4FK5A

Structure of the saga ubp8(s144n)/sgf11/sus1/sgf73 dub module
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
473
structure length
437
Chain Sequence
AAMSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGNTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALSTNRQTGFIYLLTCAWKINQQQDAHEFWQFIINQIHQSYVLDLPNAKEVSRANNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQCGECNSAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
total genus 132
structure length 437
sequence length 473
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4fk5A01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4fk5A02
3RTRB 2HYED 3C6WA 4QRVA 1PCIA 4P5OB 4X6HA 5J94A 3KWZA 3HWNA 2F1GA 3QZVA 5D1KB 3IEJA 5B79A 2R9CA 2D8SA 4CCGX 3BWKA 4I07A 3ZPVE 4XI1A 3FL2A 5G0FA 5J3XA 5B75A 1U9XA 3NHEA 4WZ2A 3C9EA 5G04B 2MNZA 3F5VA 3GL6A 4ZUXU 4YABA 2YJ2A 2FTDA 3QT4A 4W5BA 1AECA 2KFTA 4X6IA 1NL6A 2NQIA 1K2FA 1ZCMA 2IBIA 4QF2A 1BGOA 2K17A 2VHFA 5B78A 2M6MA 2KWNA 2GFOA 3L11A 2ACTA 4BPVA 2P7UA 2LQ6A 3GV4A 1X4JA 1TL9A 1F2BA 4V3KC 1HUCB 1M6DA 3KV6A 4CZWA 4GNFA 6PADA 4YADA 5LCWB 1F29A 4YV8A 1N87A 1Y08A 4MZSA 4P6EA 1ME4A 2LRIC 2VP7A 3KX1A 2QICA 3L1XA 4YYSA 2BAYA 2G6DA 3N9LA 2YHOA 2DC6A 4FJCA 5KH3A 2KR4A 4A0CD 1CTEA 1JOCA 2Y1MA 1VYXA 2F6NA 1YALA 2FRQA 1WENA 2DCCA 3P5WA 2AYNA 2DC7A 2CB5A 3ZPV1 4O64A 2R9OA 1E4UA 3BPMA 4IC2A 1O0EA 3O1GA 1PBHA 3USVA 2KIZA 4YBSA 4BQVA 4N4ZA 4F52B 2YW8A 2ECTA 2CKLB 3N9PA 2CIOA 3RPGC 2L43A 4Q8HA 3U5NA 4I04A 2L80A 3P5VA 5H1VA 2PBHA 2ZETC 3SOUA 4R7EA 3N4CA 3HHIA 3H7DA 4QBBA 2YYRA 1BY8A 4PTBA 4TKPB 4S3OB 3O70A 3V43A 4UP5A 3LXSA 4CA1A 1QXPA 3V6EA 2YURA 2LV9A 3KKUA 1VFYA 3I2DA 2B1MA 3AI8A 3ZUAA 2NQGA 2C2VS 3KNVA 4AYCB 3ZVZB 2CT2A 3F75A 4W5CA 5F02A 1AU4A 2VNFA 2B1NA 5CVNB 2KWOA 2Y6EA 4XR7A 4LJNA 2PNSA 3K8UA 5AIUA 1XKGA 2KE1A 4CDDB 5C13A 4AXLA 2XU1A 5FB1A 3U5OA 2DX8A 3PDFA 3WXFA 4YAXA 4YATA 3N9MA 2XB1A 4GNEA 2HH5A 2GHUA 1DVPA 1RMDA 4A49A 5CHVA 2P86A 2JMJA 3BC3A 4YYWA 5FEYA 1ITOA 2RSDA 3O34A 5EYAF 5B76A 2KGGA 1GECE 2MUMA 3IOQA 1A6RA 1HYIA 1GLOA 2HD5A 4LKAA 3CH2X 3RVXA 4I05A 4A4BA 1XWHA 1AU0A 4QF3A 1THEA 2H7JA 2VPBA 1WEEA 3SOWA 2YJ8A 2MT5A 1WEPA 5JG6A 2ECJA 2HDPA 3ZTGA 3P5UA 4HWYA 1EF7A 4Q6FA 5G05B 1FBVA 4CDEB 3S3QA 2FUDA 2OULA 1MM2A 2ECVA 4N3WA 2E03A 1BORA 1CSBB 2AUZA 2DCAA 2G8EA 1QDQA 1BQIA 2XU5A 4BSQA 3N3GA 2WBFX 7PCKA 1ZIVA 1EWOA 2KREA 3CH3X 4OEMA 2R9NA 4C9ZA 5I3LA 3U5MA 2DCDA 5CVOB 1F62A 4UP0A 1FP0A 3L1ZB 3LQJA 2ATOA 3IMAA 2ECGA 2C0YA 1MEMA 3HCSA 1CHCA 1WFKA 2K16A 2R9MA 4X6JA 3HTKC 2R9FA 3LQIA 4L58A 4WZ0A 2L75A 3HD3A 5TRBA 3N9QA 1T1HA 2MNYA 3ASLA 4R2YA 5K16A 3MHSA 2YU4A 1VSNA 4A4CA 1PADA 2VPEA 3KWBX 2JQFR 5A24A 8PCHA 2G43A 3E1ZB 4LK9A 5H9MA 4IC3A 4YBTA 2VJEA 3O0UA 1WEMA 2K1JA 5LKZA 1G25A 2EA6A 2YREA 4B86C 4LLBA 2MD7B 2FSAA 3KV5A 1CPJA 2CSZA 4KLBA 3QJ3A 5FPWA 4V3LC 3IV2A 5AITA 2FO5A 1VD4A 1MHWA 2XU3A 2M85A 2E6RA 3K24A 4AVXA 3P5XA 2LDRA 1ZBDB 3HHAA 2QIZA 2DC9A 2LGVA 4MVTA 3ERVA 5JA7A 3VK6A 5B8DA 1WGMA 1CS8A 1AIMA 1KFUL 2C2LA 2L0BA 4B7YC 2JRJA 1AU3A 4CDFB 3N3KA 3QSDA 4BBQA 1F2AA 3PW3A 3V6CA 2HHNA 4YYRA 2NAAA 2YUCA 1F2CA 1STFE 5TDWA 2CKLA 2VJFA 3OVXA 3U8EA 4PPEA 2QJ0A 2MA5A 1X4IA 2RI7A 4ZQLA 1NQCA 3MTNA 2EGPA 3GCBA 2YJ9A 3N9NA 2E00A 3DQVR 1YT7A 3T6RA 1POPA 4PP2E 1AU2A 2IDAA 9PAPA 1U6GB 3SOXA 3CBJA 2LN0A 2O6XA 4PP1A 2KYUA 5D1LB 2F42A 1KXRA 3EB6A 1TLOA 5LKXA 1PIPA 2FRAA 2LGKA 1CB5A 3EB5A 2PREA 4AP4A 4MZOA 1WEVA 2ECWA 2KGIA 1U9QX 1NB5A 2NQDB 4QH6A 2DZYA 3O35A 1WEOA 4FIPA 1NB3A 1GCBA 3I06A 2PUYA 2LXPC 2F6JA 3OF9A 1DEUA 5D1MB 3DPLR 1AYUA 3HCUA 2M3HA 4S3OC 3MHHA 1QMYA 3TNXA 1LDJB 2I50A 4FK5A 2OXQC 3H8BA 2E01A 2XU4A 3WXGA 5DKAA 3PURA 3ZNIA 1MDWA 2Y5BA 4N8WA 2G7YA 1Z6UA 4X3GA 4MSXA 1CJLA 1PPOA 3KFQA 2JMIA 4L7XA 1CQDA 2MD8C 5PADA 4YC9A 3H8CA 3OF8A 2DCBA 3D6SA 2AU1A 4R8PK 2L5UA 4YVAA 2YT5A 5EGWA 2DJFB 1KHQA 1PXVA 4I7DA 2KWJA 2AYOA 1DF0A 5EF4A 3LQHA 3LRQA 2VHSA 1KHPA 2K4DA 1QOLA 3O7AA 5KH7A 3PBHA 3S3RA 2PADA 4NN2A 2HXZA 3I3TA 1MS6A 4LADB 2AIMA 4I7BA 2KU3A 1PE6A 2Y1NA 3HCTA 5B77A 1CV8A 4WZ3B 1V87A 3DF0A 3KW9A 2OP3A 4BHWA 2FUUA 3RPGB 2FQ9A 1Z2QA 1HYJA 3WXEA 4YYUA 2G8JA 5JH3A 5KH9A 4P6GA 2F7DA 3N9OA 1WE9A 2H0DA 1JM7B 2LXHC 2P0RA 3MORA 2YJCA 2VPDA 2OZ2A 3KSEA 1K3BB 3RVVA 1U5IA 3OISA 3U5PA 3O37A 2MA6A 1VJVA 1JM7A 2XEUA 1U9VA 3ZVYA 2AN6A 2YSMA 4G54A 1AYVA 5FERA 1PPDA 2AUXA 1WESA 2KWKA 2VJEB 4YBMA 2CSYA 1WEWA 2DJGB 4OELA 5CVMA 1CVZA 3SHBA 4GNDA 4ZDTA 1GMYA 4AXMA 1ME3A 1U9WA 3BPFA 4GB0A 2AVWA 1IYMA 2EODA 1PPNA 1WILA 1S4VA 1ATKA 4PI3A 2FT2A 1Y4HA 4BS6A 3CBKA 2YQLA 1JQPA 1FH0A 3ZYQA 3LFYA 1BP4A 2DZZA 5LKUA 1X4UA 3NG2A 1LDKC 1MM3A 4YYVA 1Q6KA 3T7LA 1WIMA 2H0DB 4K7CA 4BS5A 2LGLA 2G6QA 2E02A 4Q8GA 4DMYA 3IHPA 5TABA 2FUIA 2YHNA 2G45A 2YSJA 5C11A 5H1UA 1X9YA 4GNGA 2BDLA 3H89A 2VPGA 2AS8A 4XUIA 1IWDA 2ARYA 3BCNA 5DINA 4FO9A 3K9MA 1PPPA 1Z60A 2JMDA 4DMXA 3PNRA 1SP4B 3M63A 2IPPB 2UZGA 3PUQA 4W4UA 1EWPA 3O36A 2ECNA 2JQGR 4PADA 3B79A 4UI9B 2R6NA 5LKTA 3H6SA 3KQIA 2DC8A 3BOWA 4N4FA 4WA6A 5TDRA 2ECIA 4YYQA 1YK7A 1ICFA 3M62A 2PNXA 4QRXA 1MIRA 1TU6A 2BDZA 5TBNA 1KFXL 2FYEA 1EWMA 1SNKA 1AYWA 5CHTA 1WEUA 4I7CA 1YK8A 3PHDA 4AYCA 1MEGA 3C5KA 5FB0A 4QRGA 4RY2A 2NQAA 2LGGA 2Y43A 2M1RA 3RVWA 1NPZA 2YJBA 4CDCB 2YQMA 2MIQA 3M99A 1WEQA 2VJFB 1EWLA 3OVZA 3O33A 1NLJA 4AUQB 5H1TA 4N79A 2E6SA 1YVBA 3IUTA
chains in the Genus database with same CATH superfamily
1MBMA 3RTRB 2HYED 3C6WA 4QRVA 3W31A 1PCIA 4P5OB 4X6HA 5J94A 3KWZA 4RF0A 3HWNA 2F1GA 3QZVA 3FANA 5D1KB 3IEJA 5B79A 2R9CA 3TRKA 2D8SA 4CCGX 3BWKA 4I07A 3ZPVE 3IFUA 4ZTBA 4WURA 4XI1A 3FL2A 5G0FA 5J3XA 5B75A 1U9XA 3NHEA 4WZ2A 3C9EA 5G04B 2MNZA 3F5VA 2CONA 4H9DA 2DOSA 2XOZA 3GL6A 4ZUXU 4YABA 2YJ2A 2FTDA 3QT4A 4OVZB 1AECA 4W5BA 2KFTA 4X6IA 1NL6A 2NQIA 1K2FA 1ZCMA 2IBIA 4MI7A 4QF2A 1BGOA 2K17A 2VHFA 5B78A 5EZSA 2M6MA 2KWNA 2GFOA 2J7QC 2IQJA 3L11A 2ACTA 4BPVA 2P7UA 2LQ6A 3DWDA 2YVRA 3GV4A 2JTCA 1X4JA 1TL9A 1F2BA 4V3KC 1HUCB 1M6DA 3KV6A 4CZWA 2AGAA 4GNFA 3PT2A 6PADA 4YADA 5LCWB 1F29A 4YV8A 4O62A 1N87A 1Y08A 4MZSA 4P6EA 1ME4A 2LRIC 2VP7A 1YZBA 3KX1A 2QICA 2EXUA 3L1XA 4YYSA 2BAYA 4BOZA 2G6DA 3N9LA 2YHOA 2DC6A 3E9SA 4FJCA 5KH3A 1DCQA 2KR4A 4A0CD 1CTEA 1JOCA 2Y1MA 1VYXA 2F6NA 1YALA 2FRQA 1WENA 2DCCA 3P5WA 2AYNA 2DC7A 2CB5A 3LVRE 3ZPV1 4O64A 2CRRA 2R9OA 1E4UA 3BPMA 2L7PA 4IC2A 1O0EA 1PBHA 3O1GA 3USVA 2KIZA 2XOCA 4YBSA 4BQVA 4N4ZA 4F52B 2YW8A 2ECTA 2J7QA 2CKLB 3N9PA 2CIOA 3RPGC 2L43A 4Q8HA 3U5NA 4I04A 2KKXA 4IUMA 2L80A 4GUAA 3P5VA 5H1VA 2PBHA 2ZETC 3SOUA 4R7EA 2BU3A 3N4CA 3HHIA 3H7DA 4QBBA 2YYRA 1BY8A 4PTBA 4TKPB 4S3OB 3O70A 3V43A 4UP5A 3LXSA 4CA1A 1QXPA 3DDTA 2YURA 2LV9A 3KKUA 3V6EA 1VFYA 3I2DA 2B1MA 3AI8A 3ZUAA 2NQGA 2C2VS 3KNVA 4P16A 4AYCB 3ZVZB 2CT2A 3F75A 3O65A 4W5CA 5F02A 1AU4A 2VNFA 2B1NA 5CVNB 2KWOA 4Z0RA 2Y6EA 4XR7A 4LJNA 2PNSA 3K8UA 5AIUA 1XKGA 2KE1A 4CDDB 5C13A 2E61A 4AXLA 2XU1A 5FB1A 3U5OA 2DX8A 3E2DA 3PDFA 3BBAA 3WXFA 4YAXA 4BOPA 4YATA 3N9MA 2XB1A 4GNEA 2HH5A 2GHUA 2EGMA 1DVPA 1RMDA 4A49A 5CHVA 2P86A 2JMJA 3BC3A 4OGEA 4YYWA 5FEYA 1ITOA 2RSDA 3O34A 5EYAF 2FFWA 2KGGA 5B76A 1GECE 2MUMA 3IOQA 1A6RA 1HYIA 1GLOA 2HD5A 4LKAA 3CH2X 3RVXA 4I05A 4A4BA 3PRPA 3JUEA 1XWHA 1AU0A 4QF3A 1THEA 1UKFA 2H7JA 2LAUA 2VPBA 1WEEA 3SOWA 2YJ8A 2MT5A 4BOUA 1WEPA 5JG6A 2ECJA 2HDPA 3ZTGA 3P5UA 4HWYA 1EF7A 4Q6FA 5G05B 1FBVA 4CDEB 3S3QA 2FUDA 2OULA 1MM2A 2ECVA 4N3WA 4REZA 2E03A 1BORA 1CSBB 2AUZA 2DCAA 2G8EA 1QDQA 5E6JA 1BQIA 3PRMA 2RR4A 2XU5A 4BSQA 3N3GA 2WBFX 7PCKA 1ZIVA 1EWOA 2KREA 3CH3X 4OEMA 2R9NA 4C9ZA 5I3LA 2DJAA 3U5MA 2XOYA 2DCDA 5CVOB 1F62A 4UP0A 1FP0A 3L1ZB 3LQJA 2ATOA 2B0OE 3IMAA 2ECGA 2C0YA 1MEMA 3HCSA 1CHCA 1WFKA 2K16A 2R9MA 4X6JA 3HTKC 2R9FA 3LQIA 4L58A 4WZ0A 2L75A 5SVIA 3LDYA 3HD3A 5TRBA 3MP2A 3N9QA 1T1HA 2MNYA 3ASLA 4R2YA 5K16A 3MHSA 2YU4A 3T9KA 4A4CA 1PADA 1VSNA 2VPEA 4M0WA 3KWBX 2JQFR 5A24A 8PCHA 2G43A 3PLWA 3E1ZB 4LK9A 5H9MA 4IC3A 4YBTA 2VJEA 5KO3A 3O0UA 1WEMA 2K1JA 5LKZA 1G25A 2EA6A 2YREA 4B86C 4LLBA 2MD7B 2FSAA 3KV5A 1CPJA 2CSZA 4KLBA 3QJ3A 5FPWA 4V3LC 3IV2A 5AITA 2HWKA 2FO5A 2KKYA 2FE8A 2OWAA 1VD4A 1MHWA 2XU3A 2M85A 2E6RA 3K24A 2Z84A 4AVXA 3P5XA 2LDRA 1ZBDB 3HHAA 2QIZA 5SVYA 2DC9A 3FJUB 2LGVA 4MVTA 3ERVA 5JA7A 3VK6A 5B8DA 1WGMA 1CS8A 1AIMA 1KFUL 2C2LA 2XP0A 2L0BA 4B7YC 2JRJA 1AU3A 4CDFB 3N3KA 3QSDA 4BBQA 1F2AA 3PW3A 3PHXA 2HHNA 3V6CA 2NAAA 4YYRA 2YUCA 1F2CA 1STFE 5TDWA 2CKLA 2VJFA 4F1PA 3OVXA 3U8EA 4PPEA 2QJ0A 2MA5A 1X4IA 2RI7A 4ZQLA 1NQCA 3MTNA 3PHUA 2EGPA 2P57A 3O47A 3GCBA 2YJ9A 3BB7A 3N9NA 2E00A 3DQVR 1YT7A 3T6RA 1POPA 4PP2E 1AU2A 2IDAA 9PAPA 1U6GB 3SOXA 3CBJA 2LN0A 2O6XA 4PP1A 2KYUA 5D1LB 2F42A 5JZEA 3SUBA 1KXRA 3EB6A 1TLOA 5LKXA 1PIPA 2FRAA 3MJ5A 2LGKA 1CB5A 3EB5A 2PREA 4AP4A 4MZOA 3PSEA 1WEVA 2ECWA 2KGIA 1U9QX 1NB5A 2NQDB 4QH6A 2DZYA 3O35A 1WEOA 4FIPA 3LJUX 1NB3A 1GCBA 4OGCA 3PHWA 2BTWA 3I06A 2JRIA 2PUYA 2LXPC 2F6JA 3OF9A 1DEUA 5D1MB 3DPLR 1AYUA 4D8EA 3HCUA 3MDBC 2M3HA 4S3OC 3MHHA 1QMYA 3BY4A 3MTVA 3TNXA 1LDJB 2I50A 5EZQA 4FK5A 2OXQC 3H8BA 2E01A 2XU4A 3WXGA 5DKAA 3RNVA 3PURA 3ZNIA 1MDWA 4XZXA 2Y5BA 4N8WA 2G7YA 1Z6UA 4X3GA 4MSXA 1CJLA 1PPOA 3KFQA 2JMIA 4L7XA 1CQDA 2MD8C 4IP3A 5PADA 4YC9A 3H8CA 3OF8A 2DCBA 3D6SA 2AU1A 4R8PK 2CRWA 2L5UA 4YVAA 2YT5A 5EGWA 2DJFB 1KHQA 1PXVA 4I7DA 2KWJA 3H7HA 2AYOA 3FM8C 1DF0A 5EF4A 3LQHA 3LRQA 2VHSA 1KHPA 2D8UA 2K4DA 1QOLA 3O7AA 5KH7A 3PBHA 4OVZA 3S3RA 3FEHA 2PADA 4NN2A 2UZJA 4RF1A 2HXZA 3I3TA 1MS6A 4LADB 2AIMA 4I7BA 2KU3A 1PE6A 1PVJA 2Y1NA 3HCTA 5B77A 1CV8A 4BOQA 4WZ3B 1V87A 3DF0A 3KW9A 2OP3A 2FUUA 3RPGB 4BHWA 2FQ9A 3C0RA 1Z2QA 1HYJA 3WXEA 4YYUA 2G8JA 5JH3A 5KH9A 4P6GA 2F7DA 1WE9A 3N9OA 2CSVA 2H0DA 1JM7B 2LXHC 2P0RA 3MORA 4A5UA 2YJCA 2VPDA 4MM3B 2OZ2A 2BTWB 3KSEA 1K3BB 3RVVA 1U5IA 3OISA 3U5PA 3O37A 2MA6A 1VJVA 1JM7A 5K3QA 2XEUA 1U9VA 2MKEA 2AN6A 2YSMA 5SVXA 3ZVYA 4G54A 1AYVA 5FERA 1PPDA 3IUTA 2AUXA 1WESA 2KWKA 2VJEB 4YBMA 2CSYA 1WEWA 2DJGB 3M7KA 4OELA 1CVZA 3SHBA 4OW0A 2JUNA 5CVMA 4GNDA 4ZDTA 1GMYA 4AXMA 1ME3A 1U9WA 3BPFA 4GB0A 2AVWA 1IYMA 2EODA 1PPNA 1WILA 1S4VA 1ATKA 4PI3A 2FT2A 1Y4HA 4BS6A 4D8BA 3CBKA 2YQLA 1JQPA 4RNAA 1FH0A 3ZYQA 3LFYA 1BP4A 2DZZA 5LKUA 1X4UA 3NG2A 3Q1DA 1LDKC 1MM3A 4YYVA 1Q6KA 3T7LA 1WIMA 2H0DB 4K7CA 4BS5A 2LGLA 2G6QA 2E02A 4Q8GA 4D8IA 3FAOA 3ZNHA 4DMYA 3IHPA 5TABA 2FUIA 2YHNA 2G45A 2YSJA 5C11A 5H1UA 1X9YA 4GNGA 2BDLA 3H89A 2VPGA 2AS8A 4XUIA 1IWDA 2ARYA 4QQ4A 5DINA 3BCNA 4FO9A 2DSMA 3K9MA 1PPPA 1Z60A 2JMDA 2M13A 4DMXA 3PNRA 1SP4B 3M63A 2IPPB 2UZGA 3PUQA 4W4UA 3OQCA 1EWPA 3O36A 2ECNA 1DKIA 2JQGR 4PADA 3B79A 4UI9B 3TMPA 2R6NA 5LKTA 3H6SA 3KQIA 2DC8A 3BOWA 4N4FA 4WA6A 5TDRA 3W30A 4BOSA 2ECIA 4YYQA 1YK7A 1ICFA 3M62A 2PNXA 4QRXA 5SVIB 1MIRA 1TU6A 2BDZA 5TBNA 1KFXL 2FYEA 1EWMA 1SNKA 1AYWA 5CHTA 2JM3A 1WEUA 4I7CA 1YK8A 3PHDA 4AYCA 1MEGA 3C5KA 5FB0A 4PT5A 4QRGA 2NQAA 4RY2A 2LGGA 2Y43A 2M1RA 3LVQE 3RVWA 3B21A 4RKXA 1NPZA 2YJBA 4CDCB 2YQMA 4HXDB 2MIQA 3M99A 1WEQA 2VJFB 1EWLA 3OVZA 3O33A 1NLJA 4AUQB 5H1TA 3KDEC 4N79A 4R3DA 4Z0OA 2E6SA 1YVBA 2FD4A
chains in the Genus database with same CATH topology
3RTRB 2HYED 3C6WA 3D9WA 4QRVA 1PCIA 4P5OB 4X6HA 5J94A 3KWZA 3HWNA 2F1GA 3QZVA 5D1KB 3IEJA 5B79A 2R9CA 2D8SA 4CCGX 3BWKA 4I07A 3ZPVE 4XI1A 3FL2A 5G0FA 5J3XA 5B75A 1U9XA 3NHEA 4WZ2A 3C9EA 5G04B 2MNZA 3F5VA 3GL6A 4ZUXU 4YABA 2YJ2A 2FTDA 3QT4A 4W5BA 1AECA 2KFTA 4X6IA 1NL6A 2NQIA 1K2FA 1ZCMA 2IBIA 4QF2A 1BGOA 2K17A 2VHFA 5B78A 2M6MA 2KWNA 2GFOA 3L11A 2ACTA 4BPVA 2P7UA 2LQ6A 3GV4A 1X4JA 1TL9A 1F2BA 4V3KC 1HUCB 1M6DA 3KV6A 4CZWA 4GNFA 6PADA 4YADA 5LCWB 1F29A 4YV8A 2VFBA 1W4TA 1N87A 1Y08A 4MZSA 4P6EA 1ME4A 2LRIC 2VP7A 3KX1A 2QICA 3L1XA 4YYSA 2BAYA 2G6DA 3N9LA 2YHOA 2DC6A 4FJCA 1W5RA 5KH3A 2KR4A 4A0CD 1CTEA 1JOCA 2Y1MA 1VYXA 2F6NA 1YALA 2FRQA 1WENA 2DCCA 3P5WA 2AYNA 2DC7A 2CB5A 3ZPV1 4O64A 2VFCA 2R9OA 1E4UA 3BPMA 4IC2A 1O0EA 3O1GA 1PBHA 3USVA 2KIZA 4YBSA 4BQVA 4N4ZA 4F52B 2YW8A 2ECTA 2CKLB 3N9PA 2CIOA 3RPGC 2L43A 4B55A 4Q8HA 3U5NA 4I04A 2L80A 3P5VA 5H1VA 2PBHA 2ZETC 3SOUA 4R7EA 3N4CA 3HHIA 3H7DA 4QBBA 2YYRA 1BY8A 4PTBA 4TKPB 4S3OB 2BSZA 3O70A 3V43A 4UP5A 3LXSA 4CA1A 1QXPA 3V6EA 2YURA 2LV9A 3KKUA 1VFYA 3I2DA 2B1MA 3AI8A 3ZUAA 2NQGA 2C2VS 3KNVA 4AYCB 3ZVZB 2CT2A 3F75A 4W5CA 5F02A 1AU4A 2VNFA 2B1NA 5CVNB 2KWOA 2Y6EA 4XR7A 4LJNA 2PNSA 3K8UA 5AIUA 1XKGA 2KE1A 4CDDB 5C13A 1E2TA 4AXLA 2XU1A 5FB1A 3U5OA 2DX8A 3PDFA 3WXFA 4YAXA 4YATA 3N9MA 2XB1A 4GNEA 2HH5A 2GHUA 1DVPA 1RMDA 4A49A 5CHVA 2P86A 2JMJA 3BC3A 4YYWA 5FEYA 1ITOA 2RSDA 3O34A 5EYAF 5B76A 2KGGA 1GECE 2MUMA 3IOQA 1A6RA 1HYIA 1GLOA 2HD5A 4LKAA 3CH2X 3RVXA 4I05A 4A4BA 1GX3A 1XWHA 1AU0A 4QF3A 1THEA 2H7JA 2VPBA 1WEEA 3SOWA 2YJ8A 2MT5A 1WEPA 5JG6A 2ECJA 2HDPA 3ZTGA 3P5UA 4HWYA 1EF7A 4Q6FA 5G05B 1FBVA 4CDEB 3S3QA 2FUDA 2OULA 1MM2A 2ECVA 4N3WA 2E03A 1BORA 1CSBB 2AUZA 2DCAA 1W6FA 1QDQA 2G8EA 1BQIA 2XU5A 4BSQA 3N3GA 2WBFX 7PCKA 1ZIVA 1EWOA 2KREA 3CH3X 4OEMA 2R9NA 4C9ZA 5I3LA 3U5MA 2DCDA 5CVOB 1F62A 3LTWA 4UP0A 1FP0A 3L1ZB 3LQJA 2ATOA 3IMAA 2ECGA 2C0YA 1MEMA 3HCSA 1CHCA 1WFKA 2K16A 2R9MA 4X6JA 3HTKC 2R9FA 3LQIA 4L58A 4WZ0A 2L75A 3HD3A 5TRBA 3N9QA 1T1HA 2MNYA 3ASLA 4R2YA 5K16A 3MHSA 2YU4A 1VSNA 4A4CA 1PADA 2VPEA 4C5PA 3KWBX 2JQFR 5A24A 8PCHA 2G43A 3E1ZB 4LK9A 5H9MA 4IC3A 4YBTA 2VJEA 3O0UA 1WEMA 2K1JA 5LKZA 1G25A 2EA6A 2YREA 4B86C 4LLBA 2MD7B 2FSAA 3KV5A 1CPJA 2CSZA 4KLBA 3QJ3A 5FPWA 4V3LC 3IV2A 5AITA 2FO5A 4GUZA 1VD4A 1MHWA 2XU3A 2M85A 2E6RA 3K24A 4BGFA 4AVXA 3P5XA 2LDRA 1ZBDB 3HHAA 2QIZA 2DC9A 2LGVA 4MVTA 3ERVA 4NV7A 5JA7A 3VK6A 5B8DA 1WGMA 1CS8A 1AIMA 1KFUL 2C2LA 2L0BA 4B7YC 2JRJA 1AU3A 4CDFB 3N3KA 3QSDA 4BBQA 1F2AA 3PW3A 3V6CA 2HHNA 4YYRA 2NAAA 2YUCA 1F2CA 1STFE 5TDWA 2CKLA 2VJFA 3OVXA 3U8EA 4PPEA 2QJ0A 2MA5A 1X4IA 2RI7A 4ZQLA 1NQCA 3MTNA 2EGPA 3GCBA 2YJ9A 3N9NA 2E00A 3DQVR 1YT7A 3T6RA 1POPA 4PP2E 1AU2A 2IDAA 9PAPA 1U6GB 3SOXA 3CBJA 2LN0A 2O6XA 4PP1A 2KYUA 5D1LB 2F42A 1KXRA 3EB6A 1TLOA 5LKXA 1PIPA 2FRAA 2LGKA 1CB5A 3EB5A 2PREA 4AP4A 4MZOA 1WEVA 2ECWA 2KGIA 1U9QX 1NB5A 2NQDB 4QH6A 2DZYA 3O35A 1WEOA 4FIPA 1NB3A 1GCBA 3I06A 2PUYA 2LXPC 2F6JA 3OF9A 1DEUA 5D1MB 3DPLR 1AYUA 3HCUA 2M3HA 4S3OC 3MHHA 1QMYA 3TNXA 1LDJB 2I50A 4FK5A 2OXQC 3H8BA 2E01A 2XU4A 3WXGA 5DKAA 3PURA 3ZNIA 1MDWA 2Y5BA 4N8WA 2G7YA 1Z6UA 4X3GA 4MSXA 1CJLA 1PPOA 3KFQA 2JMIA 4L7XA 1CQDA 2MD8C 5PADA 4YC9A 3H8CA 3OF8A 2DCBA 3D6SA 2AU1A 4R8PK 2L5UA 4YVAA 2YT5A 5EGWA 2DJFB 1KHQA 1PXVA 4I7DA 2KWJA 2AYOA 1DF0A 5EF4A 3LQHA 3LRQA 2VHSA 1KHPA 2K4DA 1QOLA 3O7AA 5KH7A 3PBHA 3S3RA 2PADA 4NN2A 2HXZA 3I3TA 1MS6A 4LADB 2AIMA 4I7BA 2KU3A 1PE6A 2Y1NA 3HCTA 5B77A 1CV8A 4WZ3B 1V87A 3DF0A 3KW9A 2OP3A 4BHWA 2FUUA 3RPGB 2FQ9A 1Z2QA 1HYJA 3WXEA 4YYUA 2G8JA 5JH3A 5KH9A 4P6GA 2F7DA 3N9OA 1WE9A 2H0DA 1JM7B 2LXHC 2P0RA 3MORA 2YJCA 2VPDA 2OZ2A 3KSEA 1K3BB 3RVVA 1U5IA 3OISA 3U5PA 3O37A 2MA6A 1VJVA 1JM7A 2XEUA 1U9VA 3ZVYA 2AN6A 2YSMA 4G54A 4NV8A 1AYVA 5FERA 1PPDA 2AUXA 1WESA 2KWKA 2VJEB 4YBMA 2CSYA 1WEWA 2DJGB 4OELA 5CVMA 1CVZA 3SHBA 4GNDA 4ZDTA 1GMYA 4AXMA 1ME3A 1U9WA 3BPFA 4GB0A 2AVWA 1IYMA 2EODA 1PPNA 1WILA 1S4VA 1ATKA 4PI3A 2FT2A 1Y4HA 4BS6A 3CBKA 2YQLA 1JQPA 1FH0A 3ZYQA 3LFYA 1BP4A 2DZZA 5LKUA 1X4UA 3NG2A 1LDKC 1MM3A 4YYVA 1Q6KA 3T7LA 1WIMA 2H0DB 4K7CA 4BS5A 2LGLA 2G6QA 2E02A 4Q8GA 4DMYA 3IHPA 5TABA 2FUIA 2YHNA 2G45A 2YSJA 5C11A 5H1UA 1X9YA 4GNGA 2BDLA 3H89A 2VPGA 2AS8A 4XUIA 1IWDA 2ARYA 3BCNA 5DINA 4FO9A 3K9MA 1PPPA 1Z60A 2JMDA 4DMXA 3PNRA 1SP4B 3M63A 2IPPB 2UZGA 3PUQA 4W4UA 1EWPA 3O36A 2ECNA 2JQGR 4PADA 3B79A 4UI9B 2R6NA 5LKTA 3H6SA 3KQIA 2DC8A 3BOWA 4N4FA 4WA6A 5TDRA 2ECIA 4YYQA 1YK7A 1ICFA 3M62A 2PNXA 4QRXA 1MIRA 1TU6A 2BDZA 5TBNA 1KFXL 2FYEA 1EWMA 1SNKA 1AYWA 5CHTA 1WEUA 4I7CA 1YK8A 3PHDA 4AYCA 1MEGA 3C5KA 5FB0A 4QRGA 4RY2A 2NQAA 2LGGA 2Y43A 2M1RA 3RVWA 1NPZA 2YJBA 4CDCB 2YQMA 2MIQA 3M99A 1WEQA 2VJFB 1EWLA 3OVZA 3O33A 1NLJA 4AUQB 5H1TA 4N79A 2E6SA 1YVBA 3IUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RTR B;  2HYE D;  3C6W A;  4QRV A;  1PCI A;  4P5O B;  4X6H A;  5J94 A;  3KWZ A;  3HWN A;  2F1G A;  3QZV A;  5D1K B;  3IEJ A;  5B79 A;  2R9C A;  2D8S A;  4CCG X;  3BWK A;  4I07 A;  3ZPV E;  4XI1 A;  3FL2 A;  5G0F A;  5J3X A;  5B75 A;  1U9X A;  3NHE A;  4WZ2 A;  3C9E A;  5G04 B;  2MNZ A;  3F5V A;  3GL6 A;  4ZUX U;  4YAB A;  2YJ2 A;  2FTD A;  3QT4 A;  4W5B A;  1AEC A;  2KFT A;  4X6I A;  1NL6 A;  2NQI A;  1K2F A;  1ZCM A;  2IBI A;  4QF2 A;  1BGO A;  2K17 A;  2VHF A;  5B78 A;  2M6M A;  2KWN A;  2GFO A;  3L11 A;  2ACT A;  4BPV A;  2P7U A;  2LQ6 A;  3GV4 A;  1X4J A;  1TL9 A;  1F2B A;  4V3K C;  1HUC B;  1M6D A;  3KV6 A;  4CZW A;  4GNF A;  6PAD A;  4YAD A;  5LCW B;  1F29 A;  4YV8 A;  1N87 A;  1Y08 A;  4MZS A;  4P6E A;  1ME4 A;  2LRI C;  2VP7 A;  3KX1 A;  2QIC A;  3L1X A;  4YYS A;  2BAY A;  2G6D A;  3N9L A;  2YHO A;  2DC6 A;  4FJC A;  5KH3 A;  2KR4 A;  4A0C D;  1CTE A;  1JOC A;  2Y1M A;  1VYX A;  2F6N A;  1YAL A;  2FRQ A;  1WEN A;  2DCC A;  3P5W A;  2AYN A;  2DC7 A;  2CB5 A;  3ZPV 1;  4O64 A;  2R9O A;  1E4U A;  3BPM A;  4IC2 A;  1O0E A;  3O1G A;  1PBH A;  3USV A;  2KIZ A;  4YBS A;  4BQV A;  4N4Z A;  4F52 B;  2YW8 A;  2ECT A;  2CKL B;  3N9P A;  2CIO A;  3RPG C;  2L43 A;  4Q8H A;  3U5N A;  4I04 A;  2L80 A;  3P5V A;  5H1V A;  2PBH A;  2ZET C;  3SOU A;  4R7E A;  3N4C A;  3HHI A;  3H7D A;  4QBB A;  2YYR A;  1BY8 A;  4PTB A;  4TKP B;  4S3O B;  3O70 A;  3V43 A;  4UP5 A;  3LXS A;  4CA1 A;  1QXP A;  3V6E A;  2YUR A;  2LV9 A;  3KKU A;  1VFY A;  3I2D A;  2B1M A;  3AI8 A;  3ZUA A;  2NQG A;  2C2V S;  3KNV A;  4AYC B;  3ZVZ B;  2CT2 A;  3F75 A;  4W5C A;  5F02 A;  1AU4 A;  2VNF A;  2B1N A;  5CVN B;  2KWO A;  2Y6E A;  4XR7 A;  4LJN A;  2PNS A;  3K8U A;  5AIU A;  1XKG A;  2KE1 A;  4CDD B;  5C13 A;  4AXL A;  2XU1 A;  5FB1 A;  3U5O A;  2DX8 A;  3PDF A;  3WXF A;  4YAX A;  4YAT A;  3N9M A;  2XB1 A;  4GNE A;  2HH5 A;  2GHU A;  1DVP A;  1RMD A;  4A49 A;  5CHV A;  2P86 A;  2JMJ A;  3BC3 A;  4YYW A;  5FEY A;  1ITO A;  2RSD A;  3O34 A;  5EYA F;  5B76 A;  2KGG A;  1GEC E;  2MUM A;  3IOQ A;  1A6R A;  1HYI A;  1GLO A;  2HD5 A;  4LKA A;  3CH2 X;  3RVX A;  4I05 A;  4A4B A;  1XWH A;  1AU0 A;  4QF3 A;  1THE A;  2H7J A;  2VPB A;  1WEE A;  3SOW A;  2YJ8 A;  2MT5 A;  1WEP A;  5JG6 A;  2ECJ A;  2HDP A;  3ZTG A;  3P5U A;  4HWY A;  1EF7 A;  4Q6F A;  5G05 B;  1FBV A;  4CDE B;  3S3Q A;  2FUD A;  2OUL A;  1MM2 A;  2ECV A;  4N3W A;  2E03 A;  1BOR A;  1CSB B;  2AUZ A;  2DCA A;  2G8E A;  1QDQ A;  1BQI A;  2XU5 A;  4BSQ A;  3N3G A;  2WBF X;  7PCK A;  1ZIV A;  1EWO A;  2KRE A;  3CH3 X;  4OEM A;  2R9N A;  4C9Z A;  5I3L A;  3U5M A;  2DCD A;  5CVO B;  1F62 A;  4UP0 A;  1FP0 A;  3L1Z B;  3LQJ A;  2ATO A;  3IMA A;  2ECG A;  2C0Y A;  1MEM A;  3HCS A;  1CHC A;  1WFK A;  2K16 A;  2R9M A;  4X6J A;  3HTK C;  2R9F A;  3LQI A;  4L58 A;  4WZ0 A;  2L75 A;  3HD3 A;  5TRB A;  3N9Q A;  1T1H A;  2MNY A;  3ASL A;  4R2Y A;  5K16 A;  3MHS A;  2YU4 A;  1VSN A;  4A4C A;  1PAD A;  2VPE A;  3KWB X;  2JQF R;  5A24 A;  8PCH A;  2G43 A;  3E1Z B;  4LK9 A;  5H9M A;  4IC3 A;  4YBT A;  2VJE A;  3O0U A;  1WEM A;  2K1J A;  5LKZ A;  1G25 A;  2EA6 A;  2YRE A;  4B86 C;  4LLB A;  2MD7 B;  2FSA A;  3KV5 A;  1CPJ A;  2CSZ A;  4KLB A;  3QJ3 A;  5FPW A;  4V3L C;  3IV2 A;  5AIT A;  2FO5 A;  1VD4 A;  1MHW A;  2XU3 A;  2M85 A;  2E6R A;  3K24 A;  4AVX A;  3P5X A;  2LDR A;  1ZBD B;  3HHA A;  2QIZ A;  2DC9 A;  2LGV A;  4MVT A;  3ERV A;  5JA7 A;  3VK6 A;  5B8D A;  1WGM A;  1CS8 A;  1AIM A;  1KFU L;  2C2L A;  2L0B A;  4B7Y C;  2JRJ A;  1AU3 A;  4CDF B;  3N3K A;  3QSD A;  4BBQ A;  1F2A A;  3PW3 A;  3V6C A;  2HHN A;  4YYR A;  2NAA A;  2YUC A;  1F2C A;  1STF E;  5TDW A;  2CKL A;  2VJF A;  3OVX A;  3U8E A;  4PPE A;  2QJ0 A;  2MA5 A;  1X4I A;  2RI7 A;  4ZQL A;  1NQC A;  3MTN A;  2EGP A;  3GCB A;  2YJ9 A;  3N9N A;  2E00 A;  3DQV R;  1YT7 A;  3T6R A;  1POP A;  4PP2 E;  1AU2 A;  2IDA A;  9PAP A;  1U6G B;  3SOX A;  3CBJ A;  2LN0 A;  2O6X A;  4PP1 A;  2KYU A;  5D1L B;  2F42 A;  1KXR A;  3EB6 A;  1TLO A;  5LKX A;  1PIP A;  2FRA A;  2LGK A;  1CB5 A;  3EB5 A;  2PRE A;  4AP4 A;  4MZO A;  1WEV A;  2ECW A;  2KGI A;  1U9Q X;  1NB5 A;  2NQD B;  4QH6 A;  2DZY A;  3O35 A;  1WEO A;  4FIP A;  1NB3 A;  1GCB A;  3I06 A;  2PUY A;  2LXP C;  2F6J A;  3OF9 A;  1DEU A;  5D1M B;  3DPL R;  1AYU A;  3HCU A;  2M3H A;  4S3O C;  3MHH A;  1QMY A;  3TNX A;  1LDJ B;  2I50 A;  4FK5 A;  2OXQ C;  3H8B A;  2E01 A;  2XU4 A;  3WXG A;  5DKA A;  3PUR A;  3ZNI A;  1MDW A;  2Y5B A;  4N8W A;  2G7Y A;  1Z6U A;  4X3G A;  4MSX A;  1CJL A;  1PPO A;  3KFQ A;  2JMI A;  4L7X A;  1CQD A;  2MD8 C;  5PAD A;  4YC9 A;  3H8C A;  3OF8 A;  2DCB A;  3D6S A;  2AU1 A;  4R8P K;  2L5U A;  4YVA A;  2YT5 A;  5EGW A;  2DJF B;  1KHQ A;  1PXV A;  4I7D A;  2KWJ A;  2AYO A;  1DF0 A;  5EF4 A;  3LQH A;  3LRQ A;  2VHS A;  1KHP A;  2K4D A;  1QOL A;  3O7A A;  5KH7 A;  3PBH A;  3S3R A;  2PAD A;  4NN2 A;  2HXZ A;  3I3T A;  1MS6 A;  4LAD B;  2AIM A;  4I7B A;  2KU3 A;  1PE6 A;  2Y1N A;  3HCT A;  5B77 A;  1CV8 A;  4WZ3 B;  1V87 A;  3DF0 A;  3KW9 A;  2OP3 A;  4BHW A;  2FUU A;  3RPG B;  2FQ9 A;  1Z2Q A;  1HYJ A;  3WXE A;  4YYU A;  2G8J A;  5JH3 A;  5KH9 A;  4P6G A;  2F7D A;  3N9O A;  1WE9 A;  2H0D A;  1JM7 B;  2LXH C;  2P0R A;  3MOR A;  2YJC A;  2VPD A;  2OZ2 A;  3KSE A;  1K3B B;  3RVV A;  1U5I A;  3OIS A;  3U5P A;  3O37 A;  2MA6 A;  1VJV A;  1JM7 A;  2XEU A;  1U9V A;  3ZVY A;  2AN6 A;  2YSM A;  4G54 A;  1AYV A;  5FER A;  1PPD A;  2AUX A;  1WES A;  2KWK A;  2VJE B;  4YBM A;  2CSY A;  1WEW A;  2DJG B;  4OEL A;  5CVM A;  1CVZ A;  3SHB A;  4GND A;  4ZDT A;  1GMY A;  4AXM A;  1ME3 A;  1U9W A;  3BPF A;  4GB0 A;  2AVW A;  1IYM A;  2EOD A;  1PPN A;  1WIL A;  1S4V A;  1ATK A;  4PI3 A;  2FT2 A;  1Y4H A;  4BS6 A;  3CBK A;  2YQL A;  1JQP A;  1FH0 A;  3ZYQ A;  3LFY A;  1BP4 A;  2DZZ A;  5LKU A;  1X4U A;  3NG2 A;  1LDK C;  1MM3 A;  4YYV A;  1Q6K A;  3T7L A;  1WIM A;  2H0D B;  4K7C A;  4BS5 A;  2LGL A;  2G6Q A;  2E02 A;  4Q8G A;  4DMY A;  3IHP A;  5TAB A;  2FUI A;  2YHN A;  2G45 A;  2YSJ A;  5C11 A;  5H1U A;  1X9Y A;  4GNG A;  2BDL A;  3H89 A;  2VPG A;  2AS8 A;  4XUI A;  1IWD A;  2ARY A;  3BCN A;  5DIN A;  4FO9 A;  3K9M A;  1PPP A;  1Z60 A;  2JMD A;  4DMX A;  3PNR A;  1SP4 B;  3M63 A;  2IPP B;  2UZG A;  3PUQ A;  4W4U A;  1EWP A;  3O36 A;  2ECN A;  2JQG R;  4PAD A;  3B79 A;  4UI9 B;  2R6N A;  5LKT A;  3H6S A;  3KQI A;  2DC8 A;  3BOW A;  4N4F A;  4WA6 A;  5TDR A;  2ECI A;  4YYQ A;  1YK7 A;  1ICF A;  3M62 A;  2PNX A;  4QRX A;  1MIR A;  1TU6 A;  2BDZ A;  5TBN A;  1KFX L;  2FYE A;  1EWM A;  1SNK A;  1AYW A;  5CHT A;  1WEU A;  4I7C A;  1YK8 A;  3PHD A;  4AYC A;  1MEG A;  3C5K A;  5FB0 A;  4QRG A;  4RY2 A;  2NQA A;  2LGG A;  2Y43 A;  2M1R A;  3RVW A;  1NPZ A;  2YJB A;  4CDC B;  2YQM A;  2MIQ A;  3M99 A;  1WEQ A;  2VJF B;  1EWL A;  3OVZ A;  3O33 A;  1NLJ A;  4AUQ B;  5H1T A;  4N79 A;  2E6S A;  1YVB A;  3IUT A; 
#chains in the Genus database with same CATH topology
 1MBM A;  3RTR B;  2HYE D;  3C6W A;  4QRV A;  3W31 A;  1PCI A;  4P5O B;  4X6H A;  5J94 A;  3KWZ A;  4RF0 A;  3HWN A;  2F1G A;  3QZV A;  3FAN A;  5D1K B;  3IEJ A;  5B79 A;  2R9C A;  3TRK A;  2D8S A;  4CCG X;  3BWK A;  4I07 A;  3ZPV E;  3IFU A;  4ZTB A;  4WUR A;  4XI1 A;  3FL2 A;  5G0F A;  5J3X A;  5B75 A;  1U9X A;  3NHE A;  4WZ2 A;  3C9E A;  5G04 B;  2MNZ A;  3F5V A;  2CON A;  4H9D A;  2DOS A;  2XOZ A;  3GL6 A;  4ZUX U;  4YAB A;  2YJ2 A;  2FTD A;  3QT4 A;  4OVZ B;  1AEC A;  4W5B A;  2KFT A;  4X6I A;  1NL6 A;  2NQI A;  1K2F A;  1ZCM A;  2IBI A;  4MI7 A;  4QF2 A;  1BGO A;  2K17 A;  2VHF A;  5B78 A;  5EZS A;  2M6M A;  2KWN A;  2GFO A;  2J7Q C;  2IQJ A;  3L11 A;  2ACT A;  4BPV A;  2P7U A;  2LQ6 A;  3DWD A;  2YVR A;  3GV4 A;  2JTC A;  1X4J A;  1TL9 A;  1F2B A;  4V3K C;  1HUC B;  1M6D A;  3KV6 A;  4CZW A;  2AGA A;  4GNF A;  3PT2 A;  6PAD A;  4YAD A;  5LCW B;  1F29 A;  4YV8 A;  4O62 A;  1N87 A;  1Y08 A;  4MZS A;  4P6E A;  1ME4 A;  2LRI C;  2VP7 A;  1YZB A;  3KX1 A;  2QIC A;  2EXU A;  3L1X A;  4YYS A;  2BAY A;  4BOZ A;  2G6D A;  3N9L A;  2YHO A;  2DC6 A;  3E9S A;  4FJC A;  5KH3 A;  1DCQ A;  2KR4 A;  4A0C D;  1CTE A;  1JOC A;  2Y1M A;  1VYX A;  2F6N A;  1YAL A;  2FRQ A;  1WEN A;  2DCC A;  3P5W A;  2AYN A;  2DC7 A;  2CB5 A;  3LVR E;  3ZPV 1;  4O64 A;  2CRR A;  2R9O A;  1E4U A;  3BPM A;  2L7P A;  4IC2 A;  1O0E A;  1PBH A;  3O1G A;  3USV A;  2KIZ A;  2XOC A;  4YBS A;  4BQV A;  4N4Z A;  4F52 B;  2YW8 A;  2ECT A;  2J7Q A;  2CKL B;  3N9P A;  2CIO A;  3RPG C;  2L43 A;  4Q8H A;  3U5N A;  4I04 A;  2KKX A;  4IUM A;  2L80 A;  4GUA A;  3P5V A;  5H1V A;  2PBH A;  2ZET C;  3SOU A;  4R7E A;  2BU3 A;  3N4C A;  3HHI A;  3H7D A;  4QBB A;  2YYR A;  1BY8 A;  4PTB A;  4TKP B;  4S3O B;  3O70 A;  3V43 A;  4UP5 A;  3LXS A;  4CA1 A;  1QXP A;  3DDT A;  2YUR A;  2LV9 A;  3KKU A;  3V6E A;  1VFY A;  3I2D A;  2B1M A;  3AI8 A;  3ZUA A;  2NQG A;  2C2V S;  3KNV A;  4P16 A;  4AYC B;  3ZVZ B;  2CT2 A;  3F75 A;  3O65 A;  4W5C A;  5F02 A;  1AU4 A;  2VNF A;  2B1N A;  5CVN B;  2KWO A;  4Z0R A;  2Y6E A;  4XR7 A;  4LJN A;  2PNS A;  3K8U A;  5AIU A;  1XKG A;  2KE1 A;  4CDD B;  5C13 A;  2E61 A;  4AXL A;  2XU1 A;  5FB1 A;  3U5O A;  2DX8 A;  3E2D A;  3PDF A;  3BBA A;  3WXF A;  4YAX A;  4BOP A;  4YAT A;  3N9M A;  2XB1 A;  4GNE A;  2HH5 A;  2GHU A;  2EGM A;  1DVP A;  1RMD A;  4A49 A;  5CHV A;  2P86 A;  2JMJ A;  3BC3 A;  4OGE A;  4YYW A;  5FEY A;  1ITO A;  2RSD A;  3O34 A;  5EYA F;  2FFW A;  2KGG A;  5B76 A;  1GEC E;  2MUM A;  3IOQ A;  1A6R A;  1HYI A;  1GLO A;  2HD5 A;  4LKA A;  3CH2 X;  3RVX A;  4I05 A;  4A4B A;  3PRP A;  3JUE A;  1XWH A;  1AU0 A;  4QF3 A;  1THE A;  1UKF A;  2H7J A;  2LAU A;  2VPB A;  1WEE A;  3SOW A;  2YJ8 A;  2MT5 A;  4BOU A;  1WEP A;  5JG6 A;  2ECJ A;  2HDP A;  3ZTG A;  3P5U A;  4HWY A;  1EF7 A;  4Q6F A;  5G05 B;  1FBV A;  4CDE B;  3S3Q A;  2FUD A;  2OUL A;  1MM2 A;  2ECV A;  4N3W A;  4REZ A;  2E03 A;  1BOR A;  1CSB B;  2AUZ A;  2DCA A;  2G8E A;  1QDQ A;  5E6J A;  1BQI A;  3PRM A;  2RR4 A;  2XU5 A;  4BSQ A;  3N3G A;  2WBF X;  7PCK A;  1ZIV A;  1EWO A;  2KRE A;  3CH3 X;  4OEM A;  2R9N A;  4C9Z A;  5I3L A;  2DJA A;  3U5M A;  2XOY A;  2DCD A;  5CVO B;  1F62 A;  4UP0 A;  1FP0 A;  3L1Z B;  3LQJ A;  2ATO A;  2B0O E;  3IMA A;  2ECG A;  2C0Y A;  1MEM A;  3HCS A;  1CHC A;  1WFK A;  2K16 A;  2R9M A;  4X6J A;  3HTK C;  2R9F A;  3LQI A;  4L58 A;  4WZ0 A;  2L75 A;  5SVI A;  3LDY A;  3HD3 A;  5TRB A;  3MP2 A;  3N9Q A;  1T1H A;  2MNY A;  3ASL A;  4R2Y A;  5K16 A;  3MHS A;  2YU4 A;  3T9K A;  4A4C A;  1PAD A;  1VSN A;  2VPE A;  4M0W A;  3KWB X;  2JQF R;  5A24 A;  8PCH A;  2G43 A;  3PLW A;  3E1Z B;  4LK9 A;  5H9M A;  4IC3 A;  4YBT A;  2VJE A;  5KO3 A;  3O0U A;  1WEM A;  2K1J A;  5LKZ A;  1G25 A;  2EA6 A;  2YRE A;  4B86 C;  4LLB A;  2MD7 B;  2FSA A;  3KV5 A;  1CPJ A;  2CSZ A;  4KLB A;  3QJ3 A;  5FPW A;  4V3L C;  3IV2 A;  5AIT A;  2HWK A;  2FO5 A;  2KKY A;  2FE8 A;  2OWA A;  1VD4 A;  1MHW A;  2XU3 A;  2M85 A;  2E6R A;  3K24 A;  2Z84 A;  4AVX A;  3P5X A;  2LDR A;  1ZBD B;  3HHA A;  2QIZ A;  5SVY A;  2DC9 A;  3FJU B;  2LGV A;  4MVT A;  3ERV A;  5JA7 A;  3VK6 A;  5B8D A;  1WGM A;  1CS8 A;  1AIM A;  1KFU L;  2C2L A;  2XP0 A;  2L0B A;  4B7Y C;  2JRJ A;  1AU3 A;  4CDF B;  3N3K A;  3QSD A;  4BBQ A;  1F2A A;  3PW3 A;  3PHX A;  2HHN A;  3V6C A;  2NAA A;  4YYR A;  2YUC A;  1F2C A;  1STF E;  5TDW A;  2CKL A;  2VJF A;  4F1P A;  3OVX A;  3U8E A;  4PPE A;  2QJ0 A;  2MA5 A;  1X4I A;  2RI7 A;  4ZQL A;  1NQC A;  3MTN A;  3PHU A;  2EGP A;  2P57 A;  3O47 A;  3GCB A;  2YJ9 A;  3BB7 A;  3N9N A;  2E00 A;  3DQV R;  1YT7 A;  3T6R A;  1POP A;  4PP2 E;  1AU2 A;  2IDA A;  9PAP A;  1U6G B;  3SOX A;  3CBJ A;  2LN0 A;  2O6X A;  4PP1 A;  2KYU A;  5D1L B;  2F42 A;  5JZE A;  3SUB A;  1KXR A;  3EB6 A;  1TLO A;  5LKX A;  1PIP A;  2FRA A;  3MJ5 A;  2LGK A;  1CB5 A;  3EB5 A;  2PRE A;  4AP4 A;  4MZO A;  3PSE A;  1WEV A;  2ECW A;  2KGI A;  1U9Q X;  1NB5 A;  2NQD B;  4QH6 A;  2DZY A;  3O35 A;  1WEO A;  4FIP A;  3LJU X;  1NB3 A;  1GCB A;  4OGC A;  3PHW A;  2BTW A;  3I06 A;  2JRI A;  2PUY A;  2LXP C;  2F6J A;  3OF9 A;  1DEU A;  5D1M B;  3DPL R;  1AYU A;  4D8E A;  3HCU A;  3MDB C;  2M3H A;  4S3O C;  3MHH A;  1QMY A;  3BY4 A;  3MTV A;  3TNX A;  1LDJ B;  2I50 A;  5EZQ A;  4FK5 A;  2OXQ C;  3H8B A;  2E01 A;  2XU4 A;  3WXG A;  5DKA A;  3RNV A;  3PUR A;  3ZNI A;  1MDW A;  4XZX A;  2Y5B A;  4N8W A;  2G7Y A;  1Z6U A;  4X3G A;  4MSX A;  1CJL A;  1PPO A;  3KFQ A;  2JMI A;  4L7X A;  1CQD A;  2MD8 C;  4IP3 A;  5PAD A;  4YC9 A;  3H8C A;  3OF8 A;  2DCB A;  3D6S A;  2AU1 A;  4R8P K;  2CRW A;  2L5U A;  4YVA A;  2YT5 A;  5EGW A;  2DJF B;  1KHQ A;  1PXV A;  4I7D A;  2KWJ A;  3H7H A;  2AYO A;  3FM8 C;  1DF0 A;  5EF4 A;  3LQH A;  3LRQ A;  2VHS A;  1KHP A;  2D8U A;  2K4D A;  1QOL A;  3O7A A;  5KH7 A;  3PBH A;  4OVZ A;  3S3R A;  3FEH A;  2PAD A;  4NN2 A;  2UZJ A;  4RF1 A;  2HXZ A;  3I3T A;  1MS6 A;  4LAD B;  2AIM A;  4I7B A;  2KU3 A;  1PE6 A;  1PVJ A;  2Y1N A;  3HCT A;  5B77 A;  1CV8 A;  4BOQ A;  4WZ3 B;  1V87 A;  3DF0 A;  3KW9 A;  2OP3 A;  2FUU A;  3RPG B;  4BHW A;  2FQ9 A;  3C0R A;  1Z2Q A;  1HYJ A;  3WXE A;  4YYU A;  2G8J A;  5JH3 A;  5KH9 A;  4P6G A;  2F7D A;  1WE9 A;  3N9O A;  2CSV A;  2H0D A;  1JM7 B;  2LXH C;  2P0R A;  3MOR A;  4A5U A;  2YJC A;  2VPD A;  4MM3 B;  2OZ2 A;  2BTW B;  3KSE A;  1K3B B;  3RVV A;  1U5I A;  3OIS A;  3U5P A;  3O37 A;  2MA6 A;  1VJV A;  1JM7 A;  5K3Q A;  2XEU A;  1U9V A;  2MKE A;  2AN6 A;  2YSM A;  5SVX A;  3ZVY A;  4G54 A;  1AYV A;  5FER A;  1PPD A;  3IUT A;  2AUX A;  1WES A;  2KWK A;  2VJE B;  4YBM A;  2CSY A;  1WEW A;  2DJG B;  3M7K A;  4OEL A;  1CVZ A;  3SHB A;  4OW0 A;  2JUN A;  5CVM A;  4GND A;  4ZDT A;  1GMY A;  4AXM A;  1ME3 A;  1U9W A;  3BPF A;  4GB0 A;  2AVW A;  1IYM A;  2EOD A;  1PPN A;  1WIL A;  1S4V A;  1ATK A;  4PI3 A;  2FT2 A;  1Y4H A;  4BS6 A;  4D8B A;  3CBK A;  2YQL A;  1JQP A;  4RNA A;  1FH0 A;  3ZYQ A;  3LFY A;  1BP4 A;  2DZZ A;  5LKU A;  1X4U A;  3NG2 A;  3Q1D A;  1LDK C;  1MM3 A;  4YYV A;  1Q6K A;  3T7L A;  1WIM A;  2H0D B;  4K7C A;  4BS5 A;  2LGL A;  2G6Q A;  2E02 A;  4Q8G A;  4D8I A;  3FAO A;  3ZNH A;  4DMY A;  3IHP A;  5TAB A;  2FUI A;  2YHN A;  2G45 A;  2YSJ A;  5C11 A;  5H1U A;  1X9Y A;  4GNG A;  2BDL A;  3H89 A;  2VPG A;  2AS8 A;  4XUI A;  1IWD A;  2ARY A;  4QQ4 A;  5DIN A;  3BCN A;  4FO9 A;  2DSM A;  3K9M A;  1PPP A;  1Z60 A;  2JMD A;  2M13 A;  4DMX A;  3PNR A;  1SP4 B;  3M63 A;  2IPP B;  2UZG A;  3PUQ A;  4W4U A;  3OQC A;  1EWP A;  3O36 A;  2ECN A;  1DKI A;  2JQG R;  4PAD A;  3B79 A;  4UI9 B;  3TMP A;  2R6N A;  5LKT A;  3H6S A;  3KQI A;  2DC8 A;  3BOW A;  4N4F A;  4WA6 A;  5TDR A;  3W30 A;  4BOS A;  2ECI A;  4YYQ A;  1YK7 A;  1ICF A;  3M62 A;  2PNX A;  4QRX A;  5SVI B;  1MIR A;  1TU6 A;  2BDZ A;  5TBN A;  1KFX L;  2FYE A;  1EWM A;  1SNK A;  1AYW A;  5CHT A;  2JM3 A;  1WEU A;  4I7C A;  1YK8 A;  3PHD A;  4AYC A;  1MEG A;  3C5K A;  5FB0 A;  4PT5 A;  4QRG A;  2NQA A;  4RY2 A;  2LGG A;  2Y43 A;  2M1R A;  3LVQ E;  3RVW A;  3B21 A;  4RKX A;  1NPZ A;  2YJB A;  4CDC B;  2YQM A;  4HXD B;  2MIQ A;  3M99 A;  1WEQ A;  2VJF B;  1EWL A;  3OVZ A;  3O33 A;  1NLJ A;  4AUQ B;  5H1T A;  3KDE C;  4N79 A;  4R3D A;  4Z0O A;  2E6S A;  1YVB A;  2FD4 A; 
#chains in the Genus database with same CATH homology
 3RTR B;  2HYE D;  3C6W A;  3D9W A;  4QRV A;  1PCI A;  4P5O B;  4X6H A;  5J94 A;  3KWZ A;  3HWN A;  2F1G A;  3QZV A;  5D1K B;  3IEJ A;  5B79 A;  2R9C A;  2D8S A;  4CCG X;  3BWK A;  4I07 A;  3ZPV E;  4XI1 A;  3FL2 A;  5G0F A;  5J3X A;  5B75 A;  1U9X A;  3NHE A;  4WZ2 A;  3C9E A;  5G04 B;  2MNZ A;  3F5V A;  3GL6 A;  4ZUX U;  4YAB A;  2YJ2 A;  2FTD A;  3QT4 A;  4W5B A;  1AEC A;  2KFT A;  4X6I A;  1NL6 A;  2NQI A;  1K2F A;  1ZCM A;  2IBI A;  4QF2 A;  1BGO A;  2K17 A;  2VHF A;  5B78 A;  2M6M A;  2KWN A;  2GFO A;  3L11 A;  2ACT A;  4BPV A;  2P7U A;  2LQ6 A;  3GV4 A;  1X4J A;  1TL9 A;  1F2B A;  4V3K C;  1HUC B;  1M6D A;  3KV6 A;  4CZW A;  4GNF A;  6PAD A;  4YAD A;  5LCW B;  1F29 A;  4YV8 A;  2VFB A;  1W4T A;  1N87 A;  1Y08 A;  4MZS A;  4P6E A;  1ME4 A;  2LRI C;  2VP7 A;  3KX1 A;  2QIC A;  3L1X A;  4YYS A;  2BAY A;  2G6D A;  3N9L A;  2YHO A;  2DC6 A;  4FJC A;  1W5R A;  5KH3 A;  2KR4 A;  4A0C D;  1CTE A;  1JOC A;  2Y1M A;  1VYX A;  2F6N A;  1YAL A;  2FRQ A;  1WEN A;  2DCC A;  3P5W A;  2AYN A;  2DC7 A;  2CB5 A;  3ZPV 1;  4O64 A;  2VFC A;  2R9O A;  1E4U A;  3BPM A;  4IC2 A;  1O0E A;  3O1G A;  1PBH A;  3USV A;  2KIZ A;  4YBS A;  4BQV A;  4N4Z A;  4F52 B;  2YW8 A;  2ECT A;  2CKL B;  3N9P A;  2CIO A;  3RPG C;  2L43 A;  4B55 A;  4Q8H A;  3U5N A;  4I04 A;  2L80 A;  3P5V A;  5H1V A;  2PBH A;  2ZET C;  3SOU A;  4R7E A;  3N4C A;  3HHI A;  3H7D A;  4QBB A;  2YYR A;  1BY8 A;  4PTB A;  4TKP B;  4S3O B;  2BSZ A;  3O70 A;  3V43 A;  4UP5 A;  3LXS A;  4CA1 A;  1QXP A;  3V6E A;  2YUR A;  2LV9 A;  3KKU A;  1VFY A;  3I2D A;  2B1M A;  3AI8 A;  3ZUA A;  2NQG A;  2C2V S;  3KNV A;  4AYC B;  3ZVZ B;  2CT2 A;  3F75 A;  4W5C A;  5F02 A;  1AU4 A;  2VNF A;  2B1N A;  5CVN B;  2KWO A;  2Y6E A;  4XR7 A;  4LJN A;  2PNS A;  3K8U A;  5AIU A;  1XKG A;  2KE1 A;  4CDD B;  5C13 A;  1E2T A;  4AXL A;  2XU1 A;  5FB1 A;  3U5O A;  2DX8 A;  3PDF A;  3WXF A;  4YAX A;  4YAT A;  3N9M A;  2XB1 A;  4GNE A;  2HH5 A;  2GHU A;  1DVP A;  1RMD A;  4A49 A;  5CHV A;  2P86 A;  2JMJ A;  3BC3 A;  4YYW A;  5FEY A;  1ITO A;  2RSD A;  3O34 A;  5EYA F;  5B76 A;  2KGG A;  1GEC E;  2MUM A;  3IOQ A;  1A6R A;  1HYI A;  1GLO A;  2HD5 A;  4LKA A;  3CH2 X;  3RVX A;  4I05 A;  4A4B A;  1GX3 A;  1XWH A;  1AU0 A;  4QF3 A;  1THE A;  2H7J A;  2VPB A;  1WEE A;  3SOW A;  2YJ8 A;  2MT5 A;  1WEP A;  5JG6 A;  2ECJ A;  2HDP A;  3ZTG A;  3P5U A;  4HWY A;  1EF7 A;  4Q6F A;  5G05 B;  1FBV A;  4CDE B;  3S3Q A;  2FUD A;  2OUL A;  1MM2 A;  2ECV A;  4N3W A;  2E03 A;  1BOR A;  1CSB B;  2AUZ A;  2DCA A;  1W6F A;  1QDQ A;  2G8E A;  1BQI A;  2XU5 A;  4BSQ A;  3N3G A;  2WBF X;  7PCK A;  1ZIV A;  1EWO A;  2KRE A;  3CH3 X;  4OEM A;  2R9N A;  4C9Z A;  5I3L A;  3U5M A;  2DCD A;  5CVO B;  1F62 A;  3LTW A;  4UP0 A;  1FP0 A;  3L1Z B;  3LQJ A;  2ATO A;  3IMA A;  2ECG A;  2C0Y A;  1MEM A;  3HCS A;  1CHC A;  1WFK A;  2K16 A;  2R9M A;  4X6J A;  3HTK C;  2R9F A;  3LQI A;  4L58 A;  4WZ0 A;  2L75 A;  3HD3 A;  5TRB A;  3N9Q A;  1T1H A;  2MNY A;  3ASL A;  4R2Y A;  5K16 A;  3MHS A;  2YU4 A;  1VSN A;  4A4C A;  1PAD A;  2VPE A;  4C5P A;  3KWB X;  2JQF R;  5A24 A;  8PCH A;  2G43 A;  3E1Z B;  4LK9 A;  5H9M A;  4IC3 A;  4YBT A;  2VJE A;  3O0U A;  1WEM A;  2K1J A;  5LKZ A;  1G25 A;  2EA6 A;  2YRE A;  4B86 C;  4LLB A;  2MD7 B;  2FSA A;  3KV5 A;  1CPJ A;  2CSZ A;  4KLB A;  3QJ3 A;  5FPW A;  4V3L C;  3IV2 A;  5AIT A;  2FO5 A;  4GUZ A;  1VD4 A;  1MHW A;  2XU3 A;  2M85 A;  2E6R A;  3K24 A;  4BGF A;  4AVX A;  3P5X A;  2LDR A;  1ZBD B;  3HHA A;  2QIZ A;  2DC9 A;  2LGV A;  4MVT A;  3ERV A;  4NV7 A;  5JA7 A;  3VK6 A;  5B8D A;  1WGM A;  1CS8 A;  1AIM A;  1KFU L;  2C2L A;  2L0B A;  4B7Y C;  2JRJ A;  1AU3 A;  4CDF B;  3N3K A;  3QSD A;  4BBQ A;  1F2A A;  3PW3 A;  3V6C A;  2HHN A;  4YYR A;  2NAA A;  2YUC A;  1F2C A;  1STF E;  5TDW A;  2CKL A;  2VJF A;  3OVX A;  3U8E A;  4PPE A;  2QJ0 A;  2MA5 A;  1X4I A;  2RI7 A;  4ZQL A;  1NQC A;  3MTN A;  2EGP A;  3GCB A;  2YJ9 A;  3N9N A;  2E00 A;  3DQV R;  1YT7 A;  3T6R A;  1POP A;  4PP2 E;  1AU2 A;  2IDA A;  9PAP A;  1U6G B;  3SOX A;  3CBJ A;  2LN0 A;  2O6X A;  4PP1 A;  2KYU A;  5D1L B;  2F42 A;  1KXR A;  3EB6 A;  1TLO A;  5LKX A;  1PIP A;  2FRA A;  2LGK A;  1CB5 A;  3EB5 A;  2PRE A;  4AP4 A;  4MZO A;  1WEV A;  2ECW A;  2KGI A;  1U9Q X;  1NB5 A;  2NQD B;  4QH6 A;  2DZY A;  3O35 A;  1WEO A;  4FIP A;  1NB3 A;  1GCB A;  3I06 A;  2PUY A;  2LXP C;  2F6J A;  3OF9 A;  1DEU A;  5D1M B;  3DPL R;  1AYU A;  3HCU A;  2M3H A;  4S3O C;  3MHH A;  1QMY A;  3TNX A;  1LDJ B;  2I50 A;  4FK5 A;  2OXQ C;  3H8B A;  2E01 A;  2XU4 A;  3WXG A;  5DKA A;  3PUR A;  3ZNI A;  1MDW A;  2Y5B A;  4N8W A;  2G7Y A;  1Z6U A;  4X3G A;  4MSX A;  1CJL A;  1PPO A;  3KFQ A;  2JMI A;  4L7X A;  1CQD A;  2MD8 C;  5PAD A;  4YC9 A;  3H8C A;  3OF8 A;  2DCB A;  3D6S A;  2AU1 A;  4R8P K;  2L5U A;  4YVA A;  2YT5 A;  5EGW A;  2DJF B;  1KHQ A;  1PXV A;  4I7D A;  2KWJ A;  2AYO A;  1DF0 A;  5EF4 A;  3LQH A;  3LRQ A;  2VHS A;  1KHP A;  2K4D A;  1QOL A;  3O7A A;  5KH7 A;  3PBH A;  3S3R A;  2PAD A;  4NN2 A;  2HXZ A;  3I3T A;  1MS6 A;  4LAD B;  2AIM A;  4I7B A;  2KU3 A;  1PE6 A;  2Y1N A;  3HCT A;  5B77 A;  1CV8 A;  4WZ3 B;  1V87 A;  3DF0 A;  3KW9 A;  2OP3 A;  4BHW A;  2FUU A;  3RPG B;  2FQ9 A;  1Z2Q A;  1HYJ A;  3WXE A;  4YYU A;  2G8J A;  5JH3 A;  5KH9 A;  4P6G A;  2F7D A;  3N9O A;  1WE9 A;  2H0D A;  1JM7 B;  2LXH C;  2P0R A;  3MOR A;  2YJC A;  2VPD A;  2OZ2 A;  3KSE A;  1K3B B;  3RVV A;  1U5I A;  3OIS A;  3U5P A;  3O37 A;  2MA6 A;  1VJV A;  1JM7 A;  2XEU A;  1U9V A;  3ZVY A;  2AN6 A;  2YSM A;  4G54 A;  4NV8 A;  1AYV A;  5FER A;  1PPD A;  2AUX A;  1WES A;  2KWK A;  2VJE B;  4YBM A;  2CSY A;  1WEW A;  2DJG B;  4OEL A;  5CVM A;  1CVZ A;  3SHB A;  4GND A;  4ZDT A;  1GMY A;  4AXM A;  1ME3 A;  1U9W A;  3BPF A;  4GB0 A;  2AVW A;  1IYM A;  2EOD A;  1PPN A;  1WIL A;  1S4V A;  1ATK A;  4PI3 A;  2FT2 A;  1Y4H A;  4BS6 A;  3CBK A;  2YQL A;  1JQP A;  1FH0 A;  3ZYQ A;  3LFY A;  1BP4 A;  2DZZ A;  5LKU A;  1X4U A;  3NG2 A;  1LDK C;  1MM3 A;  4YYV A;  1Q6K A;  3T7L A;  1WIM A;  2H0D B;  4K7C A;  4BS5 A;  2LGL A;  2G6Q A;  2E02 A;  4Q8G A;  4DMY A;  3IHP A;  5TAB A;  2FUI A;  2YHN A;  2G45 A;  2YSJ A;  5C11 A;  5H1U A;  1X9Y A;  4GNG A;  2BDL A;  3H89 A;  2VPG A;  2AS8 A;  4XUI A;  1IWD A;  2ARY A;  3BCN A;  5DIN A;  4FO9 A;  3K9M A;  1PPP A;  1Z60 A;  2JMD A;  4DMX A;  3PNR A;  1SP4 B;  3M63 A;  2IPP B;  2UZG A;  3PUQ A;  4W4U A;  1EWP A;  3O36 A;  2ECN A;  2JQG R;  4PAD A;  3B79 A;  4UI9 B;  2R6N A;  5LKT A;  3H6S A;  3KQI A;  2DC8 A;  3BOW A;  4N4F A;  4WA6 A;  5TDR A;  2ECI A;  4YYQ A;  1YK7 A;  1ICF A;  3M62 A;  2PNX A;  4QRX A;  1MIR A;  1TU6 A;  2BDZ A;  5TBN A;  1KFX L;  2FYE A;  1EWM A;  1SNK A;  1AYW A;  5CHT A;  1WEU A;  4I7C A;  1YK8 A;  3PHD A;  4AYC A;  1MEG A;  3C5K A;  5FB0 A;  4QRG A;  4RY2 A;  2NQA A;  2LGG A;  2Y43 A;  2M1R A;  3RVW A;  1NPZ A;  2YJB A;  4CDC B;  2YQM A;  2MIQ A;  3M99 A;  1WEQ A;  2VJF B;  1EWL A;  3OVZ A;  3O33 A;  1NLJ A;  4AUQ B;  5H1T A;  4N79 A;  2E6S A;  1YVB A;  3IUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...