1O0EA

1.9 angstrom crystal structure of a plant cysteine protease ervatamin c
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
208
structure length
208
Chain Sequence
LPEQIDWRKKGAVTPVKNQGSCGSCWAFSTVSTVESINQIRTGNLISLSEQELVDCDKKNHGCLGGAFVFAYQYIINNGGIDTQANYPYKAVQGPCQAASKVVSIDGYNGVPFCNEXALKQAVAVQPSTVAIDASSAQFQQYSSGIFSGPCGTKLNHGVTIVGYQANYWIVRNSWGRYWGEKGYIRMLRVGGCGLCGIARLPYYPTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of the Unusual Stability and Substrate Specificity of Ervatamin C, a Plant Cysteine Protease from Ervatamia coronaria
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Ervatamin C
total genus 68
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1o0eA00
1PPPA 1PXVA 5K16A 2FUDA 3BCNA 1AU3A 1DF0A 2DC7A 1U5IA 4PI3A 3P5VA 4AXMA 3ERVA 2NQDB 2YJBA 3DF0A 3KSEA 4Q8HA 1BQIA 3K8UA 2DC9A 5CVOB 2VHFA 4MZSA 1EF7A 3CH3X 4KLBA 4X6HA 2AIMA 4QRXA 1CJLA 2DJFB 3P5XA 1QXPA 2PREA 4AXLA 2E03A 4XUIA 3MTNA 1ZCMA 2O6XA 1YT7A 2NQIA 3C9EA 3H7DA 1S4VA 4OELA 2FO5A 4X6IA 1IWDA 2DJGB 1PPOA 4MSXA 3HHAA 1ICFA 4BS5A 1AYWA 4FJCA 2ATOA 2CB5A 4G54A 2DZZA 3OVXA 2E00A 2G6DA 1PADA 1F2BA 1POPA 2XU5A 4FK5A 1CB5A 1MEMA 1NLJA 3BWKA 4W4UA 1ITOA 5EGWA 1ME3A 1CSBB 1F2CA 1PPNA 1Q6KA 3H8BA 1Y08A 1DEUA 5JH3A 2B1NA 3S3QA 2FRQA 4CDEB 4WA6A 3P5UA 3N3GA 3OF9A 2YJCA 2DC6A 2XU4A 3HD3A 1ATKA 1AYVA 3PW3A 5J94A 1KHPA 4QRGA 1FH0A 1QDQA 4BQVA 3B79A 1AU0A 3N3KA 3PBHA 3USVA 3S3RA 2JQGR 2DC8A 2YJ8A 4W5CA 4YV8A 3RVWA 3QJ3A 4YYQA 1M6DA 1NL6A 1NQCA 3IHPA 1SNKA 3O1GA 3KKUA 3IUTA 4CDCB 5CHVA 5F02A 1SP4B 3KWBX 1A6RA 3U8EA 2HH5A 2GFOA 3HHIA 4I07A 3H8CA 3LXSA 2E01A 2AVWA 4MZOA 2NQAA 4OEMA 1PBHA 3OF8A 3TNXA 1GMYA 1XKGA 2ACTA 1GECE 1YK7A 4HWYA 2P7UA 1Y4HA 3P5WA 4DMXA 1K3BB 1NB5A 4PP1A 1MS6A 3WXGA 1PE6A 3OISA 3E1ZB 3QSDA 1X9YA 3H89A 3BPFA 3KFQA 3M99A 4XR7A 3CBJA 3I3TA 2R6NA 2PBHA 1YALA 1U9WA 1ME4A 1TLOA 3IEJA 4N4ZA 3IV2A 2R9FA 4QRVA 3MHHA 1YVBA 1O0EA 1VSNA 1MIRA 2DCBA 2C0YA 3RVVA 2FT2A 2H7JA 1KFUL 2G8JA 1MEGA 6PADA 1TL9A 4QH6A 3F5VA 4ZUXU 2JQFR 1PPDA 2F7DA 9PAPA 2F1GA 1AECA 4I04A 1CQDA 1AYUA 2YJ2A 2R9NA 2NQGA 3D6SA 2HD5A 3V6CA 1QOLA 3KX1A 4PADA 1EWPA 3V6EA 1F2AA 5A24A 1MHWA 2PNSA 2YJ9A 3H6SA 1TU6A 2R9CA 2P0RA 3F75A 2AUXA 4YYUA 2Y5BA 2XU3A 4P6EA 2HHNA 1VJVA 2Y6EA 1NPZA 3MORA 2CIOA 4N79A 1U9QX 3K9MA 1PIPA 2HXZA 5CVMA 1NB3A 4Q8GA 1JQPA 2AS8A 1ZIVA 5EF4A 3IMAA 3BPMA 1AU4A 4BS6A 1BP4A 3ZUAA 2VHSA 3OVZA 2OULA 3K24A 2BDZA 4P6GA 4YYWA 7PCKA 3KWZA 2G7YA 1CV8A 1HUCB 2FRAA 1U9VA 1GLOA 8PCHA 2AYNA 3KW9A 2E02A 2R9MA 1EWOA 3BC3A 2AUZA 1AIMA 3PDFA 2B1MA 1THEA 4BSQA 1BY8A 3O0UA 3BOWA 4I05A 4FIPA 2XU1A 4K7CA 1KHQA 3QT4A 1YK8A 3WXEA 2P86A 5FPWA 4RY2A 5JA7A 3N4CA 4W5BA 1GCBA 3CBKA 2FTDA 3MHSA 3IOQA 1U9XA 4YVAA 1STFE 2AYOA 3GCBA 2AU1A 2DCCA 1AU2A 2GHUA 4N8WA 1MDWA 3WXFA 1CPJA 1CS8A 4YYRA 2BDLA 4QBBA 5CHTA 4YYSA 1F29A 1CVZA 4CDDB 2G8EA 2WBFX 2DCAA 3NHEA 3PNRA 2OP3A 2FYEA 2IPPB 1KXRA 4PP2E 5PADA 1EWLA 4DMYA 4YYVA 3RVXA 1KFXL 4BPVA 3LFYA 1PCIA 3AI8A 4CDFB 2R9OA 1BGOA 2ARYA 2DCDA 2IBIA 3I06A 2OZ2A 1EWMA 2PADA 5CVNB 1QMYA 3HWNA 2FQ9A 2DZYA 4X6JA 3CH2X 1CTEA 4CZWA
chains in the Genus database with same CATH superfamily
1PPPA 1PXVA 5K16A 4D8IA 2FUDA 3BCNA 1AU3A 1DF0A 2DC7A 1U5IA 4PI3A 3P5VA 4AXMA 4D8BA 3ERVA 3TMPA 2NQDB 2YJBA 3DF0A 3MJ5A 3KSEA 4Q8HA 1BQIA 3K8UA 2DC9A 5CVOB 2VHFA 4MZSA 1EF7A 3CH3X 4KLBA 4X6HA 2AIMA 4QRXA 1CJLA 2DJFB 3P5XA 1QXPA 2PREA 4AXLA 2E03A 4XUIA 3MTNA 3TRKA 4WURA 1ZCMA 2O6XA 1YT7A 2NQIA 3C9EA 3H7DA 1S4VA 4OELA 2FO5A 3BB7A 4X6IA 2HWKA 1IWDA 2DJGB 1PPOA 4MSXA 4M0WA 3HHAA 1ICFA 4BS5A 1AYWA 4FJCA 2ATOA 2CB5A 4G54A 2DZZA 4OW0A 3OVXA 2E00A 2G6DA 1PADA 1F2BA 1POPA 2XU5A 4FK5A 1CB5A 1PVJA 1MEMA 1NLJA 3BBAA 3BWKA 1ITOA 4W4UA 5EGWA 1ME3A 1CSBB 1F2CA 1PPNA 1Q6KA 3H8BA 1Y08A 1DEUA 5JH3A 2B1NA 3S3QA 2FRQA 4CDEB 4WA6A 3P5UA 3N3GA 3E9SA 3OF9A 4RF1A 2YJCA 3PT2A 2DC6A 2XU4A 3HD3A 1ATKA 1AYVA 3IFUA 3PW3A 5J94A 1KHPA 4QRGA 3RNVA 1FH0A 4D8EA 1QDQA 4BQVA 3B79A 1AU0A 3N3KA 3PBHA 3USVA 4ZTBA 3S3RA 2JQGR 2DC8A 2YJ8A 4W5CA 4YV8A 3RVWA 5KO3A 3QJ3A 4BOSA 4YYQA 1M6DA 1NL6A 1NQCA 3IHPA 1SNKA 4RNAA 3O1GA 3KKUA 3IUTA 3W31A 4CDCB 2J7QC 5CHVA 5F02A 1SP4B 3KWBX 1A6RA 3U8EA 3W30A 2HH5A 3B21A 2GFOA 3HHIA 4I07A 3H8CA 3LXSA 2E01A 2AVWA 4MZOA 3PRMA 4MI7A 2NQAA 4OEMA 1PBHA 4GUAA 3MTVA 3OF8A 3TNXA 1GMYA 1XKGA 4HXDB 2ACTA 1GECE 1YK7A 4HWYA 2P7UA 1Y4HA 3P5WA 4DMXA 1K3BB 1NB5A 4PP1A 1MS6A 3WXGA 1PE6A 3OISA 3E1ZB 3QSDA 1X9YA 3H89A 3BPFA 4MM3B 3KFQA 4IP3A 3PRPA 3M99A 4XR7A 3CBJA 3I3TA 2R6NA 2PBHA 3PHUA 1YALA 1U9WA 1ME4A 1TLOA 3IEJA 3OQCA 4N4ZA 2JRIA 4RF0A 3IV2A 2R9FA 4QRVA 3MHHA 1YVBA 3PSEA 1O0EA 1VSNA 1DKIA 1MIRA 1UKFA 2DCBA 2C0YA 3RVVA 2FT2A 2H7JA 1KFUL 2G8JA 1MEGA 3ZNHA 6PADA 1TL9A 4QH6A 3F5VA 4ZUXU 2JQFR 4R3DA 4A5UA 1PPDA 2F7DA 2Z84A 9PAPA 2F1GA 1AECA 4I04A 4OVZB 1CQDA 1AYUA 2YJ2A 2R9NA 2JTCA 2NQGA 3D6SA 4BOZA 2HD5A 3V6CA 1QOLA 3KX1A 4PADA 1EWPA 3V6EA 3PHWA 1F2AA 5A24A 1MHWA 2AGAA 2PNSA 2YJ9A 2DOSA 3H6SA 1TU6A 2R9CA 2P0RA 3F75A 2AUXA 4YYUA 2Y5BA 2XU3A 4P6EA 2BTWA 2HHNA 1VJVA 2Y6EA 1NPZA 3MORA 2CIOA 4N79A 4XZXA 1U9QX 3K9MA 1PIPA 2HXZA 5CVMA 1NB3A 3C0RA 4Q8GA 3O65A 1JQPA 2AS8A 1ZIVA 5EF4A 3IMAA 3BPMA 1AU4A 4BS6A 1BP4A 3ZUAA 2VHSA 5EZQA 5EZSA 3OVZA 2OULA 3K24A 2BDZA 4RKXA 4P6GA 4YYWA 7PCKA 3KWZA 2G7YA 4BOUA 1CV8A 1HUCB 2FRAA 1U9VA 1GLOA 8PCHA 2AYNA 3KW9A 5E6JA 2E02A 2R9MA 3MP2A 1EWOA 3BC3A 4BOQA 2AUZA 1AIMA 3PDFA 2B1MA 1THEA 4BSQA 1BY8A 3O0UA 3BOWA 4I05A 4FIPA 2XU1A 4K7CA 1KHQA 3QT4A 1YK8A 2BTWB 4IUMA 3WXEA 4BOPA 2P86A 3BY4A 5FPWA 4RY2A 5JA7A 3N4CA 4W5BA 2BU3A 1GCBA 3CBKA 2FTDA 5JZEA 3MHSA 3IOQA 1U9XA 4YVAA 4PT5A 1STFE 2AYOA 3GCBA 2AU1A 2DCCA 1AU2A 2GHUA 4N8WA 1MDWA 3WXFA 1CPJA 1CS8A 4YYRA 2BDLA 2UZJA 4QBBA 3PHXA 5CHTA 4YYSA 2FE8A 1F29A 1CVZA 4CDDB 2G8EA 2WBFX 2DCAA 3NHEA 4REZA 3PNRA 2OP3A 2FYEA 2IPPB 1KXRA 4P16A 4PP2E 1EWLA 1YZBA 5PADA 4DMYA 4YYVA 3RVXA 1KFXL 4BPVA 3LFYA 1PCIA 3AI8A 4CDFB 4OVZA 2R9OA 1BGOA 2ARYA 2J7QA 2DCDA 2IBIA 3I06A 2OZ2A 1EWMA 2PADA 5CVNB 1QMYA 3HWNA 2FQ9A 2DZYA 4X6JA 3CH2X 1CTEA 4CZWA
chains in the Genus database with same CATH topology
1PPPA 1PXVA 5K16A 2FUDA 3BCNA 1AU3A 1DF0A 2DC7A 1U5IA 4PI3A 3P5VA 4AXMA 3ERVA 2NQDB 2YJBA 3DF0A 3KSEA 4Q8HA 1BQIA 3K8UA 2DC9A 5CVOB 2VHFA 4MZSA 1EF7A 3CH3X 4KLBA 4X6HA 2AIMA 4QRXA 1CJLA 2DJFB 3P5XA 1QXPA 2PREA 4AXLA 2E03A 4XUIA 3MTNA 1ZCMA 2O6XA 1YT7A 2NQIA 3C9EA 3H7DA 1S4VA 4OELA 2FO5A 4X6IA 1IWDA 2DJGB 1PPOA 4MSXA 3HHAA 1ICFA 4BS5A 1AYWA 4FJCA 2ATOA 2CB5A 4G54A 2DZZA 3OVXA 2E00A 2G6DA 1PADA 1F2BA 1POPA 2XU5A 4FK5A 1CB5A 1MEMA 1NLJA 3BWKA 4W4UA 1ITOA 5EGWA 1ME3A 1CSBB 1F2CA 1PPNA 1Q6KA 3H8BA 1Y08A 1DEUA 5JH3A 2B1NA 3S3QA 2FRQA 4CDEB 4WA6A 3P5UA 3N3GA 3OF9A 2YJCA 2DC6A 2XU4A 3HD3A 1ATKA 1AYVA 3PW3A 5J94A 1KHPA 4QRGA 1FH0A 1QDQA 4NV8A 4BQVA 3B79A 1AU0A 3N3KA 3PBHA 3USVA 4B55A 3S3RA 2JQGR 4NV7A 2DC8A 2YJ8A 4W5CA 4YV8A 3RVWA 3QJ3A 4YYQA 1M6DA 1NL6A 1NQCA 3IHPA 1SNKA 3O1GA 3KKUA 3IUTA 4CDCB 5CHVA 5F02A 1SP4B 4GUZA 3KWBX 1A6RA 3U8EA 2HH5A 2GFOA 3HHIA 4I07A 3H8CA 3LXSA 2E01A 2AVWA 3D9WA 4MZOA 2NQAA 4OEMA 1PBHA 3OF8A 3TNXA 1GMYA 1XKGA 2ACTA 1W4TA 1GECE 1YK7A 4HWYA 2P7UA 1Y4HA 3P5WA 4DMXA 1K3BB 1NB5A 4PP1A 1MS6A 3WXGA 1PE6A 4BGFA 3OISA 3E1ZB 3QSDA 1X9YA 3H89A 3BPFA 3KFQA 3M99A 4XR7A 3CBJA 3I3TA 2R6NA 1W5RA 2PBHA 1YALA 1U9WA 1E2TA 1ME4A 1TLOA 3IEJA 1GX3A 4N4ZA 3IV2A 2R9FA 4QRVA 3MHHA 1YVBA 1O0EA 3LTWA 1VSNA 1MIRA 2DCBA 2C0YA 3RVVA 2FT2A 2H7JA 1KFUL 2G8JA 1MEGA 6PADA 1TL9A 4QH6A 3F5VA 4ZUXU 2JQFR 1PPDA 2F7DA 9PAPA 2F1GA 1AECA 4I04A 1CQDA 1AYUA 2YJ2A 2R9NA 2NQGA 3D6SA 2HD5A 3V6CA 1QOLA 3KX1A 4PADA 1EWPA 3V6EA 1F2AA 5A24A 1MHWA 2PNSA 2YJ9A 3H6SA 1TU6A 2R9CA 2P0RA 3F75A 2AUXA 4YYUA 2Y5BA 2XU3A 4P6EA 2HHNA 1VJVA 2Y6EA 1NPZA 3MORA 2CIOA 4N79A 1U9QX 3K9MA 1PIPA 2HXZA 5CVMA 1NB3A 4Q8GA 1JQPA 2AS8A 1ZIVA 5EF4A 3IMAA 3BPMA 1AU4A 4BS6A 1BP4A 3ZUAA 2VHSA 3OVZA 2OULA 3K24A 2BDZA 4P6GA 4YYWA 7PCKA 3KWZA 2G7YA 1CV8A 1HUCB 2FRAA 1U9VA 1GLOA 8PCHA 2AYNA 3KW9A 2E02A 2R9MA 1EWOA 3BC3A 2AUZA 1AIMA 3PDFA 2B1MA 1THEA 4BSQA 1BY8A 3O0UA 3BOWA 4I05A 4FIPA 2XU1A 4K7CA 1KHQA 3QT4A 1W6FA 1YK8A 3WXEA 2P86A 5FPWA 4RY2A 5JA7A 3N4CA 4W5BA 1GCBA 3CBKA 2FTDA 3MHSA 3IOQA 1U9XA 4YVAA 1STFE 2AYOA 3GCBA 2AU1A 2VFCA 2DCCA 1AU2A 2GHUA 4N8WA 1MDWA 3WXFA 1CPJA 1CS8A 4YYRA 2BDLA 4QBBA 5CHTA 4YYSA 2BSZA 4C5PA 1F29A 1CVZA 4CDDB 2G8EA 2WBFX 2DCAA 3NHEA 3PNRA 2OP3A 2FYEA 2IPPB 2VFBA 1KXRA 4PP2E 1EWLA 5PADA 4DMYA 4YYVA 3RVXA 1KFXL 4BPVA 3LFYA 1PCIA 3AI8A 4CDFB 2R9OA 1BGOA 2ARYA 2DCDA 2IBIA 3I06A 2OZ2A 1EWMA 2PADA 5CVNB 1QMYA 3HWNA 2FQ9A 2DZYA 4X6JA 3CH2X 1CTEA 4CZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PPP A;  1PXV A;  5K16 A;  2FUD A;  3BCN A;  1AU3 A;  1DF0 A;  2DC7 A;  1U5I A;  4PI3 A;  3P5V A;  4AXM A;  3ERV A;  2NQD B;  2YJB A;  3DF0 A;  3KSE A;  4Q8H A;  1BQI A;  3K8U A;  2DC9 A;  5CVO B;  2VHF A;  4MZS A;  1EF7 A;  3CH3 X;  4KLB A;  4X6H A;  2AIM A;  4QRX A;  1CJL A;  2DJF B;  3P5X A;  1QXP A;  2PRE A;  4AXL A;  2E03 A;  4XUI A;  3MTN A;  1ZCM A;  2O6X A;  1YT7 A;  2NQI A;  3C9E A;  3H7D A;  1S4V A;  4OEL A;  2FO5 A;  4X6I A;  1IWD A;  2DJG B;  1PPO A;  4MSX A;  3HHA A;  1ICF A;  4BS5 A;  1AYW A;  4FJC A;  2ATO A;  2CB5 A;  4G54 A;  2DZZ A;  3OVX A;  2E00 A;  2G6D A;  1PAD A;  1F2B A;  1POP A;  2XU5 A;  4FK5 A;  1CB5 A;  1MEM A;  1NLJ A;  3BWK A;  4W4U A;  1ITO A;  5EGW A;  1ME3 A;  1CSB B;  1F2C A;  1PPN A;  1Q6K A;  3H8B A;  1Y08 A;  1DEU A;  5JH3 A;  2B1N A;  3S3Q A;  2FRQ A;  4CDE B;  4WA6 A;  3P5U A;  3N3G A;  3OF9 A;  2YJC A;  2DC6 A;  2XU4 A;  3HD3 A;  1ATK A;  1AYV A;  3PW3 A;  5J94 A;  1KHP A;  4QRG A;  1FH0 A;  1QDQ A;  4BQV A;  3B79 A;  1AU0 A;  3N3K A;  3PBH A;  3USV A;  3S3R A;  2JQG R;  2DC8 A;  2YJ8 A;  4W5C A;  4YV8 A;  3RVW A;  3QJ3 A;  4YYQ A;  1M6D A;  1NL6 A;  1NQC A;  3IHP A;  1SNK A;  3O1G A;  3KKU A;  3IUT A;  4CDC B;  5CHV A;  5F02 A;  1SP4 B;  3KWB X;  1A6R A;  3U8E A;  2HH5 A;  2GFO A;  3HHI A;  4I07 A;  3H8C A;  3LXS A;  2E01 A;  2AVW A;  4MZO A;  2NQA A;  4OEM A;  1PBH A;  3OF8 A;  3TNX A;  1GMY A;  1XKG A;  2ACT A;  1GEC E;  1YK7 A;  4HWY A;  2P7U A;  1Y4H A;  3P5W A;  4DMX A;  1K3B B;  1NB5 A;  4PP1 A;  1MS6 A;  3WXG A;  1PE6 A;  3OIS A;  3E1Z B;  3QSD A;  1X9Y A;  3H89 A;  3BPF A;  3KFQ A;  3M99 A;  4XR7 A;  3CBJ A;  3I3T A;  2R6N A;  2PBH A;  1YAL A;  1U9W A;  1ME4 A;  1TLO A;  3IEJ A;  4N4Z A;  3IV2 A;  2R9F A;  4QRV A;  3MHH A;  1YVB A;  1O0E A;  1VSN A;  1MIR A;  2DCB A;  2C0Y A;  3RVV A;  2FT2 A;  2H7J A;  1KFU L;  2G8J A;  1MEG A;  6PAD A;  1TL9 A;  4QH6 A;  3F5V A;  4ZUX U;  2JQF R;  1PPD A;  2F7D A;  9PAP A;  2F1G A;  1AEC A;  4I04 A;  1CQD A;  1AYU A;  2YJ2 A;  2R9N A;  2NQG A;  3D6S A;  2HD5 A;  3V6C A;  1QOL A;  3KX1 A;  4PAD A;  1EWP A;  3V6E A;  1F2A A;  5A24 A;  1MHW A;  2PNS A;  2YJ9 A;  3H6S A;  1TU6 A;  2R9C A;  2P0R A;  3F75 A;  2AUX A;  4YYU A;  2Y5B A;  2XU3 A;  4P6E A;  2HHN A;  1VJV A;  2Y6E A;  1NPZ A;  3MOR A;  2CIO A;  4N79 A;  1U9Q X;  3K9M A;  1PIP A;  2HXZ A;  5CVM A;  1NB3 A;  4Q8G A;  1JQP A;  2AS8 A;  1ZIV A;  5EF4 A;  3IMA A;  3BPM A;  1AU4 A;  4BS6 A;  1BP4 A;  3ZUA A;  2VHS A;  3OVZ A;  2OUL A;  3K24 A;  2BDZ A;  4P6G A;  4YYW A;  7PCK A;  3KWZ A;  2G7Y A;  1CV8 A;  1HUC B;  2FRA A;  1U9V A;  1GLO A;  8PCH A;  2AYN A;  3KW9 A;  2E02 A;  2R9M A;  1EWO A;  3BC3 A;  2AUZ A;  1AIM A;  3PDF A;  2B1M A;  1THE A;  4BSQ A;  1BY8 A;  3O0U A;  3BOW A;  4I05 A;  4FIP A;  2XU1 A;  4K7C A;  1KHQ A;  3QT4 A;  1YK8 A;  3WXE A;  2P86 A;  5FPW A;  4RY2 A;  5JA7 A;  3N4C A;  4W5B A;  1GCB A;  3CBK A;  2FTD A;  3MHS A;  3IOQ A;  1U9X A;  4YVA A;  1STF E;  2AYO A;  3GCB A;  2AU1 A;  2DCC A;  1AU2 A;  2GHU A;  4N8W A;  1MDW A;  3WXF A;  1CPJ A;  1CS8 A;  4YYR A;  2BDL A;  4QBB A;  5CHT A;  4YYS A;  1F29 A;  1CVZ A;  4CDD B;  2G8E A;  2WBF X;  2DCA A;  3NHE A;  3PNR A;  2OP3 A;  2FYE A;  2IPP B;  1KXR A;  4PP2 E;  5PAD A;  1EWL A;  4DMY A;  4YYV A;  3RVX A;  1KFX L;  4BPV A;  3LFY A;  1PCI A;  3AI8 A;  4CDF B;  2R9O A;  1BGO A;  2ARY A;  2DCD A;  2IBI A;  3I06 A;  2OZ2 A;  1EWM A;  2PAD A;  5CVN B;  1QMY A;  3HWN A;  2FQ9 A;  2DZY A;  4X6J A;  3CH2 X;  1CTE A;  4CZW A; 
#chains in the Genus database with same CATH topology
 1PPP A;  1PXV A;  5K16 A;  4D8I A;  2FUD A;  3BCN A;  1AU3 A;  1DF0 A;  2DC7 A;  1U5I A;  4PI3 A;  3P5V A;  4AXM A;  4D8B A;  3ERV A;  3TMP A;  2NQD B;  2YJB A;  3DF0 A;  3MJ5 A;  3KSE A;  4Q8H A;  1BQI A;  3K8U A;  2DC9 A;  5CVO B;  2VHF A;  4MZS A;  1EF7 A;  3CH3 X;  4KLB A;  4X6H A;  2AIM A;  4QRX A;  1CJL A;  2DJF B;  3P5X A;  1QXP A;  2PRE A;  4AXL A;  2E03 A;  4XUI A;  3MTN A;  3TRK A;  4WUR A;  1ZCM A;  2O6X A;  1YT7 A;  2NQI A;  3C9E A;  3H7D A;  1S4V A;  4OEL A;  2FO5 A;  3BB7 A;  4X6I A;  2HWK A;  1IWD A;  2DJG B;  1PPO A;  4MSX A;  4M0W A;  3HHA A;  1ICF A;  4BS5 A;  1AYW A;  4FJC A;  2ATO A;  2CB5 A;  4G54 A;  2DZZ A;  4OW0 A;  3OVX A;  2E00 A;  2G6D A;  1PAD A;  1F2B A;  1POP A;  2XU5 A;  4FK5 A;  1CB5 A;  1PVJ A;  1MEM A;  1NLJ A;  3BBA A;  3BWK A;  1ITO A;  4W4U A;  5EGW A;  1ME3 A;  1CSB B;  1F2C A;  1PPN A;  1Q6K A;  3H8B A;  1Y08 A;  1DEU A;  5JH3 A;  2B1N A;  3S3Q A;  2FRQ A;  4CDE B;  4WA6 A;  3P5U A;  3N3G A;  3E9S A;  3OF9 A;  4RF1 A;  2YJC A;  3PT2 A;  2DC6 A;  2XU4 A;  3HD3 A;  1ATK A;  1AYV A;  3IFU A;  3PW3 A;  5J94 A;  1KHP A;  4QRG A;  3RNV A;  1FH0 A;  4D8E A;  1QDQ A;  4BQV A;  3B79 A;  1AU0 A;  3N3K A;  3PBH A;  3USV A;  4ZTB A;  3S3R A;  2JQG R;  2DC8 A;  2YJ8 A;  4W5C A;  4YV8 A;  3RVW A;  5KO3 A;  3QJ3 A;  4BOS A;  4YYQ A;  1M6D A;  1NL6 A;  1NQC A;  3IHP A;  1SNK A;  4RNA A;  3O1G A;  3KKU A;  3IUT A;  3W31 A;  4CDC B;  2J7Q C;  5CHV A;  5F02 A;  1SP4 B;  3KWB X;  1A6R A;  3U8E A;  3W30 A;  2HH5 A;  3B21 A;  2GFO A;  3HHI A;  4I07 A;  3H8C A;  3LXS A;  2E01 A;  2AVW A;  4MZO A;  3PRM A;  4MI7 A;  2NQA A;  4OEM A;  1PBH A;  4GUA A;  3MTV A;  3OF8 A;  3TNX A;  1GMY A;  1XKG A;  4HXD B;  2ACT A;  1GEC E;  1YK7 A;  4HWY A;  2P7U A;  1Y4H A;  3P5W A;  4DMX A;  1K3B B;  1NB5 A;  4PP1 A;  1MS6 A;  3WXG A;  1PE6 A;  3OIS A;  3E1Z B;  3QSD A;  1X9Y A;  3H89 A;  3BPF A;  4MM3 B;  3KFQ A;  4IP3 A;  3PRP A;  3M99 A;  4XR7 A;  3CBJ A;  3I3T A;  2R6N A;  2PBH A;  3PHU A;  1YAL A;  1U9W A;  1ME4 A;  1TLO A;  3IEJ A;  3OQC A;  4N4Z A;  2JRI A;  4RF0 A;  3IV2 A;  2R9F A;  4QRV A;  3MHH A;  1YVB A;  3PSE A;  1O0E A;  1VSN A;  1DKI A;  1MIR A;  1UKF A;  2DCB A;  2C0Y A;  3RVV A;  2FT2 A;  2H7J A;  1KFU L;  2G8J A;  1MEG A;  3ZNH A;  6PAD A;  1TL9 A;  4QH6 A;  3F5V A;  4ZUX U;  2JQF R;  4R3D A;  4A5U A;  1PPD A;  2F7D A;  2Z84 A;  9PAP A;  2F1G A;  1AEC A;  4I04 A;  4OVZ B;  1CQD A;  1AYU A;  2YJ2 A;  2R9N A;  2JTC A;  2NQG A;  3D6S A;  4BOZ A;  2HD5 A;  3V6C A;  1QOL A;  3KX1 A;  4PAD A;  1EWP A;  3V6E A;  3PHW A;  1F2A A;  5A24 A;  1MHW A;  2AGA A;  2PNS A;  2YJ9 A;  2DOS A;  3H6S A;  1TU6 A;  2R9C A;  2P0R A;  3F75 A;  2AUX A;  4YYU A;  2Y5B A;  2XU3 A;  4P6E A;  2BTW A;  2HHN A;  1VJV A;  2Y6E A;  1NPZ A;  3MOR A;  2CIO A;  4N79 A;  4XZX A;  1U9Q X;  3K9M A;  1PIP A;  2HXZ A;  5CVM A;  1NB3 A;  3C0R A;  4Q8G A;  3O65 A;  1JQP A;  2AS8 A;  1ZIV A;  5EF4 A;  3IMA A;  3BPM A;  1AU4 A;  4BS6 A;  1BP4 A;  3ZUA A;  2VHS A;  5EZQ A;  5EZS A;  3OVZ A;  2OUL A;  3K24 A;  2BDZ A;  4RKX A;  4P6G A;  4YYW A;  7PCK A;  3KWZ A;  2G7Y A;  4BOU A;  1CV8 A;  1HUC B;  2FRA A;  1U9V A;  1GLO A;  8PCH A;  2AYN A;  3KW9 A;  5E6J A;  2E02 A;  2R9M A;  3MP2 A;  1EWO A;  3BC3 A;  4BOQ A;  2AUZ A;  1AIM A;  3PDF A;  2B1M A;  1THE A;  4BSQ A;  1BY8 A;  3O0U A;  3BOW A;  4I05 A;  4FIP A;  2XU1 A;  4K7C A;  1KHQ A;  3QT4 A;  1YK8 A;  2BTW B;  4IUM A;  3WXE A;  4BOP A;  2P86 A;  3BY4 A;  5FPW A;  4RY2 A;  5JA7 A;  3N4C A;  4W5B A;  2BU3 A;  1GCB A;  3CBK A;  2FTD A;  5JZE A;  3MHS A;  3IOQ A;  1U9X A;  4YVA A;  4PT5 A;  1STF E;  2AYO A;  3GCB A;  2AU1 A;  2DCC A;  1AU2 A;  2GHU A;  4N8W A;  1MDW A;  3WXF A;  1CPJ A;  1CS8 A;  4YYR A;  2BDL A;  2UZJ A;  4QBB A;  3PHX A;  5CHT A;  4YYS A;  2FE8 A;  1F29 A;  1CVZ A;  4CDD B;  2G8E A;  2WBF X;  2DCA A;  3NHE A;  4REZ A;  3PNR A;  2OP3 A;  2FYE A;  2IPP B;  1KXR A;  4P16 A;  4PP2 E;  1EWL A;  1YZB A;  5PAD A;  4DMY A;  4YYV A;  3RVX A;  1KFX L;  4BPV A;  3LFY A;  1PCI A;  3AI8 A;  4CDF B;  4OVZ A;  2R9O A;  1BGO A;  2ARY A;  2J7Q A;  2DCD A;  2IBI A;  3I06 A;  2OZ2 A;  1EWM A;  2PAD A;  5CVN B;  1QMY A;  3HWN A;  2FQ9 A;  2DZY A;  4X6J A;  3CH2 X;  1CTE A;  4CZW A; 
#chains in the Genus database with same CATH homology
 1PPP A;  1PXV A;  5K16 A;  2FUD A;  3BCN A;  1AU3 A;  1DF0 A;  2DC7 A;  1U5I A;  4PI3 A;  3P5V A;  4AXM A;  3ERV A;  2NQD B;  2YJB A;  3DF0 A;  3KSE A;  4Q8H A;  1BQI A;  3K8U A;  2DC9 A;  5CVO B;  2VHF A;  4MZS A;  1EF7 A;  3CH3 X;  4KLB A;  4X6H A;  2AIM A;  4QRX A;  1CJL A;  2DJF B;  3P5X A;  1QXP A;  2PRE A;  4AXL A;  2E03 A;  4XUI A;  3MTN A;  1ZCM A;  2O6X A;  1YT7 A;  2NQI A;  3C9E A;  3H7D A;  1S4V A;  4OEL A;  2FO5 A;  4X6I A;  1IWD A;  2DJG B;  1PPO A;  4MSX A;  3HHA A;  1ICF A;  4BS5 A;  1AYW A;  4FJC A;  2ATO A;  2CB5 A;  4G54 A;  2DZZ A;  3OVX A;  2E00 A;  2G6D A;  1PAD A;  1F2B A;  1POP A;  2XU5 A;  4FK5 A;  1CB5 A;  1MEM A;  1NLJ A;  3BWK A;  4W4U A;  1ITO A;  5EGW A;  1ME3 A;  1CSB B;  1F2C A;  1PPN A;  1Q6K A;  3H8B A;  1Y08 A;  1DEU A;  5JH3 A;  2B1N A;  3S3Q A;  2FRQ A;  4CDE B;  4WA6 A;  3P5U A;  3N3G A;  3OF9 A;  2YJC A;  2DC6 A;  2XU4 A;  3HD3 A;  1ATK A;  1AYV A;  3PW3 A;  5J94 A;  1KHP A;  4QRG A;  1FH0 A;  1QDQ A;  4NV8 A;  4BQV A;  3B79 A;  1AU0 A;  3N3K A;  3PBH A;  3USV A;  4B55 A;  3S3R A;  2JQG R;  4NV7 A;  2DC8 A;  2YJ8 A;  4W5C A;  4YV8 A;  3RVW A;  3QJ3 A;  4YYQ A;  1M6D A;  1NL6 A;  1NQC A;  3IHP A;  1SNK A;  3O1G A;  3KKU A;  3IUT A;  4CDC B;  5CHV A;  5F02 A;  1SP4 B;  4GUZ A;  3KWB X;  1A6R A;  3U8E A;  2HH5 A;  2GFO A;  3HHI A;  4I07 A;  3H8C A;  3LXS A;  2E01 A;  2AVW A;  3D9W A;  4MZO A;  2NQA A;  4OEM A;  1PBH A;  3OF8 A;  3TNX A;  1GMY A;  1XKG A;  2ACT A;  1W4T A;  1GEC E;  1YK7 A;  4HWY A;  2P7U A;  1Y4H A;  3P5W A;  4DMX A;  1K3B B;  1NB5 A;  4PP1 A;  1MS6 A;  3WXG A;  1PE6 A;  4BGF A;  3OIS A;  3E1Z B;  3QSD A;  1X9Y A;  3H89 A;  3BPF A;  3KFQ A;  3M99 A;  4XR7 A;  3CBJ A;  3I3T A;  2R6N A;  1W5R A;  2PBH A;  1YAL A;  1U9W A;  1E2T A;  1ME4 A;  1TLO A;  3IEJ A;  1GX3 A;  4N4Z A;  3IV2 A;  2R9F A;  4QRV A;  3MHH A;  1YVB A;  1O0E A;  3LTW A;  1VSN A;  1MIR A;  2DCB A;  2C0Y A;  3RVV A;  2FT2 A;  2H7J A;  1KFU L;  2G8J A;  1MEG A;  6PAD A;  1TL9 A;  4QH6 A;  3F5V A;  4ZUX U;  2JQF R;  1PPD A;  2F7D A;  9PAP A;  2F1G A;  1AEC A;  4I04 A;  1CQD A;  1AYU A;  2YJ2 A;  2R9N A;  2NQG A;  3D6S A;  2HD5 A;  3V6C A;  1QOL A;  3KX1 A;  4PAD A;  1EWP A;  3V6E A;  1F2A A;  5A24 A;  1MHW A;  2PNS A;  2YJ9 A;  3H6S A;  1TU6 A;  2R9C A;  2P0R A;  3F75 A;  2AUX A;  4YYU A;  2Y5B A;  2XU3 A;  4P6E A;  2HHN A;  1VJV A;  2Y6E A;  1NPZ A;  3MOR A;  2CIO A;  4N79 A;  1U9Q X;  3K9M A;  1PIP A;  2HXZ A;  5CVM A;  1NB3 A;  4Q8G A;  1JQP A;  2AS8 A;  1ZIV A;  5EF4 A;  3IMA A;  3BPM A;  1AU4 A;  4BS6 A;  1BP4 A;  3ZUA A;  2VHS A;  3OVZ A;  2OUL A;  3K24 A;  2BDZ A;  4P6G A;  4YYW A;  7PCK A;  3KWZ A;  2G7Y A;  1CV8 A;  1HUC B;  2FRA A;  1U9V A;  1GLO A;  8PCH A;  2AYN A;  3KW9 A;  2E02 A;  2R9M A;  1EWO A;  3BC3 A;  2AUZ A;  1AIM A;  3PDF A;  2B1M A;  1THE A;  4BSQ A;  1BY8 A;  3O0U A;  3BOW A;  4I05 A;  4FIP A;  2XU1 A;  4K7C A;  1KHQ A;  3QT4 A;  1W6F A;  1YK8 A;  3WXE A;  2P86 A;  5FPW A;  4RY2 A;  5JA7 A;  3N4C A;  4W5B A;  1GCB A;  3CBK A;  2FTD A;  3MHS A;  3IOQ A;  1U9X A;  4YVA A;  1STF E;  2AYO A;  3GCB A;  2AU1 A;  2VFC A;  2DCC A;  1AU2 A;  2GHU A;  4N8W A;  1MDW A;  3WXF A;  1CPJ A;  1CS8 A;  4YYR A;  2BDL A;  4QBB A;  5CHT A;  4YYS A;  2BSZ A;  4C5P A;  1F29 A;  1CVZ A;  4CDD B;  2G8E A;  2WBF X;  2DCA A;  3NHE A;  3PNR A;  2OP3 A;  2FYE A;  2IPP B;  2VFB A;  1KXR A;  4PP2 E;  1EWL A;  5PAD A;  4DMY A;  4YYV A;  3RVX A;  1KFX L;  4BPV A;  3LFY A;  1PCI A;  3AI8 A;  4CDF B;  2R9O A;  1BGO A;  2ARY A;  2DCD A;  2IBI A;  3I06 A;  2OZ2 A;  1EWM A;  2PAD A;  5CVN B;  1QMY A;  3HWN A;  2FQ9 A;  2DZY A;  4X6J A;  3CH2 X;  1CTE A;  4CZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...