1ME4A

High resolution crystal structure analysis of cruzain non-covalently bound to a hydroxymethyl ketone inhibitor (i)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CRUZIPAIN
publication title Crystal Structures of Reversible Ketone-based Inhibitors of the Cysteine Protease Cruzain
pubmed doi rcsb
source organism Trypanosoma cruzi
total genus 62
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2002-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1me4A00
4QH6A 4PP1A 1BP4A 1U9VA 4BS5A 2YJ2A 3K8UA 1QMYA 3BWKA 3KSEA 2B1NA 2NQDB 1EF7A 1O0EA 4PP2E 2DC6A 4BPVA 4W5BA 4P6EA 2E03A 4FIPA 3BPFA 1EWPA 1PBHA 2PREA 1PPDA 1DF0A 3LFYA 1QDQA 1AIMA 1AU0A 3IUTA 2JQGR 1STFE 3K24A 2P0RA 1NL6A 4OELA 1BGOA 2XU1A 3P5VA 2GFOA 3AI8A 4DMXA 1F2AA 3IHPA 1NB5A 3F75A 4FJCA 3N3KA 2FRQA 3OVZA 4MZOA 4X6IA 3IMAA 1ME3A 2ACTA 1VJVA 4Q8GA 1U9XA 1ZIVA 2XU4A 1TU6A 2DCCA 4CZWA 1GMYA 2YJBA 3N4CA 5EF4A 4YYQA 2YJCA 1MEGA 4YV8A 1PXVA 1CSBB 3H89A 1TLOA 4ZUXU 3OISA 2G7YA 1IWDA 2G6DA 4N8WA 1CS8A 2O6XA 1BY8A 2NQGA 3PNRA 2FUDA 2DZYA 3V6CA 1YVBA 3KFQA 4X6HA 1EWMA 3I3TA 8PCHA 1Y08A 1MS6A 1ITOA 3V6EA 2VHFA 1AU4A 4XUIA 1U9QX 5CHTA 2HXZA 2PBHA 2CIOA 2PADA 4MSXA 2R9FA 4G54A 3BC3A 4RY2A 2Y5BA 2BDZA 1A6RA 1THEA 3O1GA 1PIPA 2FYEA 1PCIA 2XU5A 4I04A 1NPZA 1CTEA 3E1ZB 5F02A 3IV2A 3OF8A 3S3QA 3F5VA 2R9MA 1ATKA 4QRXA 2F1GA 5FPWA 2FQ9A 3NHEA 2HD5A 1PPPA 3M99A 7PCKA 4QBBA 3OVXA 3BCNA 3QJ3A 1PPNA 2JQFR 2C0YA 1TL9A 3CH3X 3H8CA 3S3RA 1KHQA 4BS6A 1YT7A 3KWBX 1AU3A 1KFUL 3PDFA 1ZCMA 2OULA 2DC9A 5PADA 3RVXA 3ZUAA 1U9WA 1AECA 3CBKA 1K3BB 4AXLA 1U5IA 4YYSA 4QRVA 2ATOA 4N4ZA 4MZSA 1QOLA 9PAPA 1AYUA 4DMYA 2F7DA 1S4VA 5CVOB 3GCBA 1NB3A 4YYRA 2E01A 2HH5A 2GHUA 3D6SA 5J94A 3CBJA 4YVAA 1CJLA 2XU3A 2R9OA 2FRAA 3H6SA 3KW9A 4CDCB 3U8EA 5A24A 2DC8A 2WBFX 3P5XA 3PW3A 1SNKA 1HUCB 1PE6A 2CB5A 2AUZA 3WXEA 3ERVA 3TNXA 2DCBA 2AUXA 4W5CA 3OF9A 1AYVA 1F29A 1CB5A 1BQIA 1GECE 3IEJA 2PNSA 2YJ9A 2NQAA 2ARYA 3HWNA 4AXMA 4CDEB 4PADA 1EWOA 5CVNB 1KHPA 1XKGA 3I06A 3LXSA 1JQPA 5JH3A 3CH2X 1POPA 2OP3A 2E02A 4OEMA 4YYUA 1MDWA 4XR7A 5CHVA 2R9CA 1QXPA 5CVMA 2AVWA 3H8BA 1CVZA 3KWZA 2IPPB 4PI3A 4W4UA 4I07A 2FT2A 1FH0A 3B79A 4K7CA 2DCAA 1M6DA 4N79A 2VHSA 3IOQA 4BSQA 2HHNA 3P5UA 3QSDA 2IBIA 1X9YA 2R6NA 3PBHA 1SP4B 1YK8A 3RVWA 2DJFB 2AIMA 4Q8HA 4CDFB 3RVVA 2AYOA 2BDLA 2DCDA 3K9MA 2AYNA 2DJGB 2P7UA 2G8EA 3H7DA 1F2BA 3MORA 3MTNA 1AU2A 3P5WA 1ICFA 1F2CA 2OZ2A 3MHSA 6PADA 2Y6EA 3USVA 1PPOA 3KX1A 2B1MA 1AYWA 4QRGA 3MHHA 1PADA 1CPJA 2FO5A 1ME4A 1GLOA 1VSNA 3BPMA 2DZZA 1GCBA 1MEMA 5EGWA 2R9NA 3C9EA 4CDDB 3WXGA 1MIRA 4P6GA 3HHAA 2NQIA 4I05A 4WA6A 1YALA 1KFXL 1KXRA 1CQDA 3N3GA 1YK7A 1NQCA 4X6JA 4YYVA 4KLBA 3KKUA 2DC7A 3HHIA 2AS8A 3BOWA 1DEUA 2P86A 4HWYA 1NLJA 2E00A 1EWLA 3WXFA 2G8JA 5JA7A 3HD3A 4BQVA 4YYWA 1MHWA 2YJ8A 3QT4A 1Y4HA 3DF0A 3O0UA 4FK5A 1Q6KA 2FTDA 2H7JA 1CV8A 2AU1A 5K16A
chains in the Genus database with same CATH superfamily
4QH6A 4A5UA 4PP1A 1BP4A 1U9VA 3PRPA 4BS5A 4RF0A 2YJ2A 3K8UA 1QMYA 3BWKA 3KSEA 2B1NA 2NQDB 1EF7A 1O0EA 4OVZB 3PRMA 4PP2E 2DC6A 4BPVA 4W5BA 4P6EA 2E03A 4FIPA 4PT5A 3BPFA 1EWPA 1PBHA 2PREA 1PPDA 1DF0A 3LFYA 1QDQA 1AIMA 1AU0A 3IUTA 2JQGR 1STFE 3K24A 2P0RA 1NL6A 4OELA 1BGOA 2XU1A 3P5VA 2GFOA 3AI8A 3W30A 4DMXA 1F2AA 3IHPA 3RNVA 1NB5A 3F75A 4FJCA 3N3KA 2FRQA 4XZXA 3OVZA 4MZOA 4X6IA 3IMAA 1ME3A 2ACTA 1VJVA 4Q8GA 1U9XA 2FE8A 3OQCA 1ZIVA 2XU4A 1TU6A 2BU3A 2DCCA 4CZWA 1GMYA 2YJBA 3N4CA 5EF4A 4YYQA 2YJCA 1MEGA 4YV8A 4IP3A 4R3DA 1PXVA 1CSBB 2J7QA 3PHWA 3H89A 1TLOA 4ZUXU 3OISA 3PT2A 1UKFA 2G7YA 5E6JA 1IWDA 2G6DA 4N8WA 1CS8A 2O6XA 1BY8A 2NQGA 3PNRA 2FUDA 2JTCA 2DZYA 4IUMA 3V6CA 1YVBA 3KFQA 4X6HA 1EWMA 3I3TA 8PCHA 1Y08A 1MS6A 1ITOA 3V6EA 2VHFA 4D8EA 1AU4A 4XUIA 1U9QX 2UZJA 5CHTA 2HXZA 2PBHA 2CIOA 1PVJA 2PADA 4MSXA 2R9FA 3MJ5A 4G54A 3BC3A 4RY2A 2Y5BA 2BDZA 1A6RA 1THEA 3O1GA 1PIPA 2FYEA 1PCIA 2XU5A 4I04A 1NPZA 1CTEA 3E1ZB 5F02A 3IV2A 3BY4A 3OF8A 3S3QA 3F5VA 2R9MA 1ATKA 4QRXA 2F1GA 5FPWA 2FQ9A 3NHEA 2J7QC 2HD5A 1PPPA 3M99A 4P16A 7PCKA 4QBBA 3OVXA 3BCNA 3QJ3A 1PPNA 2JQFR 2C0YA 1TL9A 3CH3X 3H8CA 5JZEA 2DOSA 3S3RA 1KHQA 4BS6A 1YT7A 3KWBX 1AU3A 3W31A 1KFUL 3PDFA 2BTWA 1ZCMA 4RF1A 2OULA 2DC9A 5PADA 4M0WA 3RVXA 3ZUAA 3PHUA 1U9WA 1AECA 3CBKA 1K3BB 4AXLA 1U5IA 4YYSA 4QRVA 4MI7A 5KO3A 2ATOA 4N4ZA 4MZSA 1QOLA 9PAPA 1AYUA 4DMYA 3MTVA 2F7DA 1S4VA 5CVOB 3GCBA 1NB3A 2AGAA 4YYRA 4GUAA 2E01A 2HH5A 2GHUA 3D6SA 5EZSA 5J94A 3CBJA 4YVAA 1CJLA 2XU3A 2R9OA 2FRAA 3H6SA 4BOUA 3KW9A 4CDCB 3U8EA 5A24A 4BOQA 2DC8A 2WBFX 3P5XA 3PW3A 1SNKA 1HUCB 1PE6A 2CB5A 2AUZA 3WXEA 4D8IA 3ERVA 3TNXA 2DCBA 2AUXA 4HXDB 3MP2A 4W5CA 3OF9A 1AYVA 1F29A 4REZA 1CB5A 3C0RA 3IFUA 1BQIA 1GECE 3IEJA 4BOZA 3PSEA 2PNSA 2YJ9A 4OVZA 2NQAA 2ARYA 2JRIA 3HWNA 4AXMA 4CDEB 4PADA 4BOPA 1EWOA 5CVNB 1KHPA 1XKGA 3I06A 3LXSA 4RNAA 1JQPA 1DKIA 5JH3A 3CH2X 1POPA 2OP3A 2E02A 4OEMA 4YYUA 1MDWA 4WURA 4XR7A 5CHVA 2R9CA 1QXPA 5CVMA 2AVWA 3H8BA 1CVZA 3KWZA 2IPPB 4PI3A 4W4UA 4I07A 3TRKA 2FT2A 1FH0A 3B79A 4K7CA 2DCAA 3TMPA 1M6DA 4N79A 2VHSA 3B21A 3IOQA 4BSQA 2HHNA 3P5UA 3QSDA 2IBIA 1X9YA 2R6NA 3PBHA 1SP4B 1YK8A 3O65A 3RVWA 2DJFB 2AIMA 4Q8HA 4CDFB 3RVVA 2AYOA 2BDLA 2DCDA 3K9MA 2HWKA 2AYNA 3BBAA 2DJGB 2P7UA 2Z84A 2G8EA 3E9SA 4BOSA 3H7DA 1F2BA 3MORA 3MTNA 1AU2A 3P5WA 1ICFA 1F2CA 2OZ2A 3ZNHA 3MHSA 6PADA 2Y6EA 3USVA 1PPOA 3PHXA 3KX1A 2B1MA 1AYWA 4QRGA 3MHHA 1PADA 1CPJA 2FO5A 1ME4A 1GLOA 2BTWB 1VSNA 3BPMA 2DZZA 1GCBA 1MEMA 5EGWA 2R9NA 3C9EA 4CDDB 3WXGA 1MIRA 4P6GA 3HHAA 5EZQA 2NQIA 4I05A 4WA6A 1YALA 1KFXL 1KXRA 1CQDA 3N3GA 1YK7A 1NQCA 4X6JA 4YYVA 4KLBA 3KKUA 2DC7A 3HHIA 2AS8A 3BOWA 4MM3B 1DEUA 2P86A 4HWYA 1NLJA 4D8BA 2E00A 1EWLA 3WXFA 2G8JA 5JA7A 3HD3A 4RKXA 4BQVA 4YYWA 1MHWA 2YJ8A 3QT4A 4OW0A 4ZTBA 3BB7A 1Y4HA 3DF0A 3O0UA 4FK5A 1YZBA 1Q6KA 2FTDA 2H7JA 1CV8A 2AU1A 5K16A
chains in the Genus database with same CATH topology
4QH6A 4PP1A 1BP4A 1U9VA 4BS5A 2YJ2A 3K8UA 1QMYA 3BWKA 3KSEA 2B1NA 2NQDB 1EF7A 1O0EA 4PP2E 2DC6A 4BPVA 4W5BA 4P6EA 2E03A 4FIPA 3BPFA 1EWPA 1PBHA 2PREA 1PPDA 1DF0A 3LFYA 1QDQA 4NV8A 1AIMA 1AU0A 3IUTA 2JQGR 1STFE 3K24A 2P0RA 1NL6A 4OELA 1BGOA 2XU1A 3P5VA 2GFOA 3AI8A 4DMXA 1F2AA 3IHPA 1NB5A 3F75A 4FJCA 3N3KA 2FRQA 3OVZA 4MZOA 4X6IA 3IMAA 1ME3A 2ACTA 1VJVA 4Q8GA 1U9XA 1ZIVA 2XU4A 1TU6A 2DCCA 4CZWA 1GMYA 2YJBA 3N4CA 5EF4A 4YYQA 2YJCA 1MEGA 4YV8A 1PXVA 1CSBB 3H89A 1TLOA 4ZUXU 3OISA 3LTWA 2G7YA 1IWDA 2G6DA 4N8WA 2BSZA 1CS8A 2O6XA 1BY8A 2NQGA 3PNRA 2FUDA 1W4TA 2DZYA 3V6CA 1YVBA 3KFQA 4X6HA 1EWMA 3I3TA 8PCHA 1Y08A 1MS6A 1ITOA 3V6EA 2VHFA 1AU4A 4XUIA 1U9QX 5CHTA 2HXZA 4B55A 2PBHA 2CIOA 2PADA 4MSXA 2R9FA 4G54A 3BC3A 4RY2A 2Y5BA 2BDZA 1A6RA 1THEA 3O1GA 1PIPA 2FYEA 1PCIA 4BGFA 2XU5A 4I04A 1NPZA 1CTEA 3E1ZB 5F02A 3IV2A 3OF8A 3S3QA 3F5VA 2R9MA 1ATKA 4QRXA 2F1GA 5FPWA 2FQ9A 3NHEA 2HD5A 1PPPA 3M99A 7PCKA 4QBBA 3OVXA 3BCNA 3QJ3A 1E2TA 1PPNA 2JQFR 2C0YA 1TL9A 3CH3X 3H8CA 3S3RA 1KHQA 4BS6A 1YT7A 3KWBX 2VFBA 1AU3A 1KFUL 3PDFA 1ZCMA 2OULA 2DC9A 5PADA 3RVXA 3ZUAA 1U9WA 1AECA 3CBKA 1K3BB 4AXLA 1U5IA 4YYSA 4QRVA 2ATOA 4N4ZA 4MZSA 1QOLA 9PAPA 1AYUA 4DMYA 2F7DA 1S4VA 5CVOB 3GCBA 1NB3A 4YYRA 2E01A 2HH5A 2GHUA 3D6SA 5J94A 3D9WA 3CBJA 4YVAA 1CJLA 2XU3A 2R9OA 2FRAA 3H6SA 3KW9A 4CDCB 3U8EA 5A24A 2DC8A 2WBFX 3P5XA 3PW3A 1SNKA 1HUCB 1PE6A 2CB5A 2AUZA 3WXEA 3ERVA 3TNXA 2DCBA 2AUXA 4W5CA 3OF9A 1AYVA 1F29A 1CB5A 1BQIA 1GECE 3IEJA 2PNSA 2YJ9A 2NQAA 2ARYA 3HWNA 4AXMA 4CDEB 4PADA 1EWOA 5CVNB 1KHPA 1XKGA 3I06A 3LXSA 1JQPA 5JH3A 3CH2X 1POPA 2OP3A 2E02A 4OEMA 4YYUA 1MDWA 4XR7A 5CHVA 2R9CA 1QXPA 5CVMA 2AVWA 3H8BA 1CVZA 4NV7A 3KWZA 2IPPB 4PI3A 4W4UA 4I07A 2FT2A 1FH0A 3B79A 4K7CA 2DCAA 1M6DA 4N79A 2VHSA 3IOQA 4BSQA 1W5RA 2HHNA 3P5UA 3QSDA 2IBIA 1X9YA 2R6NA 3PBHA 1SP4B 1YK8A 3RVWA 2DJFB 2AIMA 2VFCA 4Q8HA 4CDFB 3RVVA 2AYOA 2BDLA 2DCDA 3K9MA 2AYNA 2DJGB 2P7UA 4GUZA 2G8EA 3H7DA 1F2BA 3MORA 3MTNA 1AU2A 3P5WA 1ICFA 1F2CA 2OZ2A 3MHSA 6PADA 2Y6EA 3USVA 1PPOA 3KX1A 2B1MA 1AYWA 4QRGA 3MHHA 1PADA 1CPJA 2FO5A 1ME4A 1GLOA 1VSNA 3BPMA 2DZZA 1GCBA 1MEMA 5EGWA 2R9NA 3C9EA 4CDDB 1W6FA 3WXGA 1MIRA 4P6GA 3HHAA 2NQIA 4I05A 4WA6A 1YALA 1KFXL 1KXRA 1CQDA 3N3GA 1YK7A 1NQCA 4X6JA 4YYVA 4KLBA 3KKUA 2DC7A 3HHIA 2AS8A 3BOWA 1DEUA 2P86A 4HWYA 1NLJA 2E00A 1EWLA 3WXFA 2G8JA 5JA7A 3HD3A 4BQVA 4YYWA 1MHWA 2YJ8A 3QT4A 1Y4HA 3DF0A 3O0UA 4FK5A 1Q6KA 2FTDA 2H7JA 1GX3A 1CV8A 2AU1A 4C5PA 5K16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QH6 A;  4PP1 A;  1BP4 A;  1U9V A;  4BS5 A;  2YJ2 A;  3K8U A;  1QMY A;  3BWK A;  3KSE A;  2B1N A;  2NQD B;  1EF7 A;  1O0E A;  4PP2 E;  2DC6 A;  4BPV A;  4W5B A;  4P6E A;  2E03 A;  4FIP A;  3BPF A;  1EWP A;  1PBH A;  2PRE A;  1PPD A;  1DF0 A;  3LFY A;  1QDQ A;  1AIM A;  1AU0 A;  3IUT A;  2JQG R;  1STF E;  3K24 A;  2P0R A;  1NL6 A;  4OEL A;  1BGO A;  2XU1 A;  3P5V A;  2GFO A;  3AI8 A;  4DMX A;  1F2A A;  3IHP A;  1NB5 A;  3F75 A;  4FJC A;  3N3K A;  2FRQ A;  3OVZ A;  4MZO A;  4X6I A;  3IMA A;  1ME3 A;  2ACT A;  1VJV A;  4Q8G A;  1U9X A;  1ZIV A;  2XU4 A;  1TU6 A;  2DCC A;  4CZW A;  1GMY A;  2YJB A;  3N4C A;  5EF4 A;  4YYQ A;  2YJC A;  1MEG A;  4YV8 A;  1PXV A;  1CSB B;  3H89 A;  1TLO A;  4ZUX U;  3OIS A;  2G7Y A;  1IWD A;  2G6D A;  4N8W A;  1CS8 A;  2O6X A;  1BY8 A;  2NQG A;  3PNR A;  2FUD A;  2DZY A;  3V6C A;  1YVB A;  3KFQ A;  4X6H A;  1EWM A;  3I3T A;  8PCH A;  1Y08 A;  1MS6 A;  1ITO A;  3V6E A;  2VHF A;  1AU4 A;  4XUI A;  1U9Q X;  5CHT A;  2HXZ A;  2PBH A;  2CIO A;  2PAD A;  4MSX A;  2R9F A;  4G54 A;  3BC3 A;  4RY2 A;  2Y5B A;  2BDZ A;  1A6R A;  1THE A;  3O1G A;  1PIP A;  2FYE A;  1PCI A;  2XU5 A;  4I04 A;  1NPZ A;  1CTE A;  3E1Z B;  5F02 A;  3IV2 A;  3OF8 A;  3S3Q A;  3F5V A;  2R9M A;  1ATK A;  4QRX A;  2F1G A;  5FPW A;  2FQ9 A;  3NHE A;  2HD5 A;  1PPP A;  3M99 A;  7PCK A;  4QBB A;  3OVX A;  3BCN A;  3QJ3 A;  1PPN A;  2JQF R;  2C0Y A;  1TL9 A;  3CH3 X;  3H8C A;  3S3R A;  1KHQ A;  4BS6 A;  1YT7 A;  3KWB X;  1AU3 A;  1KFU L;  3PDF A;  1ZCM A;  2OUL A;  2DC9 A;  5PAD A;  3RVX A;  3ZUA A;  1U9W A;  1AEC A;  3CBK A;  1K3B B;  4AXL A;  1U5I A;  4YYS A;  4QRV A;  2ATO A;  4N4Z A;  4MZS A;  1QOL A;  9PAP A;  1AYU A;  4DMY A;  2F7D A;  1S4V A;  5CVO B;  3GCB A;  1NB3 A;  4YYR A;  2E01 A;  2HH5 A;  2GHU A;  3D6S A;  5J94 A;  3CBJ A;  4YVA A;  1CJL A;  2XU3 A;  2R9O A;  2FRA A;  3H6S A;  3KW9 A;  4CDC B;  3U8E A;  5A24 A;  2DC8 A;  2WBF X;  3P5X A;  3PW3 A;  1SNK A;  1HUC B;  1PE6 A;  2CB5 A;  2AUZ A;  3WXE A;  3ERV A;  3TNX A;  2DCB A;  2AUX A;  4W5C A;  3OF9 A;  1AYV A;  1F29 A;  1CB5 A;  1BQI A;  1GEC E;  3IEJ A;  2PNS A;  2YJ9 A;  2NQA A;  2ARY A;  3HWN A;  4AXM A;  4CDE B;  4PAD A;  1EWO A;  5CVN B;  1KHP A;  1XKG A;  3I06 A;  3LXS A;  1JQP A;  5JH3 A;  3CH2 X;  1POP A;  2OP3 A;  2E02 A;  4OEM A;  4YYU A;  1MDW A;  4XR7 A;  5CHV A;  2R9C A;  1QXP A;  5CVM A;  2AVW A;  3H8B A;  1CVZ A;  3KWZ A;  2IPP B;  4PI3 A;  4W4U A;  4I07 A;  2FT2 A;  1FH0 A;  3B79 A;  4K7C A;  2DCA A;  1M6D A;  4N79 A;  2VHS A;  3IOQ A;  4BSQ A;  2HHN A;  3P5U A;  3QSD A;  2IBI A;  1X9Y A;  2R6N A;  3PBH A;  1SP4 B;  1YK8 A;  3RVW A;  2DJF B;  2AIM A;  4Q8H A;  4CDF B;  3RVV A;  2AYO A;  2BDL A;  2DCD A;  3K9M A;  2AYN A;  2DJG B;  2P7U A;  2G8E A;  3H7D A;  1F2B A;  3MOR A;  3MTN A;  1AU2 A;  3P5W A;  1ICF A;  1F2C A;  2OZ2 A;  3MHS A;  6PAD A;  2Y6E A;  3USV A;  1PPO A;  3KX1 A;  2B1M A;  1AYW A;  4QRG A;  3MHH A;  1PAD A;  1CPJ A;  2FO5 A;  1ME4 A;  1GLO A;  1VSN A;  3BPM A;  2DZZ A;  1GCB A;  1MEM A;  5EGW A;  2R9N A;  3C9E A;  4CDD B;  3WXG A;  1MIR A;  4P6G A;  3HHA A;  2NQI A;  4I05 A;  4WA6 A;  1YAL A;  1KFX L;  1KXR A;  1CQD A;  3N3G A;  1YK7 A;  1NQC A;  4X6J A;  4YYV A;  4KLB A;  3KKU A;  2DC7 A;  3HHI A;  2AS8 A;  3BOW A;  1DEU A;  2P86 A;  4HWY A;  1NLJ A;  2E00 A;  1EWL A;  3WXF A;  2G8J A;  5JA7 A;  3HD3 A;  4BQV A;  4YYW A;  1MHW A;  2YJ8 A;  3QT4 A;  1Y4H A;  3DF0 A;  3O0U A;  4FK5 A;  1Q6K A;  2FTD A;  2H7J A;  1CV8 A;  2AU1 A;  5K16 A; 
#chains in the Genus database with same CATH topology
 4QH6 A;  4A5U A;  4PP1 A;  1BP4 A;  1U9V A;  3PRP A;  4BS5 A;  4RF0 A;  2YJ2 A;  3K8U A;  1QMY A;  3BWK A;  3KSE A;  2B1N A;  2NQD B;  1EF7 A;  1O0E A;  4OVZ B;  3PRM A;  4PP2 E;  2DC6 A;  4BPV A;  4W5B A;  4P6E A;  2E03 A;  4FIP A;  4PT5 A;  3BPF A;  1EWP A;  1PBH A;  2PRE A;  1PPD A;  1DF0 A;  3LFY A;  1QDQ A;  1AIM A;  1AU0 A;  3IUT A;  2JQG R;  1STF E;  3K24 A;  2P0R A;  1NL6 A;  4OEL A;  1BGO A;  2XU1 A;  3P5V A;  2GFO A;  3AI8 A;  3W30 A;  4DMX A;  1F2A A;  3IHP A;  3RNV A;  1NB5 A;  3F75 A;  4FJC A;  3N3K A;  2FRQ A;  4XZX A;  3OVZ A;  4MZO A;  4X6I A;  3IMA A;  1ME3 A;  2ACT A;  1VJV A;  4Q8G A;  1U9X A;  2FE8 A;  3OQC A;  1ZIV A;  2XU4 A;  1TU6 A;  2BU3 A;  2DCC A;  4CZW A;  1GMY A;  2YJB A;  3N4C A;  5EF4 A;  4YYQ A;  2YJC A;  1MEG A;  4YV8 A;  4IP3 A;  4R3D A;  1PXV A;  1CSB B;  2J7Q A;  3PHW A;  3H89 A;  1TLO A;  4ZUX U;  3OIS A;  3PT2 A;  1UKF A;  2G7Y A;  5E6J A;  1IWD A;  2G6D A;  4N8W A;  1CS8 A;  2O6X A;  1BY8 A;  2NQG A;  3PNR A;  2FUD A;  2JTC A;  2DZY A;  4IUM A;  3V6C A;  1YVB A;  3KFQ A;  4X6H A;  1EWM A;  3I3T A;  8PCH A;  1Y08 A;  1MS6 A;  1ITO A;  3V6E A;  2VHF A;  4D8E A;  1AU4 A;  4XUI A;  1U9Q X;  2UZJ A;  5CHT A;  2HXZ A;  2PBH A;  2CIO A;  1PVJ A;  2PAD A;  4MSX A;  2R9F A;  3MJ5 A;  4G54 A;  3BC3 A;  4RY2 A;  2Y5B A;  2BDZ A;  1A6R A;  1THE A;  3O1G A;  1PIP A;  2FYE A;  1PCI A;  2XU5 A;  4I04 A;  1NPZ A;  1CTE A;  3E1Z B;  5F02 A;  3IV2 A;  3BY4 A;  3OF8 A;  3S3Q A;  3F5V A;  2R9M A;  1ATK A;  4QRX A;  2F1G A;  5FPW A;  2FQ9 A;  3NHE A;  2J7Q C;  2HD5 A;  1PPP A;  3M99 A;  4P16 A;  7PCK A;  4QBB A;  3OVX A;  3BCN A;  3QJ3 A;  1PPN A;  2JQF R;  2C0Y A;  1TL9 A;  3CH3 X;  3H8C A;  5JZE A;  2DOS A;  3S3R A;  1KHQ A;  4BS6 A;  1YT7 A;  3KWB X;  1AU3 A;  3W31 A;  1KFU L;  3PDF A;  2BTW A;  1ZCM A;  4RF1 A;  2OUL A;  2DC9 A;  5PAD A;  4M0W A;  3RVX A;  3ZUA A;  3PHU A;  1U9W A;  1AEC A;  3CBK A;  1K3B B;  4AXL A;  1U5I A;  4YYS A;  4QRV A;  4MI7 A;  5KO3 A;  2ATO A;  4N4Z A;  4MZS A;  1QOL A;  9PAP A;  1AYU A;  4DMY A;  3MTV A;  2F7D A;  1S4V A;  5CVO B;  3GCB A;  1NB3 A;  2AGA A;  4YYR A;  4GUA A;  2E01 A;  2HH5 A;  2GHU A;  3D6S A;  5EZS A;  5J94 A;  3CBJ A;  4YVA A;  1CJL A;  2XU3 A;  2R9O A;  2FRA A;  3H6S A;  4BOU A;  3KW9 A;  4CDC B;  3U8E A;  5A24 A;  4BOQ A;  2DC8 A;  2WBF X;  3P5X A;  3PW3 A;  1SNK A;  1HUC B;  1PE6 A;  2CB5 A;  2AUZ A;  3WXE A;  4D8I A;  3ERV A;  3TNX A;  2DCB A;  2AUX A;  4HXD B;  3MP2 A;  4W5C A;  3OF9 A;  1AYV A;  1F29 A;  4REZ A;  1CB5 A;  3C0R A;  3IFU A;  1BQI A;  1GEC E;  3IEJ A;  4BOZ A;  3PSE A;  2PNS A;  2YJ9 A;  4OVZ A;  2NQA A;  2ARY A;  2JRI A;  3HWN A;  4AXM A;  4CDE B;  4PAD A;  4BOP A;  1EWO A;  5CVN B;  1KHP A;  1XKG A;  3I06 A;  3LXS A;  4RNA A;  1JQP A;  1DKI A;  5JH3 A;  3CH2 X;  1POP A;  2OP3 A;  2E02 A;  4OEM A;  4YYU A;  1MDW A;  4WUR A;  4XR7 A;  5CHV A;  2R9C A;  1QXP A;  5CVM A;  2AVW A;  3H8B A;  1CVZ A;  3KWZ A;  2IPP B;  4PI3 A;  4W4U A;  4I07 A;  3TRK A;  2FT2 A;  1FH0 A;  3B79 A;  4K7C A;  2DCA A;  3TMP A;  1M6D A;  4N79 A;  2VHS A;  3B21 A;  3IOQ A;  4BSQ A;  2HHN A;  3P5U A;  3QSD A;  2IBI A;  1X9Y A;  2R6N A;  3PBH A;  1SP4 B;  1YK8 A;  3O65 A;  3RVW A;  2DJF B;  2AIM A;  4Q8H A;  4CDF B;  3RVV A;  2AYO A;  2BDL A;  2DCD A;  3K9M A;  2HWK A;  2AYN A;  3BBA A;  2DJG B;  2P7U A;  2Z84 A;  2G8E A;  3E9S A;  4BOS A;  3H7D A;  1F2B A;  3MOR A;  3MTN A;  1AU2 A;  3P5W A;  1ICF A;  1F2C A;  2OZ2 A;  3ZNH A;  3MHS A;  6PAD A;  2Y6E A;  3USV A;  1PPO A;  3PHX A;  3KX1 A;  2B1M A;  1AYW A;  4QRG A;  3MHH A;  1PAD A;  1CPJ A;  2FO5 A;  1ME4 A;  1GLO A;  2BTW B;  1VSN A;  3BPM A;  2DZZ A;  1GCB A;  1MEM A;  5EGW A;  2R9N A;  3C9E A;  4CDD B;  3WXG A;  1MIR A;  4P6G A;  3HHA A;  5EZQ A;  2NQI A;  4I05 A;  4WA6 A;  1YAL A;  1KFX L;  1KXR A;  1CQD A;  3N3G A;  1YK7 A;  1NQC A;  4X6J A;  4YYV A;  4KLB A;  3KKU A;  2DC7 A;  3HHI A;  2AS8 A;  3BOW A;  4MM3 B;  1DEU A;  2P86 A;  4HWY A;  1NLJ A;  4D8B A;  2E00 A;  1EWL A;  3WXF A;  2G8J A;  5JA7 A;  3HD3 A;  4RKX A;  4BQV A;  4YYW A;  1MHW A;  2YJ8 A;  3QT4 A;  4OW0 A;  4ZTB A;  3BB7 A;  1Y4H A;  3DF0 A;  3O0U A;  4FK5 A;  1YZB A;  1Q6K A;  2FTD A;  2H7J A;  1CV8 A;  2AU1 A;  5K16 A; 
#chains in the Genus database with same CATH homology
 4QH6 A;  4PP1 A;  1BP4 A;  1U9V A;  4BS5 A;  2YJ2 A;  3K8U A;  1QMY A;  3BWK A;  3KSE A;  2B1N A;  2NQD B;  1EF7 A;  1O0E A;  4PP2 E;  2DC6 A;  4BPV A;  4W5B A;  4P6E A;  2E03 A;  4FIP A;  3BPF A;  1EWP A;  1PBH A;  2PRE A;  1PPD A;  1DF0 A;  3LFY A;  1QDQ A;  4NV8 A;  1AIM A;  1AU0 A;  3IUT A;  2JQG R;  1STF E;  3K24 A;  2P0R A;  1NL6 A;  4OEL A;  1BGO A;  2XU1 A;  3P5V A;  2GFO A;  3AI8 A;  4DMX A;  1F2A A;  3IHP A;  1NB5 A;  3F75 A;  4FJC A;  3N3K A;  2FRQ A;  3OVZ A;  4MZO A;  4X6I A;  3IMA A;  1ME3 A;  2ACT A;  1VJV A;  4Q8G A;  1U9X A;  1ZIV A;  2XU4 A;  1TU6 A;  2DCC A;  4CZW A;  1GMY A;  2YJB A;  3N4C A;  5EF4 A;  4YYQ A;  2YJC A;  1MEG A;  4YV8 A;  1PXV A;  1CSB B;  3H89 A;  1TLO A;  4ZUX U;  3OIS A;  3LTW A;  2G7Y A;  1IWD A;  2G6D A;  4N8W A;  2BSZ A;  1CS8 A;  2O6X A;  1BY8 A;  2NQG A;  3PNR A;  2FUD A;  1W4T A;  2DZY A;  3V6C A;  1YVB A;  3KFQ A;  4X6H A;  1EWM A;  3I3T A;  8PCH A;  1Y08 A;  1MS6 A;  1ITO A;  3V6E A;  2VHF A;  1AU4 A;  4XUI A;  1U9Q X;  5CHT A;  2HXZ A;  4B55 A;  2PBH A;  2CIO A;  2PAD A;  4MSX A;  2R9F A;  4G54 A;  3BC3 A;  4RY2 A;  2Y5B A;  2BDZ A;  1A6R A;  1THE A;  3O1G A;  1PIP A;  2FYE A;  1PCI A;  4BGF A;  2XU5 A;  4I04 A;  1NPZ A;  1CTE A;  3E1Z B;  5F02 A;  3IV2 A;  3OF8 A;  3S3Q A;  3F5V A;  2R9M A;  1ATK A;  4QRX A;  2F1G A;  5FPW A;  2FQ9 A;  3NHE A;  2HD5 A;  1PPP A;  3M99 A;  7PCK A;  4QBB A;  3OVX A;  3BCN A;  3QJ3 A;  1E2T A;  1PPN A;  2JQF R;  2C0Y A;  1TL9 A;  3CH3 X;  3H8C A;  3S3R A;  1KHQ A;  4BS6 A;  1YT7 A;  3KWB X;  2VFB A;  1AU3 A;  1KFU L;  3PDF A;  1ZCM A;  2OUL A;  2DC9 A;  5PAD A;  3RVX A;  3ZUA A;  1U9W A;  1AEC A;  3CBK A;  1K3B B;  4AXL A;  1U5I A;  4YYS A;  4QRV A;  2ATO A;  4N4Z A;  4MZS A;  1QOL A;  9PAP A;  1AYU A;  4DMY A;  2F7D A;  1S4V A;  5CVO B;  3GCB A;  1NB3 A;  4YYR A;  2E01 A;  2HH5 A;  2GHU A;  3D6S A;  5J94 A;  3D9W A;  3CBJ A;  4YVA A;  1CJL A;  2XU3 A;  2R9O A;  2FRA A;  3H6S A;  3KW9 A;  4CDC B;  3U8E A;  5A24 A;  2DC8 A;  2WBF X;  3P5X A;  3PW3 A;  1SNK A;  1HUC B;  1PE6 A;  2CB5 A;  2AUZ A;  3WXE A;  3ERV A;  3TNX A;  2DCB A;  2AUX A;  4W5C A;  3OF9 A;  1AYV A;  1F29 A;  1CB5 A;  1BQI A;  1GEC E;  3IEJ A;  2PNS A;  2YJ9 A;  2NQA A;  2ARY A;  3HWN A;  4AXM A;  4CDE B;  4PAD A;  1EWO A;  5CVN B;  1KHP A;  1XKG A;  3I06 A;  3LXS A;  1JQP A;  5JH3 A;  3CH2 X;  1POP A;  2OP3 A;  2E02 A;  4OEM A;  4YYU A;  1MDW A;  4XR7 A;  5CHV A;  2R9C A;  1QXP A;  5CVM A;  2AVW A;  3H8B A;  1CVZ A;  4NV7 A;  3KWZ A;  2IPP B;  4PI3 A;  4W4U A;  4I07 A;  2FT2 A;  1FH0 A;  3B79 A;  4K7C A;  2DCA A;  1M6D A;  4N79 A;  2VHS A;  3IOQ A;  4BSQ A;  1W5R A;  2HHN A;  3P5U A;  3QSD A;  2IBI A;  1X9Y A;  2R6N A;  3PBH A;  1SP4 B;  1YK8 A;  3RVW A;  2DJF B;  2AIM A;  2VFC A;  4Q8H A;  4CDF B;  3RVV A;  2AYO A;  2BDL A;  2DCD A;  3K9M A;  2AYN A;  2DJG B;  2P7U A;  4GUZ A;  2G8E A;  3H7D A;  1F2B A;  3MOR A;  3MTN A;  1AU2 A;  3P5W A;  1ICF A;  1F2C A;  2OZ2 A;  3MHS A;  6PAD A;  2Y6E A;  3USV A;  1PPO A;  3KX1 A;  2B1M A;  1AYW A;  4QRG A;  3MHH A;  1PAD A;  1CPJ A;  2FO5 A;  1ME4 A;  1GLO A;  1VSN A;  3BPM A;  2DZZ A;  1GCB A;  1MEM A;  5EGW A;  2R9N A;  3C9E A;  4CDD B;  1W6F A;  3WXG A;  1MIR A;  4P6G A;  3HHA A;  2NQI A;  4I05 A;  4WA6 A;  1YAL A;  1KFX L;  1KXR A;  1CQD A;  3N3G A;  1YK7 A;  1NQC A;  4X6J A;  4YYV A;  4KLB A;  3KKU A;  2DC7 A;  3HHI A;  2AS8 A;  3BOW A;  1DEU A;  2P86 A;  4HWY A;  1NLJ A;  2E00 A;  1EWL A;  3WXF A;  2G8J A;  5JA7 A;  3HD3 A;  4BQV A;  4YYW A;  1MHW A;  2YJ8 A;  3QT4 A;  1Y4H A;  3DF0 A;  3O0U A;  4FK5 A;  1Q6K A;  2FTD A;  2H7J A;  1GX3 A;  1CV8 A;  2AU1 A;  4C5P A;  5K16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...