0 A;  3LXS A;  3BPF A;  1AIM A;  1F29 A;  3RNV A;  4BS6 A;  4RKX A;  5JG6 A;  2KYU A;  4BOZ A;  3DWD A;  4X3G A;  4PP2 E;  2G45 A;  3W31 A;  5LKX A;  1AU0 A;  4RY2 A;  4YYQ A;  1DCQ A;  4R2Y A;  2DC9 A;  1PAD A;  2L80 A;  2CKL B;  2CSZ A;  4RF1 A;  1WFK A;  5DKA A;  2LDR A;  2FO5 A;  4YYW A;  2K1J A;  4A0C D;  1AU4 A;  3PHW A;  1WEE A;  4P6E A;  2CB5 A;  1KFU L;  4AVX A;  4X6I A;  3RVX A;  3C5K A;  3CH3 X;  4N4F A;  4TKP B;  4LAD B;  2CRR A;  4PPE A;  4S3O B;  3M62 A;  3L11 A;  2B0O E;  4H9D A;  1HYJ A;  2GHU A;  1VSN A;  2DC7 A;  2XU1 A;  5SVI A;  3FJU B;  4F1P A;  1EWP A;  5EF4 A;  1U6G B;  4BSQ A;  1V87 A;  2KGI A;  4A4C A;  3U5M A;  1BY8 A;  1MS6 A;  2LV9 A;  5JZE A;  3O36 A;  3IMA A;  3I2D A;  3IV2 A;  3LQI A;  5EYA F;  2ECN A;  2FYE A;  2KWO A;  2QJ0 A;  5B77 A;  5LKT A;  2FRA A;  1MDW A;  2PAD A;  5EZQ A;  2C0Y A;  4YYU A;  3NHE A;  1WIM A;  5FB1 A;  4BPV A;  2R9C A;  5C13 A;  3KDE C;  4GNF A;  3K24 A;  5A24 A;  3SOW A;  2PUY A;  4IC3 A;  3O0U A;  1ITO A;  4I05 A;  3P5W A;  2KR4 A;  1T1H A;  3BCN A;  4IP3 A;  3GCB A;  4L58 A;  5B75 A;  4W4U A;  4C9Z A;  1TU6 A;  2MNZ A;  4R3D A;  3W30 A;  2EGP A;  3FAO A;  3PUQ A;  2E61 A;  3V43 A;  2YHN A;  5SVI B;  2K4D A;  2BTW B;  4MZS A;  5B8D A;  3E9S A;  2ECI A;  3ZYQ A;  1NL6 A;  1F2B A;  4YAT A;  3BBA A;  2XU5 A;  2DCB A;  1WEN A;  3EB5 A;  4BOQ A;  4OEL A;  3IUT A;  3LVR E;  2OP3 A;  4YYS A;  8PCH A;  2VPD A;  3KNV A;  3S3Q A;  3RVV A;  4I04 A;  2FE8 A;  5B76 A;  2BU3 A;  2DX8 A;  4PT5 A;  3HTK C;  2P57 A;  4O62 A;  5G0F A;  4P6G A;  5FPW A;  1G25 A;  3L1X A;  4DMY A;  4M0W A;  2OXQ C;  1M6D A;  1X4J A;  3KKU A;  5B79 A;  4B7Y C;  1GEC E;  1PIP A;  1AU3 A;  2G43 A;  3RTR B;  2NQI A;  4QBB A;  3USV A;  4LK9 A;  4A5U A;  4MVT A;  1YAL A;  3NG2 A;  3PDF A;  3RPG C;  2YJC A;  4IUM A;  4D8B A;  1FP0 A;  1THE A;  4GUA A;  2J7Q A;  2VHF A;  3C0R A;  3PSE A;  3HCS A;  2YU4 A;  5C11 A;  2DZZ A;  2L0B A;  2JM3 A;  2NAA A;  1PPO A;  2XEU A;  3HWN A;  1QMY A;  2FD4 A;  3DF0 A;  2M6M A;  3I06 A;  4XI1 A;  1HUC B;  2NQG A;  4FO9 A;  2ZET C;  5LCW B;  2G6D A;  3V6C A;  1WEW A;  4QRV A;  2M85 A;  1POP A;  3BC3 A;  1BQI A;  1Y4H A;  2ECG A;  3SOU A;  2YT5 A;  3IOQ A;  3WXE A;  3V6E A;  4LJN A;  3KX1 A;  2VNF A;  1U9X A;  5FB0 A;  1YT7 A;  3H7H A;  3PHU A;  4D8I A;  2VJF A;  1QDQ A;  2B1N A;  2CON A;  3LVQ E;  3DPL R;  1STF E;  2JRI A;  3FAN A;  2H0D A;  4LKA A;  1PPP A;  4MZO A;  1ZIV A;  4ZUX U;  3WXG A;  1WE9 A;  2VPG A;  4F52 B;  1KHP A;  1CSB B;  2OWA A;  2L5U A;  2R9F A;  5J3X A;  5KH9 A;  5FEY A;  3HCT A;  5K16 A;  4N79 A;  3DQV R;  3MOR A;  4YC9 A;  3U8E A;  2F6N A;  2RI7 A;  3U5O A;  2ECJ A;  2FT2 A;  2NQA A;  5CVM A;  3QSD A;  5I3L A;  1PPD A;  2L7P A;  1PPN A;  3P5X A;  2JMD A;  2G8E A;  2YHO A;  1ZBD B;  1WGM A;  1WEO A;  1X4U A;  2EOD A;  2KE1 A;  2D8U A;  2YUR A;  3O33 A;  5D1L B;  1FBV A;  3N9O A;  3VK6 A;  2MIQ A;  2AU1 A;  2DC6 A;  3AI8 A;  2YQL A;  4N3W A;  3KFQ A;  3LQJ A;  2VJF B;  2AGA A;  3ZNI A;  1BGO A;  3O7A A;  2KWJ A;  3FEH A;  4A4B A;  5KH7 A;  2H0D B;  3N9M A;  4Q8G A;  4YAB A;  5CHT A;  6PAD A;  1WEM A;  5TRB A;  4BHW A;  3CBJ A;  1Z2Q A;  3N9P A;  2PBH A;  3QJ3 A;  5SVX A;  1AYV A;  4B86 C;  3C9E A;  2Y1N A;  3E1Z B;  2YVR A;  4ZTB A;  1KHQ A;  2JUN A;  1CS8 A;  2NQD B;  3MP2 A;  1CQD A;  2F7D A;  4PP1 A;  4XUI A;  4XR7 A;  2RR4 A;  1AEC A;  2XOZ A;  3N4C A;  9PAP A;  2LGG A;  1JOC A;  2BTW A;  3HHI A;  2CIO A;  3F5V A;  1WEQ A;  3N9N A;  2BAY A;  2E6S A;  2XU4 A;  4GNE A;  3MTV A;  3KV5 A;  5TAB A;  1VFY A;  2MKE A;  1KXR A;  2AIM A;  4CZW A;  3ZPV 1;  5JH3 A;  2F42 A;  1QOL A;  1NLJ A;  1CV8 A;  4ZDT A;  2QIC A;  2PRE A;  2VHS A;  3PRM A;  1A6R A;  3BOW A;  3S3R A;  5G04 B;  3BPM A;  3K9M A;  3O65 A;  3OF9 A;  2LXH C;  3LDY A;  2ECV A;  4YV8 A;  2AUX A;  3HHA A;  3EB6 A;  1VJV A;  2HYE D;  1F2A A;  2AYN A;  2XU3 A;  4Q6F A;  2KKY A;  1S4V A;  1WEV A;  1YVB A;  1TLO A;  1WIL A;  2OUL A;  4GND A;  1N87 A;  1DF0 A;  3PRP A;  4W5B A;  4RNA A;  2E6R A;  2JRJ A;  2E01 A;  3MHH A;  2MA5 A;  4AYC A;  2DZY A;  5LKU A;  3H7D A;  5DIN A;  4IC2 A;  3OVX A;  4BOP A;  3LRQ A;  4P5O B;  4CDF B;  4QRX A;  3N9L A;  2LXP C;  1LDK C;  4I7B A;  3QT4 A;  1PXV A;  4GNG A;  1ZCM A;  2P86 A;  4OGC A; 
#chains in the Genus database with same CATH homology
 4A49 A;  1YK8 A;  4YBM A;  3KV6 A;  1IWD A;  2KWK A;  2HH5 A;  1Z6U A;  1WES A;  2CT2 A;  2R9N A;  2VPB A;  5G05 B;  3LQH A;  1GMY A;  1K2F A;  2HHN A;  2YSM A;  2JQF R;  2AYO A;  4YAX A;  4AYC B;  2IBI A;  3D6S A;  4WZ0 A;  1JQP A;  4G54 A;  4I07 A;  2Y5B A;  1CTE A;  5CVN B;  1SNK A;  4S3O C;  4PTB A;  1Y08 A;  2KU3 A;  4PI3 A;  3GL6 A;  2M3H A;  4X6H A;  2BDL A;  3O35 A;  2E00 A;  3CBK A;  3ASL A;  1XWH A;  1JM7 A;  2K17 A;  2ECW A;  2OZ2 A;  3ZPV E;  4W5C A;  5TBN A;  5PAD A;  5F02 A;  4WZ2 A;  5H1V A;  4HWY A;  2F6J A;  3N3K A;  2C2L A;  2PNS A;  2FSA A;  4OEM A;  4CDC B;  1ME3 A;  2YUC A;  3N3G A;  1VYX A;  4N8W A;  3SOX A;  4AXL A;  2FUU A;  2MD8 C;  1EWO A;  1WEU A;  5CHV A;  3BWK A;  3O34 A;  2ARY A;  2DCA A;  4AP4 A;  3U5N A;  2KGG A;  1W6F A;  2DC8 A;  1AYU A;  3O37 A;  1F62 A;  2YW8 A;  3QZV A;  5FER A;  1AU2 A;  2YJ9 A;  2O6X A;  3H8B A;  4YYR A;  4MSX A;  4WA6 A;  2B1M A;  2WBF X;  2AS8 A;  1JM7 B;  2DJG B;  4I7D A;  3U5P A;  4V3K C;  3ZUA A;  1U9Q X;  2Y6E A;  3H89 A;  2D8S A;  4YBS A;  4O64 A;  4QF3 A;  2VPE A;  7PCK A;  2G6Q A;  3H8C A;  1GX3 A;  3ZTG A;  2JQG R;  2VJE A;  2P0R A;  1U9W A;  2E03 A;  2CSY A;  1LDJ B;  4CCG X;  3M63 A;  3PNR A;  2Y43 A;  3K8U A;  4NN2 A;  1BOR A;  1NB5 A;  4DMX A;  1O0E A;  5H1T A;  3P5V A;  4QH6 A;  1ATK A;  1EWL A;  3T6R A;  2JMI A;  1MM2 A;  2ACT A;  2ECT A;  3KSE A;  4QF2 A;  3F75 A;  1PBH A;  2PNX A;  2XB1 A;  1CPJ A;  4KLB A;  2AN6 A;  2LGL A;  4AXM A;  1F2C A;  3I3T A;  3KWZ A;  4ZQL A;  1CVZ A;  2RSD A;  3RPG B;  3GV4 A;  2C2V S;  1NPZ A;  5J94 A;  2YYR A;  2JMJ A;  2VJE B;  1KFX L;  2LN0 A;  2KFT A;  2YSJ A;  2GFO A;  2YJ8 A;  1TL9 A;  3B79 A;  3ZVZ B;  3ERV A;  3L1Z B;  2MUM A;  3TNX A;  3LTW A;  1BP4 A;  4YAD A;  1QXP A;  3H6S A;  4R8P K;  2QIZ A;  2F1G A;  3PBH A;  2L43 A;  1U5I A;  3KWB X;  3O1G A;  1K3B B;  4LLB A;  2R9O A;  3RVW A;  4QRG A;  3IEJ A;  1GCB A;  5B78 A;  2LGK A;  1MHW A;  4PAD A;  1Z60 A;  1MEM A;  3SHB A;  3C6W A;  2G7Y A;  1X9Y A;  5TDW A;  2VP7 A;  2BDZ A;  2KRE A;  2I50 A;  5H1U A;  1E4U A;  3HD3 A;  2MA6 A;  4GB0 A;  1ICF A;  2AUZ A;  4BBQ A;  4UP5 A;  4YBT A;  3OF8 A;  5TDR A;  2AVW A;  5KH3 A;  4CDD B;  2YJB A;  4UI9 B;  2DCD A;  2YJ2 A;  3M99 A;  4YYV A;  2KIZ A;  4FJC A;  2FTD A;  3O70 A;  1Q6K A;  4N4Z A;  4Q8H A;  4AUQ B;  3ZVY A;  4X6J A;  2YQM A;  1NQC A;  2MD7 B;  2FQ9 A;  2HXZ A;  3OIS A;  3PUR A;  2LQ6 A;  1WEP A;  4YVA A;  1MIR A;  3PHD A;  2G8J A;  2IPP B;  2R9M A;  1MM3 A;  1GLO A;  2IDA A;  5H9M A;  3T7L A;  4CA1 A;  3P5U A;  5EGW A;  1VD4 A;  4L7X A;  1DVP A;  2R6N A;  2LGV A;  1X4I A;  2M1R A;  2K16 A;  1CJL A;  1SP4 B;  2EA6 A;  2DJF B;  3MHS A;  3CH2 X;  2MT5 A;  2MNY A;  3HCU A;  4I7C A;  1YK7 A;  4K7C A;  4CDE B;  3MTN A;  2FRQ A;  3WXF A;  3LFY A;  2YRE A;  2HDP A;  2LRI C;  5AIU A;  4R7E A;  1EWM A;  4C5P A;  3N9Q A;  1PCI A;  2ATO A;  2E02 A;  5CVO B;  1AYW A;  1W5R A;  1HYI A;  1RMD A;  1CB5 A;  5D1K B;  2HD5 A;  2P7U A;  2H7J A;  2FUI A;  2UZG A;  4FK5 A;  4BS5 A;  2Y1M A;  3KW9 A;  5D1M B;  2L75 A;  2CKL A;  5LKZ A;  1IYM A;  1FH0 A;  5AIT A;  3PW3 A;  1EF7 A;  1XKG A;  3IHP A;  1CHC A;  2DCC A;  1DEU A;  3OVZ A;  2FUD A;  1MEG A;  1NB3 A;  4V3L C;  1U9V A;  1ME4 A;  4BQV A;  4FIP A;  1PE6 A;  2KWN A;  3KQI A;  5JA7 A;  4WZ3 B;  3FL2 A;  4UP0 A;  3LXS A;  3BPF A;  1AIM A;  1F29 A;  4BS6 A;  5JG6 A;  2KYU A;  4PP2 E;  4X3G A;  2G45 A;  5LKX A;  1AU0 A;  4RY2 A;  4YYQ A;  4R2Y A;  2DC9 A;  1PAD A;  2L80 A;  2CKL B;  2CSZ A;  1WFK A;  5DKA A;  2LDR A;  2FO5 A;  4YYW A;  2K1J A;  4A0C D;  1AU4 A;  4P6E A;  1WEE A;  2CB5 A;  1KFU L;  4AVX A;  4X6I A;  3RVX A;  3C5K A;  3CH3 X;  4N4F A;  4TKP B;  4LAD B;  4PPE A;  4S3O B;  3M62 A;  3L11 A;  2GHU A;  1HYJ A;  1VSN A;  2DC7 A;  2XU1 A;  5EF4 A;  1EWP A;  4BSQ A;  1U6G B;  1V87 A;  2KGI A;  4A4C A;  3U5M A;  1BY8 A;  1MS6 A;  2LV9 A;  3O36 A;  3IMA A;  3I2D A;  3IV2 A;  3LQI A;  5EYA F;  2ECN A;  2FYE A;  2KWO A;  2QJ0 A;  5B77 A;  5LKT A;  2FRA A;  1MDW A;  2PAD A;  2C0Y A;  4YYU A;  3NHE A;  1WIM A;  5FB1 A;  4BPV A;  2R9C A;  5C13 A;  4GNF A;  3K24 A;  5A24 A;  3SOW A;  2PUY A;  4IC3 A;  3O0U A;  1ITO A;  4I05 A;  3P5W A;  2KR4 A;  1T1H A;  3BCN A;  3GCB A;  4L58 A;  5B75 A;  4W4U A;  4C9Z A;  1TU6 A;  2MNZ A;  2EGP A;  3PUQ A;  3V43 A;  2YHN A;  2K4D A;  4MZS A;  5B8D A;  2ECI A;  3ZYQ A;  1NL6 A;  1F2B A;  4YAT A;  2XU5 A;  2DCB A;  1WEN A;  3EB5 A;  4OEL A;  3IUT A;  2OP3 A;  4YYS A;  8PCH A;  2VPD A;  3KNV A;  3S3Q A;  3RVV A;  4I04 A;  5B76 A;  2DX8 A;  3HTK C;  3D9W A;  5G0F A;  4P6G A;  5FPW A;  1G25 A;  3L1X A;  4DMY A;  2OXQ C;  1M6D A;  1X4J A;  3KKU A;  5B79 A;  4B7Y C;  1GEC E;  1PIP A;  1AU3 A;  3RTR B;  2G43 A;  2NQI A;  4QBB A;  3USV A;  4LK9 A;  4MVT A;  1YAL A;  3NG2 A;  3PDF A;  3RPG C;  2YJC A;  1FP0 A;  1THE A;  2VHF A;  3HCS A;  2YU4 A;  5C11 A;  2DZZ A;  2L0B A;  2NAA A;  1PPO A;  2XEU A;  3HWN A;  1QMY A;  3DF0 A;  2M6M A;  3I06 A;  4XI1 A;  1HUC B;  2NQG A;  4FO9 A;  2ZET C;  5LCW B;  2G6D A;  3V6C A;  1WEW A;  4QRV A;  2M85 A;  1POP A;  3BC3 A;  1BQI A;  1Y4H A;  2ECG A;  3SOU A;  4B55 A;  2YT5 A;  3IOQ A;  3WXE A;  3V6E A;  4LJN A;  3KX1 A;  2VNF A;  1U9X A;  5FB0 A;  1YT7 A;  2VJF A;  1QDQ A;  2B1N A;  3DPL R;  1STF E;  2H0D A;  4LKA A;  1PPP A;  4MZO A;  1ZIV A;  4ZUX U;  3WXG A;  1WE9 A;  2VPG A;  4F52 B;  1KHP A;  1CSB B;  2VFC A;  2L5U A;  2R9F A;  5J3X A;  5KH9 A;  5FEY A;  3HCT A;  5K16 A;  4N79 A;  3DQV R;  3MOR A;  4YC9 A;  2F6N A;  2RI7 A;  3U5O A;  2ECJ A;  2FT2 A;  2NQA A;  5CVM A;  3QSD A;  5I3L A;  1PPD A;  1PPN A;  3P5X A;  2BSZ A;  2JMD A;  2G8E A;  1ZBD B;  1WGM A;  1WEO A;  2YHO A;  1X4U A;  2EOD A;  2KE1 A;  2YUR A;  5D1L B;  3O33 A;  3VK6 A;  1FBV A;  3N9O A;  3KFQ A;  2MIQ A;  2AU1 A;  2DC6 A;  3AI8 A;  2YQL A;  4N3W A;  4GUZ A;  3LQJ A;  2VJF B;  3ZNI A;  1BGO A;  3O7A A;  2KWJ A;  4A4B A;  5KH7 A;  2H0D B;  3N9M A;  4Q8G A;  4YAB A;  5CHT A;  6PAD A;  1WEM A;  5TRB A;  4BHW A;  4BGF A;  3CBJ A;  1Z2Q A;  3N9P A;  2PBH A;  3QJ3 A;  1AYV A;  4B86 C;  3C9E A;  2Y1N A;  3E1Z B;  1KHQ A;  2NQD B;  1CS8 A;  4PP1 A;  4XUI A;  1CQD A;  2F7D A;  4XR7 A;  1AEC A;  3N4C A;  9PAP A;  2LGG A;  1JOC A;  3HHI A;  2CIO A;  3F5V A;  1WEQ A;  3N9N A;  2BAY A;  2E6S A;  2XU4 A;  4GNE A;  3KV5 A;  5TAB A;  1VFY A;  1KXR A;  2AIM A;  5JH3 A;  4CZW A;  3ZPV 1;  2F42 A;  1QOL A;  1NLJ A;  1CV8 A;  4ZDT A;  2QIC A;  2PRE A;  2VHS A;  4NV8 A;  4NV7 A;  3S3R A;  1A6R A;  3BOW A;  5G04 B;  1E2T A;  3BPM A;  3K9M A;  3OF9 A;  2LXH C;  2ECV A;  4YV8 A;  2AUX A;  3HHA A;  3EB6 A;  1VJV A;  2HYE D;  1F2A A;  2AYN A;  2XU3 A;  2VFB A;  4Q6F A;  1S4V A;  1WEV A;  1YVB A;  1TLO A;  1WIL A;  2OUL A;  1W4T A;  4GND A;  1N87 A;  1DF0 A;  4W5B A;  2E6R A;  2JRJ A;  2E01 A;  3MHH A;  2MA5 A;  4AYC A;  2DZY A;  5LKU A;  3H7D A;  5DIN A;  4IC2 A;  3OVX A;  3LRQ A;  4P5O B;  4CDF B;  4QRX A;  3N9L A;  2LXP C;  1LDK C;  4I7B A;  3QT4 A;  1PXV A;  4GNG A;  1ZCM A;  2P86 A;  3U8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...