4FK5A

Structure of the saga ubp8(s144n)/sgf11/sus1/sgf73 dub module
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
473
structure length
437
Chain Sequence
AAMSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGNTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALSTNRQTGFIYLLTCAWKINQQQDAHEFWQFIINQIHQSYVLDLPNAKEVSRANNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQCGECNSAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
publication title A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 132
structure length 437
sequence length 473
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4fk5A01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4fk5A02
3F75A 1U9WA 3DPLR 1RMDA 2VPEA 3LFYA 1AU3A 3OVXA 4OEMA 2DCBA 2YURA 3PHDA 5D1MB 5JG6A 2DJGB 4XUIA 1SNKA 1WILA 5C13A 4BPVA 2LDRA 2MNYA 3N3GA 4LKAA 3H89A 4YADA 3I3TA 2MIQA 2Y5BA 6PADA 3GV4A 2F1GA 2YW8A 4K7CA 1JM7B 2KREA 4UI9B 4CA1A 4X6HA 4AUQB 3GCBA 3V6EA 4I04A 2VHSA 2BDLA 3MHSA 1IYMA 4P6EA 2M3HA 1MHWA 3BPMA 1VYXA 3KW9A 1ME4A 4CZWA 2ECJA 1DF0A 2ACTA 1TU6A 4X6IA 1TLOA 3E1ZB 4B86C 1JOCA 4MVTA 4A4BA 3PNRA 4CDDB 4YBSA 1CV8A 4AXLA 4BSQA 3BOWA 2C2VS 2JMJA 4N4FA 2L75A 1S4VA 1HUCB 3S3RA 1CSBB 1QOLA 3MORA 3VK6A 3RVWA 1CPJA 3S3QA 4MZOA 4W5BA 2XU3A 3C5KA 1VD4A 2XEUA 1BP4A 1YK8A 3NG2A 2PUYA 5DINA 2G7YA 5LKUA 1T1HA 2M1RA 2DCAA 1VFYA 2VPGA 3N9PA 1G25A 2E6SA 2YJ9A 1ITOA 3CBJA 1WEVA 1U6GB 3N9QA 3KNVA 1X9YA 4YBTA 2LQ6A 3RPGB 3CH2X 3ZPVE 2AU1A 4BS6A 3RPGC 3OF8A 5EF4A 1E4UA 1U9VA 4CDFB 4MSXA 3IOQA 2HXZA 2AYNA 4I7BA 1KFXL 2ECVA 4YVAA 1VJVA 3HCUA 3IV2A 1N87A 3K8UA 2FUIA 1WENA 1AECA 3ASLA 4GB0A 1AIMA 2ATOA 2HH5A 3IEJA 4AYCA 5JA7A 1VSNA 3HTKC 4UP5A 5EGWA 1Z2QA 2DJFB 2R9OA 4UP0A 2YREA 1DVPA 3KQIA 4GNGA 2FUDA 2VHFA 2XU1A 3BWKA 4V3KC 5FERA 2ARYA 1F2CA 3ZPV1 5G04B 1Y08A 2OZ2A 1FP0A 3LRQA 5CVMA 4I07A 4V3LC 2CIOA 2E01A 4YABA 4QBBA 3RVVA 5B76A 5B79A 4YAXA 1K3BB 3LXSA 2L43A 1MS6A 1CHCA 5D1LB 4QF2A 4PP1A 1IWDA 2EA6A 2L0BA 4PPEA 3WXFA 1TL9A 2CT2A 1JQPA 5FB0A 1MEGA 3RTRB 1EWPA 2M85A 3V6CA 2VJEB 2LGLA 2EODA 2KR4A 5H9MA 4O64A 4AVXA 3GL6A 3U5MA 2C2LA 2KWKA 2YU4A 5AIUA 2PADA 1JM7A 2ECIA 4ZQLA 1MM3A 2EGPA 1CB5A 4L7XA 3O34A 1AU4A 2R9CA 3O1GA 3L1ZB 4YATA 3D6SA 4FJCA 2Y6EA 2K16A 5DKAA 2YHNA 2MA6A 2G8JA 2FYEA 4QRGA 1U9XA 2AS8A 4YC9A 4W5CA 1X4JA 2F6JA 4W4UA 2AN6A 3HCSA 4LJNA 3ZNIA 3ZVZB 4A4CA 4PTBA 3L11A 2R9MA 3C6WA 5C11A 4YBMA 4BS5A 2LXHC 1MEMA 1EWOA 4N8WA 3P5XA 3PURA 4XR7A 1NB5A 2LV9A 2VPDA 4N4ZA 3SOXA 2G45A 1WEPA 2YQLA 3N9MA 4CDCB 1O0EA 2JQFR 3PW3A 1NL6A 2KWOA 1PIPA 5AITA 3TNXA 5FB1A 2YJ8A 4I7DA 4R2YA 3QSDA 1WEEA 1CS8A 2OXQC 5TABA 1NLJA 5KH3A 2YJBA 3PDFA 2DX8A 5LKZA 1MIRA 2H0DA 2CSZA 5J3XA 3QZVA 1XWHA 1EWMA 2L80A 2YSJA 5A24A 2JMIA 2LXPC 2NQIA 1WGMA 4CDEB 4PP2E 3EB5A 2Y1MA 1WEUA 2D8SA 3IMAA 2MA5A 1GMYA 1WFKA 2AUXA 4X6JA 4FK5A 1PBHA 2FT2A 2MD7B 3NHEA 2B1MA 5LKTA 2K1JA 3WXEA 3SOWA 4RY2A 2KWJA 3V43A 1ICFA 4ZDTA 4R7EA 2DC8A 3KV6A 3B79A 1ZBDB 2ECNA 1HYIA 1U5IA 1BQIA 2P0RA 4A49A 2AIMA 2DCCA 4YYWA 2HHNA 5B75A 1YVBA 3HWNA 4LADB 2DC6A 5G0FA 2H7JA 2ECTA 2H0DB 3C9EA 2E03A 2MUMA 3HHIA 2VJEA 4A0CD 1MM2A 4TKPB 2R6NA 1PXVA 1A6RA 2BDZA 4XI1A 1KHQA 1F62A 1PPOA 5LKXA 5TDWA 3USVA 9PAPA 1YALA 3LQJA 3IUTA 2QIZA 3T7LA 2KYUA 1GECE 1QDQA 2R9FA 3ERVA 3QT4A 2F6NA 3PBHA 2B1NA 2XU4A 1M6DA 2G8EA 4BBQA 4L58A 3EB6A 2XU5A 1AU2A 5H1VA 4R8PK 3KFQA 2NAAA 3SOUA 2QJ0A 2KE1A 1DEUA 2AYOA 4AP4A 2NQAA 2F42A 1MDWA 2YYRA 2VNFA 4I7CA 2K4DA 3M63A 5CHVA 2F7DA 2NQGA 3BC3A 2LGKA 3N9OA 4WZ2A 1WESA 3KKUA 5PADA 4PI3A 3U8EA 3ZTGA 1BORA 1F2BA 4N3WA 3WXGA 5KH9A 3K9MA 5TRBA 5CVOB 2QICA 2ZETC 1WEOA 1WIMA 2M6MA 5I3LA 3P5UA 2ECWA 3N4CA 2XB1A 2GHUA 2FTDA 2PBHA 1SP4B 2IPPB 1CQDA 2E02A 2BAYA 1PPDA 4LK9A 5CHTA 5FEYA 5LCWB 4BHWA 1U9QX 1NB3A 3OF9A 1X4UA 2VJFB 2YUCA 4QH6A 1FH0A 2YHOA 3O7AA 2KGIA 5D1KB 2PREA 4MZSA 5KH7A 3O36A 3ZYQA 3CH3X 2YJCA 2L5UA 4YYQA 1HYJA 3O35A 4HWYA 3IHPA 1QMYA 2K17A 5CVNB 3FL2A 3AI8A 1KXRA 5G05B 2KWNA 2IDAA 2GFOA 3K24A 5FPWA 2YQMA 3O0UA 5B8DA 2CB5A 4OELA 1WEQA 3KWBX 4WZ3B 3BPFA 3OISA 2CKLA 3SHBA 2YSMA 2LN0A 1CVZA 3BCNA 4YYRA 2C0YA 3U5NA 1ATKA 1ZIVA 3HD3A 1BGOA 1CTEA 1GLOA 2RSDA 1YK7A 1AYVA 1KHPA 2G43A 3P5WA 2PNSA 4I05A 3KSEA 4F52B 1AYUA 4N79A 2DZZA 1WE9A 3I06A 2OULA 3H8BA 2O6XA 1V87A 3N9NA 4B7YC 4Q8GA 2FRQA 1EWLA 5B77A 3KV5A 1GCBA 4GNEA 2LGGA 1WEWA 4C9ZA 3H8CA 2YT5A 4FIPA 4NN2A 3HCTA 2JQGR 3M99A 2Y1NA 1XKGA 2AVWA 2CKLB 3RVXA 4DMYA 1PPNA 3I2DA 4CCGX 1CJLA 5J94A 1Q6KA 1K2FA 1STFE 4GNDA 3O70A 1PE6A 2VP7A 2G6DA 1PADA 4QF3A 2OP3A 1X4IA 4FO9A 4GNFA 4YYUA 2R9NA 4DMXA 8PCHA 4ZUXU 3KX1A 1QXPA 1WEMA 2YJ2A 3L1XA 1PCIA 3ZUAA 1ZCMA 1PPPA 2IBIA 2RI7A 5TBNA 1AYWA 2I50A 3QJ3A 2WBFX 1NQCA 3U5PA 3H7DA 1ME3A 1LDJB 4YV8A 2ECGA 2FUUA 1BY8A 1YT7A 4P5OB 3N3KA 2FO5A 4P6GA 2KGGA 2VPBA 3T6RA 4YYSA 3MHHA 1AU0A 2E00A 3KWZA 2KU3A 4IC3A 5H1UA 3DQVR 1Y4HA 1FBVA 3N9LA 5JH3A 2MD8C 3U5OA 1F2AA 3P5VA 1THEA 3OVZA 2LGVA 2VJFA 3M62A 2KFTA 5H1TA 3H6SA 4QRXA 2PNXA 3DF0A 4YYVA 3HHAA 5F02A 1LDKC 2KIZA 3CBKA 3O37A 2UZGA 2DC9A 2DZYA 3LQHA 1Z60A 4AXMA 3LQIA 4PADA 2MNZA 5B78A 2G6QA 5EYAF 1Z6UA 2JMDA 2HYED 4Q8HA 3O33A 2DC7A 4KLBA 2LRIC 4AYCB 2P86A 4S3OB 2E6RA 4G54A 1NPZA 2MT5A 4IC2A 4Q6FA 5K16A 4S3OC 7PCKA 1POPA 3F5VA 4QRVA 3PUQA 5TDRA 1KFUL 2JRJA 2AUZA 1EF7A 2FQ9A 2HDPA 4LLBA 2FSAA 4WA6A 2HD5A 1F29A 2P7UA 4BQVA 2NQDB 2CSYA 4X3GA 2DCDA 3MTNA 3ZVYA 4WZ0A 2Y43A 2FRAA
chains in the Genus database with same CATH superfamily
3F75A 2P57A 1U9WA 3DPLR 1RMDA 2VPEA 3LFYA 1AU3A 3OVXA 4OEMA 2DCBA 2YURA 3PHDA 3ZNHA 5D1MB 5JG6A 2DJGB 4XUIA 4BOSA 1SNKA 1WILA 5C13A 4BPVA 2LDRA 2MNYA 3N3GA 4LKAA 3H89A 4YADA 3I3TA 2MIQA 2Y5BA 1PVJA 6PADA 3GV4A 2F1GA 2YW8A 2OWAA 4K7CA 1JM7B 2KREA 4UI9B 3O47A 4CA1A 4X6HA 4AUQB 3GCBA 3V6EA 4I04A 2DJAA 2VHSA 4ZTBA 3PSEA 2BDLA 3MHSA 1IYMA 4P6EA 2M3HA 1MHWA 3BPMA 1VYXA 3KW9A 1ME4A 4CZWA 2ECJA 1DF0A 4OGEA 2ACTA 4IUMA 1TU6A 3PHWA 4X6IA 1TLOA 4Z0RA 3E1ZB 4B86C 1JOCA 4MVTA 4A4BA 3PNRA 4CDDB 4YBSA 1CV8A 3C0RA 2UZJA 4AXLA 4BSQA 3BOWA 2C2VS 2JMJA 4N4FA 2L75A 1S4VA 1HUCB 3S3RA 1CSBB 1QOLA 3MORA 3VK6A 3RVWA 1CPJA 3S3QA 3BB7A 4MZOA 4W5BA 2XU3A 3TRKA 4H9DA 3C5KA 1VD4A 2XEUA 1BP4A 3NG2A 2PUYA 5DINA 1YK8A 2G7YA 5LKUA 1T1HA 2M1RA 3FM8C 2DCAA 1VFYA 2CRWA 2VPGA 3N9PA 1G25A 2E6SA 2YJ9A 3W30A 1ITOA 4F1PA 1WEVA 3CBJA 1U6GB 4IP3A 3N9QA 3KNVA 1X9YA 4YBTA 2LQ6A 3RPGB 3CH2X 3ZPVE 2AU1A 4BS6A 3RPGC 3LJUX 3OF8A 5EF4A 1E4UA 4OW0A 1U9VA 4REZA 4CDFB 4MSXA 3IOQA 2HXZA 2AYNA 4I7BA 1KFXL 2ECVA 4YVAA 1VJVA 3PLWA 3HCUA 3IV2A 1N87A 3K8UA 2FUIA 1WENA 1AECA 3ASLA 4GB0A 1AIMA 2ATOA 2HH5A 3IEJA 4AYCA 5JA7A 1VSNA 3HTKC 4UP5A 5EGWA 3RNVA 1Z2QA 2RR4A 2KKYA 2DJFB 2R9OA 2YREA 1DVPA 4GNGA 3KQIA 4UP0A 2FUDA 2VHFA 2XU1A 3BWKA 4V3KC 5FERA 2ARYA 1F2CA 2KKXA 3ZPV1 5G04B 1Y08A 2OZ2A 1FP0A 3LRQA 4D8EA 5CVMA 4I07A 4V3LC 2CIOA 2E01A 4YABA 4QBBA 3RVVA 3M7KA 5B76A 5B79A 4YAXA 1K3BB 3LXSA 2L43A 1MS6A 1CHCA 5D1LB 4QF2A 5E6JA 4PP1A 1IWDA 2EA6A 2EGMA 2L0BA 4PPEA 3WXFA 1TL9A 2CT2A 1JQPA 5FB0A 1MEGA 2L7PA 3RTRB 1EWPA 2M85A 3V6CA 3O65A 2VJEB 2LGLA 2EODA 2KR4A 5H9MA 4O64A 4AVXA 4Z0OA 3GL6A 2E61A 3U5MA 2C2LA 2KWKA 2YU4A 5AIUA 2PADA 1JM7A 2ECIA 4ZQLA 1MM3A 2EGPA 2EXUA 1CB5A 3PRPA 4L7XA 3O34A 1AU4A 2R9CA 3O1GA 3L1ZB 4YATA 3D6SA 4FJCA 2Y6EA 2K16A 5DKAA 2YHNA 2MA6A 2G8JA 2FYEA 4QRGA 1U9XA 2AS8A 4YC9A 4W5CA 1X4JA 2CRRA 3KDEC 2F6JA 4W4UA 2AN6A 3HCSA 4LJNA 3ZNIA 3ZVZB 4A4CA 4PTBA 3L11A 2R9MA 3C6WA 5C11A 3DWDA 4BOZA 4RKXA 4YBMA 2XOYA 4BS5A 2LXHC 3LVRE 1MEMA 1EWOA 4N8WA 2D8UA 3P5XA 3PURA 4XR7A 1NB5A 2LV9A 4PT5A 4QQ4A 2VPDA 4N4ZA 2J7QC 5K3QA 3SOXA 2G45A 1WEPA 2YQLA 3N9MA 4CDCB 1O0EA 2JQFR 3PW3A 4D8BA 4XZXA 1NL6A 2KWOA 1PIPA 2YVRA 5AITA 3BBAA 3TNXA 5FB1A 2YJ8A 2XOCA 4I7DA 4R2YA 3MTVA 3FAOA 3QSDA 1WEEA 1CS8A 2OXQC 4MM3B 4MI7A 5TABA 1NLJA 5KH3A 2YJBA 3PDFA 2DX8A 5LKZA 1MIRA 2H0DA 2CSZA 3FEHA 5J3XA 3QZVA 1XWHA 1EWMA 2B0OE 2L80A 2YSJA 5A24A 2JMIA 2LXPC 2NQIA 1WGMA 2FFWA 4PP2E 3W31A 4CDEB 3EB5A 2Y1MA 1WEUA 2D8SA 3IMAA 2MA5A 1GMYA 1WFKA 2AUXA 4X6JA 4FK5A 1PBHA 2FT2A 2MD7B 3NHEA 2B1MA 5LKTA 2K1JA 3WXEA 3SOWA 4RY2A 5EZQA 2KWJA 3V43A 1ICFA 4ZDTA 4R7EA 2DC8A 3KV6A 3B79A 2DSMA 1ZBDB 2ECNA 1HYIA 1U5IA 1BQIA 2P0RA 4A49A 3MJ5A 2AIMA 2DCCA 4YYWA 2HHNA 5B75A 1YVBA 3HWNA 3E9SA 4LADB 2DC6A 5G0FA 2H7JA 1DKIA 2ECTA 2H0DB 3C9EA 2MKEA 2E03A 2MUMA 3HHIA 2VJEA 4A0CD 1MM2A 4TKPB 2R6NA 1PXVA 1A6RA 2BDZA 4XI1A 1KHQA 1F62A 1PPOA 5LKXA 5TDWA 3USVA 9PAPA 1YALA 3LQJA 3IUTA 2QIZA 3LVQE 2KYUA 3T7LA 1GECE 1QDQA 4HXDB 2R9FA 3ERVA 3QT4A 2F6NA 3PBHA 2B1NA 4WURA 2XU4A 1M6DA 2G8EA 4BBQA 4L58A 3EB6A 2XU5A 2XOZA 1AU2A 5SVIA 5H1VA 4R8PK 3OQCA 2FD4A 3KFQA 2NAAA 3SOUA 2QJ0A 2KE1A 1DEUA 2AYOA 4AP4A 2NQAA 4M0WA 2F42A 1MDWA 2YYRA 2VNFA 4I7CA 2K4DA 3M63A 5CHVA 2DOSA 2F7DA 2NQGA 3BC3A 2LGKA 3N9OA 4WZ2A 1WESA 3KKUA 5PADA 4PI3A 3U8EA 3ZTGA 1BORA 1F2BA 4N3WA 3FJUB 3WXGA 5KH9A 3K9MA 5TRBA 5CVOB 2QICA 2ZETC 1WEOA 1WIMA 2M6MA 5I3LA 3P5UA 2ECWA 3N4CA 2XB1A 2GHUA 2FTDA 2PBHA 1SP4B 2IPPB 1CQDA 2E02A 2J7QA 2BAYA 1PPDA 4LK9A 3BY4A 5CHTA 5FEYA 5SVIB 5LCWB 4BHWA 1U9QX 1NB3A 3OF9A 1X4UA 2BU3A 4GUAA 2VJFB 2YUCA 4QH6A 1FH0A 2YHOA 3O7AA 2KGIA 5D1KB 2PREA 4MZSA 5KH7A 3O36A 3ZYQA 5KO3A 3CH3X 3JUEA 4BOPA 2HWKA 2YJCA 2L5UA 1DCQA 4YYQA 1HYJA 3O35A 4HWYA 3IHPA 1QMYA 2K17A 5CVNB 3FL2A 3PRMA 2CONA 3AI8A 1MBMA 1KXRA 5G05B 2KWNA 2IDAA 2GFOA 5SVYA 3K24A 2YQMA 3O0UA 5B8DA 2CB5A 4OELA 5FPWA 1WEQA 5JZEA 3KWBX 4WZ3B 1YZBA 3BPFA 3OISA 2CKLA 3SHBA 2YSMA 2LN0A 1CVZA 3BCNA 4YYRA 2C0YA 3U5NA 1ATKA 1ZIVA 3HD3A 1BGOA 1CTEA 1GLOA 2RSDA 1YK7A 2JRIA 1AYVA 1KHPA 4BOQA 2G43A 2Z84A 3P5WA 2PNSA 4I05A 2JUNA 3KSEA 4F52B 1AYUA 4N79A 2DZZA 1WE9A 3I06A 2OULA 3H8BA 4OVZA 3Q1DA 2O6XA 1V87A 3N9NA 4B7YC 4Q8GA 4RNAA 2FRQA 1EWLA 5B77A 3KV5A 1GCBA 4GNEA 3PT2A 2LGGA 1UKFA 1WEWA 4C9ZA 3H8CA 2YT5A 4FIPA 4NN2A 3HCTA 2JQGR 3M99A 2Y1NA 1XKGA 2AVWA 2BTWA 2CKLB 3RVXA 4DMYA 1PPNA 3I2DA 4CCGX 1CJLA 5J94A 1Q6KA 1K2FA 2IQJA 1STFE 4GNDA 3O70A 1PE6A 2VP7A 2G6DA 1PADA 4QF3A 2OP3A 1X4IA 4FO9A 4GNFA 4YYUA 2R9NA 4DMXA 8PCHA 2JM3A 4ZUXU 3KX1A 4OVZB 1QXPA 3B21A 1WEMA 3PHXA 2YJ2A 3L1XA 1PCIA 3ZUAA 1ZCMA 1PPPA 2IBIA 2RI7A 5TBNA 3MP2A 1AYWA 2I50A 3QJ3A 4A5UA 2WBFX 1NQCA 3U5PA 3H7DA 1ME3A 1LDJB 4YV8A 2ECGA 2FUUA 1BY8A 1YT7A 4P5OB 3N3KA 2FO5A 2BTWB 4P6GA 2KGGA 2VPBA 3T6RA 4YYSA 3MHHA 1AU0A 2E00A 3KWZA 2KU3A 4IC3A 5H1UA 3DQVR 1Y4HA 1FBVA 2XP0A 3N9LA 5JH3A 2MD8C 4O62A 3U5OA 4R3DA 3T9KA 4D8IA 3DDTA 1F2AA 3P5VA 1THEA 3OVZA 2LGVA 3TMPA 2VJFA 3M62A 2KFTA 5H1TA 3H6SA 4QRXA 2PNXA 4OGCA 3PHUA 3DF0A 4YYVA 3HHAA 5F02A 1LDKC 2KIZA 3CBKA 3O37A 2UZGA 2DC9A 3IFUA 2DZYA 3LQHA 4BOUA 1Z60A 5SVXA 4AXMA 3LQIA 4PADA 4RF1A 2M13A 2MNZA 5B78A 4RF0A 2G6QA 3FANA 5EYAF 3SUBA 1Z6UA 2JMDA 2HYED 2CSVA 2JTCA 4P16A 4Q8HA 3LDYA 3O33A 2DC7A 2FE8A 2AGAA 4KLBA 2LRIC 4AYCB 2P86A 4S3OB 2E6RA 4G54A 1NPZA 3MDBC 2MT5A 4IC2A 4Q6FA 5K16A 3H7HA 4S3OC 7PCKA 1POPA 3F5VA 4QRVA 3PUQA 5TDRA 1KFUL 2JRJA 2AUZA 2LAUA 1EF7A 2FQ9A 2HDPA 4LLBA 2FSAA 4WA6A 2HD5A 5EZSA 1F29A 2P7UA 4BQVA 2NQDB 2CSYA 4X3GA 2DCDA 3MTNA 3ZVYA 4WZ0A 2Y43A 3E2DA 2FRAA
chains in the Genus database with same CATH topology
3F75A 1U9WA 3DPLR 1RMDA 2VPEA 3LFYA 1AU3A 3OVXA 4OEMA 2DCBA 2YURA 3PHDA 5D1MB 5JG6A 2DJGB 4XUIA 1SNKA 1WILA 5C13A 4BPVA 2LDRA 2MNYA 3N3GA 4LKAA 3H89A 4YADA 3I3TA 2MIQA 2Y5BA 6PADA 3GV4A 2F1GA 2YW8A 4K7CA 1JM7B 2KREA 4UI9B 4CA1A 4X6HA 4AUQB 3GCBA 3V6EA 4I04A 2VHSA 2BDLA 3MHSA 1IYMA 4P6EA 2M3HA 1MHWA 3BPMA 1VYXA 3KW9A 1ME4A 4CZWA 2ECJA 1DF0A 2ACTA 1TU6A 4X6IA 1TLOA 3E1ZB 4B86C 1JOCA 4MVTA 4A4BA 3PNRA 4CDDB 4YBSA 1CV8A 4AXLA 4BSQA 3BOWA 2C2VS 2JMJA 4N4FA 2L75A 1S4VA 1HUCB 3S3RA 1CSBB 1QOLA 3MORA 3VK6A 3RVWA 1CPJA 3S3QA 4MZOA 4W5BA 2XU3A 3C5KA 1VD4A 2XEUA 1BP4A 1YK8A 3NG2A 2PUYA 5DINA 2G7YA 5LKUA 1T1HA 2M1RA 2DCAA 1VFYA 2VPGA 3N9PA 1G25A 2E6SA 2YJ9A 1ITOA 3CBJA 1WEVA 1U6GB 3N9QA 3KNVA 1X9YA 4YBTA 2LQ6A 3RPGB 3CH2X 3ZPVE 2AU1A 4BS6A 3RPGC 3OF8A 4C5PA 5EF4A 1E4UA 1U9VA 4CDFB 4MSXA 3IOQA 2HXZA 2AYNA 4I7BA 1KFXL 2ECVA 4YVAA 1VJVA 3HCUA 3IV2A 1N87A 3K8UA 2FUIA 1WENA 1AECA 3ASLA 4GB0A 1AIMA 2ATOA 2HH5A 3IEJA 4AYCA 5JA7A 1VSNA 3HTKC 4UP5A 5EGWA 1Z2QA 2DJFB 2R9OA 4UP0A 2YREA 1DVPA 3KQIA 4GNGA 2FUDA 2VHFA 2XU1A 3BWKA 4V3KC 5FERA 2ARYA 1F2CA 3ZPV1 5G04B 1Y08A 2OZ2A 1FP0A 3LRQA 5CVMA 4I07A 4V3LC 2CIOA 2E01A 4YABA 4QBBA 3RVVA 5B76A 5B79A 4YAXA 1K3BB 3LXSA 2L43A 1MS6A 1CHCA 5D1LB 4QF2A 4PP1A 1IWDA 2EA6A 2L0BA 4PPEA 3WXFA 1TL9A 2CT2A 1JQPA 5FB0A 1MEGA 3RTRB 1EWPA 2M85A 3V6CA 2VJEB 2LGLA 2EODA 2KR4A 5H9MA 4O64A 4AVXA 3GL6A 3U5MA 2C2LA 2KWKA 2YU4A 5AIUA 2PADA 1JM7A 2ECIA 4ZQLA 1MM3A 2EGPA 1CB5A 4L7XA 3O34A 1AU4A 2R9CA 3O1GA 3L1ZB 4YATA 3D6SA 4FJCA 2Y6EA 2K16A 5DKAA 2YHNA 2MA6A 2G8JA 2FYEA 4QRGA 1U9XA 2AS8A 4YC9A 4W5CA 4GUZA 1X4JA 2F6JA 4W4UA 2AN6A 3HCSA 4LJNA 3ZNIA 3ZVZB 4A4CA 4PTBA 3L11A 2R9MA 3C6WA 5C11A 4YBMA 4BS5A 2LXHC 1W5RA 1MEMA 1EWOA 4N8WA 3P5XA 3PURA 4XR7A 1NB5A 2LV9A 2VPDA 4N4ZA 3SOXA 2G45A 1WEPA 2YQLA 3N9MA 4CDCB 1O0EA 2JQFR 3PW3A 2BSZA 1NL6A 2KWOA 1PIPA 5AITA 3TNXA 5FB1A 2YJ8A 4I7DA 4R2YA 3QSDA 1WEEA 1CS8A 2OXQC 5TABA 4NV8A 1NLJA 5KH3A 2YJBA 3PDFA 2DX8A 5LKZA 1MIRA 2H0DA 2CSZA 5J3XA 3QZVA 1XWHA 1EWMA 2L80A 2YSJA 5A24A 2JMIA 2LXPC 2NQIA 1WGMA 4CDEB 4PP2E 3EB5A 2Y1MA 1WEUA 2D8SA 3IMAA 2MA5A 1GMYA 1WFKA 2AUXA 4X6JA 4FK5A 1PBHA 2FT2A 2MD7B 3NHEA 1W4TA 2B1MA 5LKTA 2K1JA 3WXEA 3SOWA 4RY2A 2KWJA 3V43A 1ICFA 4ZDTA 4R7EA 2DC8A 3KV6A 3B79A 1ZBDB 2ECNA 1HYIA 1U5IA 1BQIA 2P0RA 4A49A 2AIMA 2DCCA 4YYWA 2HHNA 5B75A 1YVBA 3HWNA 4LADB 2DC6A 5G0FA 2H7JA 2ECTA 2H0DB 3C9EA 2E03A 2MUMA 3HHIA 2VJEA 4A0CD 1MM2A 4TKPB 2R6NA 1PXVA 1A6RA 2BDZA 4XI1A 1KHQA 1F62A 1PPOA 5LKXA 5TDWA 3USVA 9PAPA 1YALA 3LQJA 3IUTA 2QIZA 3T7LA 2KYUA 1GECE 1QDQA 2R9FA 3ERVA 3QT4A 2F6NA 3PBHA 2B1NA 2XU4A 1M6DA 2G8EA 4BBQA 4L58A 3EB6A 2XU5A 1AU2A 5H1VA 4R8PK 3KFQA 2NAAA 3SOUA 2QJ0A 2KE1A 1DEUA 2AYOA 4AP4A 2NQAA 2F42A 1MDWA 2YYRA 2VNFA 4I7CA 2K4DA 3M63A 5CHVA 2F7DA 2NQGA 3BC3A 2LGKA 3N9OA 4WZ2A 1WESA 3KKUA 5PADA 4PI3A 3U8EA 3ZTGA 1BORA 1F2BA 4B55A 4N3WA 3WXGA 5KH9A 3K9MA 5TRBA 5CVOB 2QICA 2ZETC 1WEOA 1WIMA 2M6MA 5I3LA 3P5UA 2ECWA 3N4CA 2XB1A 2GHUA 2FTDA 2PBHA 1SP4B 2IPPB 1CQDA 2E02A 2BAYA 1PPDA 4LK9A 5CHTA 5FEYA 5LCWB 4BHWA 1U9QX 1NB3A 3OF9A 1X4UA 2VJFB 2YUCA 4QH6A 1FH0A 2YHOA 3O7AA 2KGIA 5D1KB 2PREA 4MZSA 5KH7A 3O36A 3ZYQA 3CH3X 2YJCA 2L5UA 4YYQA 1HYJA 3O35A 3D9WA 4HWYA 2VFCA 3IHPA 1QMYA 2K17A 5CVNB 3FL2A 3AI8A 1KXRA 5G05B 2KWNA 2IDAA 2GFOA 3K24A 5FPWA 2YQMA 3O0UA 5B8DA 2CB5A 4OELA 1WEQA 3KWBX 4WZ3B 3BPFA 3OISA 2CKLA 3SHBA 2YSMA 2LN0A 1CVZA 3BCNA 4YYRA 2C0YA 3U5NA 1ATKA 1ZIVA 3HD3A 1BGOA 1CTEA 1GLOA 1GX3A 2RSDA 1YK7A 1AYVA 1KHPA 2G43A 3P5WA 2PNSA 4I05A 3KSEA 4F52B 1AYUA 4N79A 2DZZA 1WE9A 3I06A 2OULA 3H8BA 2O6XA 1V87A 3N9NA 4B7YC 4Q8GA 2FRQA 1EWLA 5B77A 3KV5A 1GCBA 4GNEA 2LGGA 1WEWA 4C9ZA 3H8CA 2YT5A 4FIPA 4NN2A 3HCTA 2JQGR 3M99A 2Y1NA 1XKGA 2AVWA 2CKLB 3RVXA 4DMYA 1PPNA 3I2DA 4CCGX 1CJLA 5J94A 1Q6KA 1K2FA 1STFE 4GNDA 3O70A 1PE6A 2VP7A 2G6DA 1PADA 4QF3A 2OP3A 2VFBA 1X4IA 4FO9A 4GNFA 4YYUA 2R9NA 4DMXA 8PCHA 4ZUXU 3KX1A 1QXPA 1WEMA 2YJ2A 3L1XA 1PCIA 3ZUAA 1ZCMA 1PPPA 2IBIA 2RI7A 5TBNA 1AYWA 2I50A 3QJ3A 2WBFX 1NQCA 3U5PA 3H7DA 1ME3A 3LTWA 1LDJB 4YV8A 2ECGA 2FUUA 1BY8A 1YT7A 4P5OB 3N3KA 2FO5A 4P6GA 2KGGA 2VPBA 3T6RA 4YYSA 3MHHA 1AU0A 2E00A 3KWZA 2KU3A 4IC3A 5H1UA 3DQVR 1Y4HA 1FBVA 3N9LA 5JH3A 2MD8C 3U5OA 1F2AA 3P5VA 1THEA 3OVZA 2LGVA 2VJFA 3M62A 2KFTA 5H1TA 3H6SA 4QRXA 2PNXA 3DF0A 4YYVA 3HHAA 5F02A 1LDKC 2KIZA 3CBKA 3O37A 2UZGA 2DC9A 2DZYA 3LQHA 1E2TA 1Z60A 4AXMA 3LQIA 4PADA 2MNZA 5B78A 4BGFA 2G6QA 5EYAF 1Z6UA 2JMDA 2HYED 4Q8HA 3O33A 2DC7A 4KLBA 2LRIC 4AYCB 2P86A 4S3OB 2E6RA 4G54A 1NPZA 2MT5A 4IC2A 4Q6FA 1W6FA 5K16A 4S3OC 7PCKA 1POPA 3F5VA 4NV7A 4QRVA 3PUQA 5TDRA 1KFUL 2JRJA 2AUZA 1EF7A 2FQ9A 2HDPA 4LLBA 2FSAA 4WA6A 2HD5A 1F29A 2P7UA 4BQVA 2NQDB 2CSYA 4X3GA 2DCDA 3MTNA 3ZVYA 4WZ0A 2Y43A 2FRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F75 A;  1U9W A;  3DPL R;  1RMD A;  2VPE A;  3LFY A;  1AU3 A;  3OVX A;  4OEM A;  2DCB A;  2YUR A;  3PHD A;  5D1M B;  5JG6 A;  2DJG B;  4XUI A;  1SNK A;  1WIL A;  5C13 A;  4BPV A;  2LDR A;  2MNY A;  3N3G A;  4LKA A;  3H89 A;  4YAD A;  3I3T A;  2MIQ A;  2Y5B A;  6PAD A;  3GV4 A;  2F1G A;  2YW8 A;  4K7C A;  1JM7 B;  2KRE A;  4UI9 B;  4CA1 A;  4X6H A;  4AUQ B;  3GCB A;  3V6E A;  4I04 A;  2VHS A;  2BDL A;  3MHS A;  1IYM A;  4P6E A;  2M3H A;  1MHW A;  3BPM A;  1VYX A;  3KW9 A;  1ME4 A;  4CZW A;  2ECJ A;  1DF0 A;  2ACT A;  1TU6 A;  4X6I A;  1TLO A;  3E1Z B;  4B86 C;  1JOC A;  4MVT A;  4A4B A;  3PNR A;  4CDD B;  4YBS A;  1CV8 A;  4AXL A;  4BSQ A;  3BOW A;  2C2V S;  2JMJ A;  4N4F A;  2L75 A;  1S4V A;  1HUC B;  3S3R A;  1CSB B;  1QOL A;  3MOR A;  3VK6 A;  3RVW A;  1CPJ A;  3S3Q A;  4MZO A;  4W5B A;  2XU3 A;  3C5K A;  1VD4 A;  2XEU A;  1BP4 A;  1YK8 A;  3NG2 A;  2PUY A;  5DIN A;  2G7Y A;  5LKU A;  1T1H A;  2M1R A;  2DCA A;  1VFY A;  2VPG A;  3N9P A;  1G25 A;  2E6S A;  2YJ9 A;  1ITO A;  3CBJ A;  1WEV A;  1U6G B;  3N9Q A;  3KNV A;  1X9Y A;  4YBT A;  2LQ6 A;  3RPG B;  3CH2 X;  3ZPV E;  2AU1 A;  4BS6 A;  3RPG C;  3OF8 A;  5EF4 A;  1E4U A;  1U9V A;  4CDF B;  4MSX A;  3IOQ A;  2HXZ A;  2AYN A;  4I7B A;  1KFX L;  2ECV A;  4YVA A;  1VJV A;  3HCU A;  3IV2 A;  1N87 A;  3K8U A;  2FUI A;  1WEN A;  1AEC A;  3ASL A;  4GB0 A;  1AIM A;  2ATO A;  2HH5 A;  3IEJ A;  4AYC A;  5JA7 A;  1VSN A;  3HTK C;  4UP5 A;  5EGW A;  1Z2Q A;  2DJF B;  2R9O A;  4UP0 A;  2YRE A;  1DVP A;  3KQI A;  4GNG A;  2FUD A;  2VHF A;  2XU1 A;  3BWK A;  4V3K C;  5FER A;  2ARY A;  1F2C A;  3ZPV 1;  5G04 B;  1Y08 A;  2OZ2 A;  1FP0 A;  3LRQ A;  5CVM A;  4I07 A;  4V3L C;  2CIO A;  2E01 A;  4YAB A;  4QBB A;  3RVV A;  5B76 A;  5B79 A;  4YAX A;  1K3B B;  3LXS A;  2L43 A;  1MS6 A;  1CHC A;  5D1L B;  4QF2 A;  4PP1 A;  1IWD A;  2EA6 A;  2L0B A;  4PPE A;  3WXF A;  1TL9 A;  2CT2 A;  1JQP A;  5FB0 A;  1MEG A;  3RTR B;  1EWP A;  2M85 A;  3V6C A;  2VJE B;  2LGL A;  2EOD A;  2KR4 A;  5H9M A;  4O64 A;  4AVX A;  3GL6 A;  3U5M A;  2C2L A;  2KWK A;  2YU4 A;  5AIU A;  2PAD A;  1JM7 A;  2ECI A;  4ZQL A;  1MM3 A;  2EGP A;  1CB5 A;  4L7X A;  3O34 A;  1AU4 A;  2R9C A;  3O1G A;  3L1Z B;  4YAT A;  3D6S A;  4FJC A;  2Y6E A;  2K16 A;  5DKA A;  2YHN A;  2MA6 A;  2G8J A;  2FYE A;  4QRG A;  1U9X A;  2AS8 A;  4YC9 A;  4W5C A;  1X4J A;  2F6J A;  4W4U A;  2AN6 A;  3HCS A;  4LJN A;  3ZNI A;  3ZVZ B;  4A4C A;  4PTB A;  3L11 A;  2R9M A;  3C6W A;  5C11 A;  4YBM A;  4BS5 A;  2LXH C;  1MEM A;  1EWO A;  4N8W A;  3P5X A;  3PUR A;  4XR7 A;  1NB5 A;  2LV9 A;  2VPD A;  4N4Z A;  3SOX A;  2G45 A;  1WEP A;  2YQL A;  3N9M A;  4CDC B;  1O0E A;  2JQF R;  3PW3 A;  1NL6 A;  2KWO A;  1PIP A;  5AIT A;  3TNX A;  5FB1 A;  2YJ8 A;  4I7D A;  4R2Y A;  3QSD A;  1WEE A;  1CS8 A;  2OXQ C;  5TAB A;  1NLJ A;  5KH3 A;  2YJB A;  3PDF A;  2DX8 A;  5LKZ A;  1MIR A;  2H0D A;  2CSZ A;  5J3X A;  3QZV A;  1XWH A;  1EWM A;  2L80 A;  2YSJ A;  5A24 A;  2JMI A;  2LXP C;  2NQI A;  1WGM A;  4CDE B;  4PP2 E;  3EB5 A;  2Y1M A;  1WEU A;  2D8S A;  3IMA A;  2MA5 A;  1GMY A;  1WFK A;  2AUX A;  4X6J A;  4FK5 A;  1PBH A;  2FT2 A;  2MD7 B;  3NHE A;  2B1M A;  5LKT A;  2K1J A;  3WXE A;  3SOW A;  4RY2 A;  2KWJ A;  3V43 A;  1ICF A;  4ZDT A;  4R7E A;  2DC8 A;  3KV6 A;  3B79 A;  1ZBD B;  2ECN A;  1HYI A;  1U5I A;  1BQI A;  2P0R A;  4A49 A;  2AIM A;  2DCC A;  4YYW A;  2HHN A;  5B75 A;  1YVB A;  3HWN A;  4LAD B;  2DC6 A;  5G0F A;  2H7J A;  2ECT A;  2H0D B;  3C9E A;  2E03 A;  2MUM A;  3HHI A;  2VJE A;  4A0C D;  1MM2 A;  4TKP B;  2R6N A;  1PXV A;  1A6R A;  2BDZ A;  4XI1 A;  1KHQ A;  1F62 A;  1PPO A;  5LKX A;  5TDW A;  3USV A;  9PAP A;  1YAL A;  3LQJ A;  3IUT A;  2QIZ A;  3T7L A;  2KYU A;  1GEC E;  1QDQ A;  2R9F A;  3ERV A;  3QT4 A;  2F6N A;  3PBH A;  2B1N A;  2XU4 A;  1M6D A;  2G8E A;  4BBQ A;  4L58 A;  3EB6 A;  2XU5 A;  1AU2 A;  5H1V A;  4R8P K;  3KFQ A;  2NAA A;  3SOU A;  2QJ0 A;  2KE1 A;  1DEU A;  2AYO A;  4AP4 A;  2NQA A;  2F42 A;  1MDW A;  2YYR A;  2VNF A;  4I7C A;  2K4D A;  3M63 A;  5CHV A;  2F7D A;  2NQG A;  3BC3 A;  2LGK A;  3N9O A;  4WZ2 A;  1WES A;  3KKU A;  5PAD A;  4PI3 A;  3U8E A;  3ZTG A;  1BOR A;  1F2B A;  4N3W A;  3WXG A;  5KH9 A;  3K9M A;  5TRB A;  5CVO B;  2QIC A;  2ZET C;  1WEO A;  1WIM A;  2M6M A;  5I3L A;  3P5U A;  2ECW A;  3N4C A;  2XB1 A;  2GHU A;  2FTD A;  2PBH A;  1SP4 B;  2IPP B;  1CQD A;  2E02 A;  2BAY A;  1PPD A;  4LK9 A;  5CHT A;  5FEY A;  5LCW B;  4BHW A;  1U9Q X;  1NB3 A;  3OF9 A;  1X4U A;  2VJF B;  2YUC A;  4QH6 A;  1FH0 A;  2YHO A;  3O7A A;  2KGI A;  5D1K B;  2PRE A;  4MZS A;  5KH7 A;  3O36 A;  3ZYQ A;  3CH3 X;  2YJC A;  2L5U A;  4YYQ A;  1HYJ A;  3O35 A;  4HWY A;  3IHP A;  1QMY A;  2K17 A;  5CVN B;  3FL2 A;  3AI8 A;  1KXR A;  5G05 B;  2KWN A;  2IDA A;  2GFO A;  3K24 A;  5FPW A;  2YQM A;  3O0U A;  5B8D A;  2CB5 A;  4OEL A;  1WEQ A;  3KWB X;  4WZ3 B;  3BPF A;  3OIS A;  2CKL A;  3SHB A;  2YSM A;  2LN0 A;  1CVZ A;  3BCN A;  4YYR A;  2C0Y A;  3U5N A;  1ATK A;  1ZIV A;  3HD3 A;  1BGO A;  1CTE A;  1GLO A;  2RSD A;  1YK7 A;  1AYV A;  1KHP A;  2G43 A;  3P5W A;  2PNS A;  4I05 A;  3KSE A;  4F52 B;  1AYU A;  4N79 A;  2DZZ A;  1WE9 A;  3I06 A;  2OUL A;  3H8B A;  2O6X A;  1V87 A;  3N9N A;  4B7Y C;  4Q8G A;  2FRQ A;  1EWL A;  5B77 A;  3KV5 A;  1GCB A;  4GNE A;  2LGG A;  1WEW A;  4C9Z A;  3H8C A;  2YT5 A;  4FIP A;  4NN2 A;  3HCT A;  2JQG R;  3M99 A;  2Y1N A;  1XKG A;  2AVW A;  2CKL B;  3RVX A;  4DMY A;  1PPN A;  3I2D A;  4CCG X;  1CJL A;  5J94 A;  1Q6K A;  1K2F A;  1STF E;  4GND A;  3O70 A;  1PE6 A;  2VP7 A;  2G6D A;  1PAD A;  4QF3 A;  2OP3 A;  1X4I A;  4FO9 A;  4GNF A;  4YYU A;  2R9N A;  4DMX A;  8PCH A;  4ZUX U;  3KX1 A;  1QXP A;  1WEM A;  2YJ2 A;  3L1X A;  1PCI A;  3ZUA A;  1ZCM A;  1PPP A;  2IBI A;  2RI7 A;  5TBN A;  1AYW A;  2I50 A;  3QJ3 A;  2WBF X;  1NQC A;  3U5P A;  3H7D A;  1ME3 A;  1LDJ B;  4YV8 A;  2ECG A;  2FUU A;  1BY8 A;  1YT7 A;  4P5O B;  3N3K A;  2FO5 A;  4P6G A;  2KGG A;  2VPB A;  3T6R A;  4YYS A;  3MHH A;  1AU0 A;  2E00 A;  3KWZ A;  2KU3 A;  4IC3 A;  5H1U A;  3DQV R;  1Y4H A;  1FBV A;  3N9L A;  5JH3 A;  2MD8 C;  3U5O A;  1F2A A;  3P5V A;  1THE A;  3OVZ A;  2LGV A;  2VJF A;  3M62 A;  2KFT A;  5H1T A;  3H6S A;  4QRX A;  2PNX A;  3DF0 A;  4YYV A;  3HHA A;  5F02 A;  1LDK C;  2KIZ A;  3CBK A;  3O37 A;  2UZG A;  2DC9 A;  2DZY A;  3LQH A;  1Z60 A;  4AXM A;  3LQI A;  4PAD A;  2MNZ A;  5B78 A;  2G6Q A;  5EYA F;  1Z6U A;  2JMD A;  2HYE D;  4Q8H A;  3O33 A;  2DC7 A;  4KLB A;  2LRI C;  4AYC B;  2P86 A;  4S3O B;  2E6R A;  4G54 A;  1NPZ A;  2MT5 A;  4IC2 A;  4Q6F A;  5K16 A;  4S3O C;  7PCK A;  1POP A;  3F5V A;  4QRV A;  3PUQ A;  5TDR A;  1KFU L;  2JRJ A;  2AUZ A;  1EF7 A;  2FQ9 A;  2HDP A;  4LLB A;  2FSA A;  4WA6 A;  2HD5 A;  1F29 A;  2P7U A;  4BQV A;  2NQD B;  2CSY A;  4X3G A;  2DCD A;  3MTN A;  3ZVY A;  4WZ0 A;  2Y43 A;  2FRA A; 
#chains in the Genus database with same CATH topology
 3F75 A;  2P57 A;  1U9W A;  3DPL R;  1RMD A;  2VPE A;  3LFY A;  1AU3 A;  3OVX A;  4OEM A;  2DCB A;  2YUR A;  3PHD A;  3ZNH A;  5D1M B;  5JG6 A;  2DJG B;  4XUI A;  4BOS A;  1SNK A;  1WIL A;  5C13 A;  4BPV A;  2LDR A;  2MNY A;  3N3G A;  4LKA A;  3H89 A;  4YAD A;  3I3T A;  2MIQ A;  2Y5B A;  1PVJ A;  6PAD A;  3GV4 A;  2F1G A;  2YW8 A;  2OWA A;  4K7C A;  1JM7 B;  2KRE A;  4UI9 B;  3O47 A;  4CA1 A;  4X6H A;  4AUQ B;  3GCB A;  3V6E A;  4I04 A;  2DJA A;  2VHS A;  4ZTB A;  3PSE A;  2BDL A;  3MHS A;  1IYM A;  4P6E A;  2M3H A;  1MHW A;  3BPM A;  1VYX A;  3KW9 A;  1ME4 A;  4CZW A;  2ECJ A;  1DF0 A;  4OGE A;  2ACT A;  4IUM A;  1TU6 A;  3PHW A;  4X6I A;  1TLO A;  4Z0R A;  3E1Z B;  4B86 C;  1JOC A;  4MVT A;  4A4B A;  3PNR A;  4CDD B;  4YBS A;  1CV8 A;  3C0R A;  2UZJ A;  4AXL A;  4BSQ A;  3BOW A;  2C2V S;  2JMJ A;  4N4F A;  2L75 A;  1S4V A;  1HUC B;  3S3R A;  1CSB B;  1QOL A;  3MOR A;  3VK6 A;  3RVW A;  1CPJ A;  3S3Q A;  3BB7 A;  4MZO A;  4W5B A;  2XU3 A;  3TRK A;  4H9D A;  3C5K A;  1VD4 A;  2XEU A;  1BP4 A;  3NG2 A;  2PUY A;  5DIN A;  1YK8 A;  2G7Y A;  5LKU A;  1T1H A;  2M1R A;  3FM8 C;  2DCA A;  1VFY A;  2CRW A;  2VPG A;  3N9P A;  1G25 A;  2E6S A;  2YJ9 A;  3W30 A;  1ITO A;  4F1P A;  1WEV A;  3CBJ A;  1U6G B;  4IP3 A;  3N9Q A;  3KNV A;  1X9Y A;  4YBT A;  2LQ6 A;  3RPG B;  3CH2 X;  3ZPV E;  2AU1 A;  4BS6 A;  3RPG C;  3LJU X;  3OF8 A;  5EF4 A;  1E4U A;  4OW0 A;  1U9V A;  4REZ A;  4CDF B;  4MSX A;  3IOQ A;  2HXZ A;  2AYN A;  4I7B A;  1KFX L;  2ECV A;  4YVA A;  1VJV A;  3PLW A;  3HCU A;  3IV2 A;  1N87 A;  3K8U A;  2FUI A;  1WEN A;  1AEC A;  3ASL A;  4GB0 A;  1AIM A;  2ATO A;  2HH5 A;  3IEJ A;  4AYC A;  5JA7 A;  1VSN A;  3HTK C;  4UP5 A;  5EGW A;  3RNV A;  1Z2Q A;  2RR4 A;  2KKY A;  2DJF B;  2R9O A;  2YRE A;  1DVP A;  4GNG A;  3KQI A;  4UP0 A;  2FUD A;  2VHF A;  2XU1 A;  3BWK A;  4V3K C;  5FER A;  2ARY A;  1F2C A;  2KKX A;  3ZPV 1;  5G04 B;  1Y08 A;  2OZ2 A;  1FP0 A;  3LRQ A;  4D8E A;  5CVM A;  4I07 A;  4V3L C;  2CIO A;  2E01 A;  4YAB A;  4QBB A;  3RVV A;  3M7K A;  5B76 A;  5B79 A;  4YAX A;  1K3B B;  3LXS A;  2L43 A;  1MS6 A;  1CHC A;  5D1L B;  4QF2 A;  5E6J A;  4PP1 A;  1IWD A;  2EA6 A;  2EGM A;  2L0B A;  4PPE A;  3WXF A;  1TL9 A;  2CT2 A;  1JQP A;  5FB0 A;  1MEG A;  2L7P A;  3RTR B;  1EWP A;  2M85 A;  3V6C A;  3O65 A;  2VJE B;  2LGL A;  2EOD A;  2KR4 A;  5H9M A;  4O64 A;  4AVX A;  4Z0O A;  3GL6 A;  2E61 A;  3U5M A;  2C2L A;  2KWK A;  2YU4 A;  5AIU A;  2PAD A;  1JM7 A;  2ECI A;  4ZQL A;  1MM3 A;  2EGP A;  2EXU A;  1CB5 A;  3PRP A;  4L7X A;  3O34 A;  1AU4 A;  2R9C A;  3O1G A;  3L1Z B;  4YAT A;  3D6S A;  4FJC A;  2Y6E A;  2K16 A;  5DKA A;  2YHN A;  2MA6 A;  2G8J A;  2FYE A;  4QRG A;  1U9X A;  2AS8 A;  4YC9 A;  4W5C A;  1X4J A;  2CRR A;  3KDE C;  2F6J A;  4W4U A;  2AN6 A;  3HCS A;  4LJN A;  3ZNI A;  3ZVZ B;  4A4C A;  4PTB A;  3L11 A;  2R9M A;  3C6W A;  5C11 A;  3DWD A;  4BOZ A;  4RKX A;  4YBM A;  2XOY A;  4BS5 A;  2LXH C;  3LVR E;  1MEM A;  1EWO A;  4N8W A;  2D8U A;  3P5X A;  3PUR A;  4XR7 A;  1NB5 A;  2LV9 A;  4PT5 A;  4QQ4 A;  2VPD A;  4N4Z A;  2J7Q C;  5K3Q A;  3SOX A;  2G45 A;  1WEP A;  2YQL A;  3N9M A;  4CDC B;  1O0E A;  2JQF R;  3PW3 A;  4D8B A;  4XZX A;  1NL6 A;  2KWO A;  1PIP A;  2YVR A;  5AIT A;  3BBA A;  3TNX A;  5FB1 A;  2YJ8 A;  2XOC A;  4I7D A;  4R2Y A;  3MTV A;  3FAO A;  3QSD A;  1WEE A;  1CS8 A;  2OXQ C;  4MM3 B;  4MI7 A;  5TAB A;  1NLJ A;  5KH3 A;  2YJB A;  3PDF A;  2DX8 A;  5LKZ A;  1MIR A;  2H0D A;  2CSZ A;  3FEH A;  5J3X A;  3QZV A;  1XWH A;  1EWM A;  2B0O E;  2L80 A;  2YSJ A;  5A24 A;  2JMI A;  2LXP C;  2NQI A;  1WGM A;  2FFW A;  4PP2 E;  3W31 A;  4CDE B;  3EB5 A;  2Y1M A;  1WEU A;  2D8S A;  3IMA A;  2MA5 A;  1GMY A;  1WFK A;  2AUX A;  4X6J A;  4FK5 A;  1PBH A;  2FT2 A;  2MD7 B;  3NHE A;  2B1M A;  5LKT A;  2K1J A;  3WXE A;  3SOW A;  4RY2 A;  5EZQ A;  2KWJ A;  3V43 A;  1ICF A;  4ZDT A;  4R7E A;  2DC8 A;  3KV6 A;  3B79 A;  2DSM A;  1ZBD B;  2ECN A;  1HYI A;  1U5I A;  1BQI A;  2P0R A;  4A49 A;  3MJ5 A;  2AIM A;  2DCC A;  4YYW A;  2HHN A;  5B75 A;  1YVB A;  3HWN A;  3E9S A;  4LAD B;  2DC6 A;  5G0F A;  2H7J A;  1DKI A;  2ECT A;  2H0D B;  3C9E A;  2MKE A;  2E03 A;  2MUM A;  3HHI A;  2VJE A;  4A0C D;  1MM2 A;  4TKP B;  2R6N A;  1PXV A;  1A6R A;  2BDZ A;  4XI1 A;  1KHQ A;  1F62 A;  1PPO A;  5LKX A;  5TDW A;  3USV A;  9PAP A;  1YAL A;  3LQJ A;  3IUT A;  2QIZ A;  3LVQ E;  2KYU A;  3T7L A;  1GEC E;  1QDQ A;  4HXD B;  2R9F A;  3ERV A;  3QT4 A;  2F6N A;  3PBH A;  2B1N A;  4WUR A;  2XU4 A;  1M6D A;  2G8E A;  4BBQ A;  4L58 A;  3EB6 A;  2XU5 A;  2XOZ A;  1AU2 A;  5SVI A;  5H1V A;  4R8P K;  3OQC A;  2FD4 A;  3KFQ A;  2NAA A;  3SOU A;  2QJ0 A;  2KE1 A;  1DEU A;  2AYO A;  4AP4 A;  2NQA A;  4M0W A;  2F42 A;  1MDW A;  2YYR A;  2VNF A;  4I7C A;  2K4D A;  3M63 A;  5CHV A;  2DOS A;  2F7D A;  2NQG A;  3BC3 A;  2LGK A;  3N9O A;  4WZ2 A;  1WES A;  3KKU A;  5PAD A;  4PI3 A;  3U8E A;  3ZTG A;  1BOR A;  1F2B A;  4N3W A;  3FJU B;  3WXG A;  5KH9 A;  3K9M A;  5TRB A;  5CVO B;  2QIC A;  2ZET C;  1WEO A;  1WIM A;  2M6M A;  5I3L A;  3P5U A;  2ECW A;  3N4C A;  2XB1 A;  2GHU A;  2FTD A;  2PBH A;  1SP4 B;  2IPP B;  1CQD A;  2E02 A;  2J7Q A;  2BAY A;  1PPD A;  4LK9 A;  3BY4 A;  5CHT A;  5FEY A;  5SVI B;  5LCW B;  4BHW A;  1U9Q X;  1NB3 A;  3OF9 A;  1X4U A;  2BU3 A;  4GUA A;  2VJF B;  2YUC A;  4QH6 A;  1FH0 A;  2YHO A;  3O7A A;  2KGI A;  5D1K B;  2PRE A;  4MZS A;  5KH7 A;  3O36 A;  3ZYQ A;  5KO3 A;  3CH3 X;  3JUE A;  4BOP A;  2HWK A;  2YJC A;  2L5U A;  1DCQ A;  4YYQ A;  1HYJ A;  3O35 A;  4HWY A;  3IHP A;  1QMY A;  2K17 A;  5CVN B;  3FL2 A;  3PRM A;  2CON A;  3AI8 A;  1MBM A;  1KXR A;  5G05 B;  2KWN A;  2IDA A;  2GFO A;  5SVY A;  3K24 A;  2YQM A;  3O0U A;  5B8D A;  2CB5 A;  4OEL A;  5FPW A;  1WEQ A;  5JZE A;  3KWB X;  4WZ3 B;  1YZB A;  3BPF A;  3OIS A;  2CKL A;  3SHB A;  2YSM A;  2LN0 A;  1CVZ A;  3BCN A;  4YYR A;  2C0Y A;  3U5N A;  1ATK A;  1ZIV A;  3HD3 A;  1BGO A;  1CTE A;  1GLO A;  2RSD A;  1YK7 A;  2JRI A;  1AYV A;  1KHP A;  4BOQ A;  2G43 A;  2Z84 A;  3P5W A;  2PNS A;  4I05 A;  2JUN A;  3KSE A;  4F52 B;  1AYU A;  4N79 A;  2DZZ A;  1WE9 A;  3I06 A;  2OUL A;  3H8B A;  4OVZ A;  3Q1D A;  2O6X A;  1V87 A;  3N9N A;  4B7Y C;  4Q8G A;  4RNA A;  2FRQ A;  1EWL A;  5B77 A;  3KV5 A;  1GCB A;  4GNE A;  3PT2 A;  2LGG A;  1UKF A;  1WEW A;  4C9Z A;  3H8C A;  2YT5 A;  4FIP A;  4NN2 A;  3HCT A;  2JQG R;  3M99 A;  2Y1N A;  1XKG A;  2AVW A;  2BTW A;  2CKL B;  3RVX A;  4DMY A;  1PPN A;  3I2D A;  4CCG X;  1CJL A;  5J94 A;  1Q6K A;  1K2F A;  2IQJ A;  1STF E;  4GND A;  3O70 A;  1PE6 A;  2VP7 A;  2G6D A;  1PAD A;  4QF3 A;  2OP3 A;  1X4I A;  4FO9 A;  4GNF A;  4YYU A;  2R9N A;  4DMX A;  8PCH A;  2JM3 A;  4ZUX U;  3KX1 A;  4OVZ B;  1QXP A;  3B21 A;  1WEM A;  3PHX A;  2YJ2 A;  3L1X A;  1PCI A;  3ZUA A;  1ZCM A;  1PPP A;  2IBI A;  2RI7 A;  5TBN A;  3MP2 A;  1AYW A;  2I50 A;  3QJ3 A;  4A5U A;  2WBF X;  1NQC A;  3U5P A;  3H7D A;  1ME3 A;  1LDJ B;  4YV8 A;  2ECG A;  2FUU A;  1BY8 A;  1YT7 A;  4P5O B;  3N3K A;  2FO5 A;  2BTW B;  4P6G A;  2KGG A;  2VPB A;  3T6R A;  4YYS A;  3MHH A;  1AU0 A;  2E00 A;  3KWZ A;  2KU3 A;  4IC3 A;  5H1U A;  3DQV R;  1Y4H A;  1FBV A;  2XP0 A;  3N9L A;  5JH3 A;  2MD8 C;  4O62 A;  3U5O A;  4R3D A;  3T9K A;  4D8I A;  3DDT A;  1F2A A;  3P5V A;  1THE A;  3OVZ A;  2LGV A;  3TMP A;  2VJF A;  3M62 A;  2KFT A;  5H1T A;  3H6S A;  4QRX A;  2PNX A;  4OGC A;  3PHU A;  3DF0 A;  4YYV A;  3HHA A;  5F02 A;  1LDK C;  2KIZ A;  3CBK A;  3O37 A;  2UZG A;  2DC9 A;  3IFU A;  2DZY A;  3LQH A;  4BOU A;  1Z60 A;  5SVX A;  4AXM A;  3LQI A;  4PAD A;  4RF1 A;  2M13 A;  2MNZ A;  5B78 A;  4RF0 A;  2G6Q A;  3FAN A;  5EYA F;  3SUB A;  1Z6U A;  2JMD A;  2HYE D;  2CSV A;  2JTC A;  4P16 A;  4Q8H A;  3LDY A;  3O33 A;  2DC7 A;  2FE8 A;  2AGA A;  4KLB A;  2LRI C;  4AYC B;  2P86 A;  4S3O B;  2E6R A;  4G54 A;  1NPZ A;  3MDB C;  2MT5 A;  4IC2 A;  4Q6F A;  5K16 A;  3H7H A;  4S3O C;  7PCK A;  1POP A;  3F5V A;  4QRV A;  3PUQ A;  5TDR A;  1KFU L;  2JRJ A;  2AUZ A;  2LAU A;  1EF7 A;  2FQ9 A;  2HDP A;  4LLB A;  2FSA A;  4WA6 A;  2HD5 A;  5EZS A;  1F29 A;  2P7U A;  4BQV A;  2NQD B;  2CSY A;  4X3G A;  2DCD A;  3MTN A;  3ZVY A;  4WZ0 A;  2Y43 A;  3E2D A;  2FRA A; 
#chains in the Genus database with same CATH homology
 3F75 A;  1U9W A;  3DPL R;  1RMD A;  2VPE A;  3LFY A;  1AU3 A;  3OVX A;  4OEM A;  2DCB A;  2YUR A;  3PHD A;  5D1M B;  5JG6 A;  2DJG B;  4XUI A;  1SNK A;  1WIL A;  5C13 A;  4BPV A;  2LDR A;  2MNY A;  3N3G A;  4LKA A;  3H89 A;  4YAD A;  3I3T A;  2MIQ A;  2Y5B A;  6PAD A;  3GV4 A;  2F1G A;  2YW8 A;  4K7C A;  1JM7 B;  2KRE A;  4UI9 B;  4CA1 A;  4X6H A;  4AUQ B;  3GCB A;  3V6E A;  4I04 A;  2VHS A;  2BDL A;  3MHS A;  1IYM A;  4P6E A;  2M3H A;  1MHW A;  3BPM A;  1VYX A;  3KW9 A;  1ME4 A;  4CZW A;  2ECJ A;  1DF0 A;  2ACT A;  1TU6 A;  4X6I A;  1TLO A;  3E1Z B;  4B86 C;  1JOC A;  4MVT A;  4A4B A;  3PNR A;  4CDD B;  4YBS A;  1CV8 A;  4AXL A;  4BSQ A;  3BOW A;  2C2V S;  2JMJ A;  4N4F A;  2L75 A;  1S4V A;  1HUC B;  3S3R A;  1CSB B;  1QOL A;  3MOR A;  3VK6 A;  3RVW A;  1CPJ A;  3S3Q A;  4MZO A;  4W5B A;  2XU3 A;  3C5K A;  1VD4 A;  2XEU A;  1BP4 A;  1YK8 A;  3NG2 A;  2PUY A;  5DIN A;  2G7Y A;  5LKU A;  1T1H A;  2M1R A;  2DCA A;  1VFY A;  2VPG A;  3N9P A;  1G25 A;  2E6S A;  2YJ9 A;  1ITO A;  3CBJ A;  1WEV A;  1U6G B;  3N9Q A;  3KNV A;  1X9Y A;  4YBT A;  2LQ6 A;  3RPG B;  3CH2 X;  3ZPV E;  2AU1 A;  4BS6 A;  3RPG C;  3OF8 A;  4C5P A;  5EF4 A;  1E4U A;  1U9V A;  4CDF B;  4MSX A;  3IOQ A;  2HXZ A;  2AYN A;  4I7B A;  1KFX L;  2ECV A;  4YVA A;  1VJV A;  3HCU A;  3IV2 A;  1N87 A;  3K8U A;  2FUI A;  1WEN A;  1AEC A;  3ASL A;  4GB0 A;  1AIM A;  2ATO A;  2HH5 A;  3IEJ A;  4AYC A;  5JA7 A;  1VSN A;  3HTK C;  4UP5 A;  5EGW A;  1Z2Q A;  2DJF B;  2R9O A;  4UP0 A;  2YRE A;  1DVP A;  3KQI A;  4GNG A;  2FUD A;  2VHF A;  2XU1 A;  3BWK A;  4V3K C;  5FER A;  2ARY A;  1F2C A;  3ZPV 1;  5G04 B;  1Y08 A;  2OZ2 A;  1FP0 A;  3LRQ A;  5CVM A;  4I07 A;  4V3L C;  2CIO A;  2E01 A;  4YAB A;  4QBB A;  3RVV A;  5B76 A;  5B79 A;  4YAX A;  1K3B B;  3LXS A;  2L43 A;  1MS6 A;  1CHC A;  5D1L B;  4QF2 A;  4PP1 A;  1IWD A;  2EA6 A;  2L0B A;  4PPE A;  3WXF A;  1TL9 A;  2CT2 A;  1JQP A;  5FB0 A;  1MEG A;  3RTR B;  1EWP A;  2M85 A;  3V6C A;  2VJE B;  2LGL A;  2EOD A;  2KR4 A;  5H9M A;  4O64 A;  4AVX A;  3GL6 A;  3U5M A;  2C2L A;  2KWK A;  2YU4 A;  5AIU A;  2PAD A;  1JM7 A;  2ECI A;  4ZQL A;  1MM3 A;  2EGP A;  1CB5 A;  4L7X A;  3O34 A;  1AU4 A;  2R9C A;  3O1G A;  3L1Z B;  4YAT A;  3D6S A;  4FJC A;  2Y6E A;  2K16 A;  5DKA A;  2YHN A;  2MA6 A;  2G8J A;  2FYE A;  4QRG A;  1U9X A;  2AS8 A;  4YC9 A;  4W5C A;  4GUZ A;  1X4J A;  2F6J A;  4W4U A;  2AN6 A;  3HCS A;  4LJN A;  3ZNI A;  3ZVZ B;  4A4C A;  4PTB A;  3L11 A;  2R9M A;  3C6W A;  5C11 A;  4YBM A;  4BS5 A;  2LXH C;  1W5R A;  1MEM A;  1EWO A;  4N8W A;  3P5X A;  3PUR A;  4XR7 A;  1NB5 A;  2LV9 A;  2VPD A;  4N4Z A;  3SOX A;  2G45 A;  1WEP A;  2YQL A;  3N9M A;  4CDC B;  1O0E A;  2JQF R;  3PW3 A;  2BSZ A;  1NL6 A;  2KWO A;  1PIP A;  5AIT A;  3TNX A;  5FB1 A;  2YJ8 A;  4I7D A;  4R2Y A;  3QSD A;  1WEE A;  1CS8 A;  2OXQ C;  5TAB A;  4NV8 A;  1NLJ A;  5KH3 A;  2YJB A;  3PDF A;  2DX8 A;  5LKZ A;  1MIR A;  2H0D A;  2CSZ A;  5J3X A;  3QZV A;  1XWH A;  1EWM A;  2L80 A;  2YSJ A;  5A24 A;  2JMI A;  2LXP C;  2NQI A;  1WGM A;  4CDE B;  4PP2 E;  3EB5 A;  2Y1M A;  1WEU A;  2D8S A;  3IMA A;  2MA5 A;  1GMY A;  1WFK A;  2AUX A;  4X6J A;  4FK5 A;  1PBH A;  2FT2 A;  2MD7 B;  3NHE A;  1W4T A;  2B1M A;  5LKT A;  2K1J A;  3WXE A;  3SOW A;  4RY2 A;  2KWJ A;  3V43 A;  1ICF A;  4ZDT A;  4R7E A;  2DC8 A;  3KV6 A;  3B79 A;  1ZBD B;  2ECN A;  1HYI A;  1U5I A;  1BQI A;  2P0R A;  4A49 A;  2AIM A;  2DCC A;  4YYW A;  2HHN A;  5B75 A;  1YVB A;  3HWN A;  4LAD B;  2DC6 A;  5G0F A;  2H7J A;  2ECT A;  2H0D B;  3C9E A;  2E03 A;  2MUM A;  3HHI A;  2VJE A;  4A0C D;  1MM2 A;  4TKP B;  2R6N A;  1PXV A;  1A6R A;  2BDZ A;  4XI1 A;  1KHQ A;  1F62 A;  1PPO A;  5LKX A;  5TDW A;  3USV A;  9PAP A;  1YAL A;  3LQJ A;  3IUT A;  2QIZ A;  3T7L A;  2KYU A;  1GEC E;  1QDQ A;  2R9F A;  3ERV A;  3QT4 A;  2F6N A;  3PBH A;  2B1N A;  2XU4 A;  1M6D A;  2G8E A;  4BBQ A;  4L58 A;  3EB6 A;  2XU5 A;  1AU2 A;  5H1V A;  4R8P K;  3KFQ A;  2NAA A;  3SOU A;  2QJ0 A;  2KE1 A;  1DEU A;  2AYO A;  4AP4 A;  2NQA A;  2F42 A;  1MDW A;  2YYR A;  2VNF A;  4I7C A;  2K4D A;  3M63 A;  5CHV A;  2F7D A;  2NQG A;  3BC3 A;  2LGK A;  3N9O A;  4WZ2 A;  1WES A;  3KKU A;  5PAD A;  4PI3 A;  3U8E A;  3ZTG A;  1BOR A;  1F2B A;  4B55 A;  4N3W A;  3WXG A;  5KH9 A;  3K9M A;  5TRB A;  5CVO B;  2QIC A;  2ZET C;  1WEO A;  1WIM A;  2M6M A;  5I3L A;  3P5U A;  2ECW A;  3N4C A;  2XB1 A;  2GHU A;  2FTD A;  2PBH A;  1SP4 B;  2IPP B;  1CQD A;  2E02 A;  2BAY A;  1PPD A;  4LK9 A;  5CHT A;  5FEY A;  5LCW B;  4BHW A;  1U9Q X;  1NB3 A;  3OF9 A;  1X4U A;  2VJF B;  2YUC A;  4QH6 A;  1FH0 A;  2YHO A;  3O7A A;  2KGI A;  5D1K B;  2PRE A;  4MZS A;  5KH7 A;  3O36 A;  3ZYQ A;  3CH3 X;  2YJC A;  2L5U A;  4YYQ A;  1HYJ A;  3O35 A;  3D9W A;  4HWY A;  2VFC A;  3IHP A;  1QMY A;  2K17 A;  5CVN B;  3FL2 A;  3AI8 A;  1KXR A;  5G05 B;  2KWN A;  2IDA A;  2GFO A;  3K24 A;  5FPW A;  2YQM A;  3O0U A;  5B8D A;  2CB5 A;  4OEL A;  1WEQ A;  3KWB X;  4WZ3 B;  3BPF A;  3OIS A;  2CKL A;  3SHB A;  2YSM A;  2LN0 A;  1CVZ A;  3BCN A;  4YYR A;  2C0Y A;  3U5N A;  1ATK A;  1ZIV A;  3HD3 A;  1BGO A;  1CTE A;  1GLO A;  1GX3 A;  2RSD A;  1YK7 A;  1AYV A;  1KHP A;  2G43 A;  3P5W A;  2PNS A;  4I05 A;  3KSE A;  4F52 B;  1AYU A;  4N79 A;  2DZZ A;  1WE9 A;  3I06 A;  2OUL A;  3H8B A;  2O6X A;  1V87 A;  3N9N A;  4B7Y C;  4Q8G A;  2FRQ A;  1EWL A;  5B77 A;  3KV5 A;  1GCB A;  4GNE A;  2LGG A;  1WEW A;  4C9Z A;  3H8C A;  2YT5 A;  4FIP A;  4NN2 A;  3HCT A;  2JQG R;  3M99 A;  2Y1N A;  1XKG A;  2AVW A;  2CKL B;  3RVX A;  4DMY A;  1PPN A;  3I2D A;  4CCG X;  1CJL A;  5J94 A;  1Q6K A;  1K2F A;  1STF E;  4GND A;  3O70 A;  1PE6 A;  2VP7 A;  2G6D A;  1PAD A;  4QF3 A;  2OP3 A;  2VFB A;  1X4I A;  4FO9 A;  4GNF A;  4YYU A;  2R9N A;  4DMX A;  8PCH A;  4ZUX U;  3KX1 A;  1QXP A;  1WEM A;  2YJ2 A;  3L1X A;  1PCI A;  3ZUA A;  1ZCM A;  1PPP A;  2IBI A;  2RI7 A;  5TBN A;  1AYW A;  2I50 A;  3QJ3 A;  2WBF X;  1NQC A;  3U5P A;  3H7D A;  1ME3 A;  3LTW A;  1LDJ B;  4YV8 A;  2ECG A;  2FUU A;  1BY8 A;  1YT7 A;  4P5O B;  3N3K A;  2FO5 A;  4P6G A;  2KGG A;  2VPB A;  3T6R A;  4YYS A;  3MHH A;  1AU0 A;  2E00 A;  3KWZ A;  2KU3 A;  4IC3 A;  5H1U A;  3DQV R;  1Y4H A;  1FBV A;  3N9L A;  5JH3 A;  2MD8 C;  3U5O A;  1F2A A;  3P5V A;  1THE A;  3OVZ A;  2LGV A;  2VJF A;  3M62 A;  2KFT A;  5H1T A;  3H6S A;  4QRX A;  2PNX A;  3DF0 A;  4YYV A;  3HHA A;  5F02 A;  1LDK C;  2KIZ A;  3CBK A;  3O37 A;  2UZG A;  2DC9 A;  2DZY A;  3LQH A;  1E2T A;  1Z60 A;  4AXM A;  3LQI A;  4PAD A;  2MNZ A;  5B78 A;  4BGF A;  2G6Q A;  5EYA F;  1Z6U A;  2JMD A;  2HYE D;  4Q8H A;  3O33 A;  2DC7 A;  4KLB A;  2LRI C;  4AYC B;  2P86 A;  4S3O B;  2E6R A;  4G54 A;  1NPZ A;  2MT5 A;  4IC2 A;  4Q6F A;  1W6F A;  5K16 A;  4S3O C;  7PCK A;  1POP A;  3F5V A;  4NV7 A;  4QRV A;  3PUQ A;  5TDR A;  1KFU L;  2JRJ A;  2AUZ A;  1EF7 A;  2FQ9 A;  2HDP A;  4LLB A;  2FSA A;  4WA6 A;  2HD5 A;  1F29 A;  2P7U A;  4BQV A;  2NQD B;  2CSY A;  4X3G A;  2DCD A;  3MTN A;  3ZVY A;  4WZ0 A;  2Y43 A;  2FRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...