1O0EA

1.9 angstrom crystal structure of a plant cysteine protease ervatamin c
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
208
structure length
208
Chain Sequence
LPEQIDWRKKGAVTPVKNQGSCGSCWAFSTVSTVESINQIRTGNLISLSEQELVDCDKKNHGCLGGAFVFAYQYIINNGGIDTQANYPYKAVQGPCQAASKVVSIDGYNGVPFCNEXALKQAVAVQPSTVAIDASSAQFQQYSSGIFSGPCGTKLNHGVTIVGYQANYWIVRNSWGRYWGEKGYIRMLRVGGCGLCGIARLPYYPTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ervatamin C
publication title Structural Basis of the Unusual Stability and Substrate Specificity of Ervatamin C, a Plant Cysteine Protease from Ervatamia coronaria
pubmed doi rcsb
total genus 68
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1o0eA00
3DF0A 4QRGA 2B1NA 3HHAA 3OISA 1QDQA 2E02A 2P0RA 5EF4A 4XR7A 1CSBB 3TNXA 3OVXA 3MTNA 3BWKA 4PADA 2ACTA 2G6DA 3RVXA 2PADA 3U8EA 4BS5A 3F5VA 3K9MA 4CDDB 1ZCMA 3MORA 1U5IA 2ARYA 1U9WA 4YV8A 3CH2X 4KLBA 1ME4A 3KFQA 1YK7A 1GLOA 3PNRA 2DJFB 1ICFA 1MHWA 2F7DA 2NQDB 1MIRA 2BDLA 2AUZA 3NHEA 1KXRA 1U9VA 1U9QX 2JQFR 3N4CA 2YJ9A 3MHHA 1F2BA 2R9FA 3O1GA 2NQGA 2IPPB 1DEUA 8PCHA 3S3RA 3KSEA 2DJGB 2XU4A 2XU1A 3IUTA 4BS6A 4P6EA 1PBHA 1X9YA 1AIMA 3KWZA 3BOWA 4X6HA 4MSXA 1KFXL 1AU2A 2FRAA 2FYEA 3I3TA 2AYNA 2NQIA 1PPNA 2DC9A 3P5WA 2FTDA 3ERVA 3RVWA 3BC3A 9PAPA 1A6RA 2PREA 1POPA 4CDEB 1PIPA 6PADA 4OEMA 4W5CA 1PPDA 3BPFA 3P5UA 1NB5A 4P6GA 4BPVA 3B79A 4W4UA 3OF9A 5F02A 4CDCB 4OELA 2AVWA 1U9XA 3V6CA 2WBFX 2YJCA 3LFYA 2F1GA 1Y08A 4CDFB 2DCCA 4K7CA 4N4ZA 3H89A 3PW3A 3ZUAA 3V6EA 1AU3A 4PI3A 3N3KA 3HD3A 2P7UA 2CIOA 1ITOA 4WA6A 3KX1A 1CB5A 4YYSA 1PCIA 2FUDA 2JQGR 1CS8A 2FO5A 1GCBA 1PADA 2DCAA 3HWNA 1KFUL 5CVMA 1K3BB 4RY2A 3BPMA 3C9EA 1YVBA 1AYWA 1AYVA 1VJVA 2HH5A 1EWPA 4FJCA 2GHUA 2B1MA 3H6SA 4I07A 1NLJA 3QSDA 4QRVA 5FPWA 2VHFA 1PPPA 2NQAA 3KKUA 1NL6A 4CZWA 2BDZA 1TLOA 2AU1A 1BQIA 1F2AA 2AS8A 1CV8A 2YJ8A 2P86A 2ATOA 2XU5A 1SNKA 1STFE 5J94A 1EWOA 3I06A 3QT4A 1MS6A 1KHQA 5K16A 4N8WA 2IBIA 1AU0A 3BCNA 3H8CA 2DC7A 4YVAA 3IHPA 3WXGA 2GFOA 3HHIA 4YYWA 1BGOA 1AECA 2Y5BA 1EWLA 5EGWA 1XKGA 3M99A 2HHNA 2Y6EA 3WXEA 1CPJA 2XU3A 3IOQA 3E1ZB 1IWDA 2G7YA 3PDFA 1F2CA 1PE6A 1TU6A 1DF0A 4BQVA 4PP2E 3OVZA 3P5XA 2PBHA 3K8UA 1YALA 3GCBA 4PP1A 1M6DA 1QMYA 4X6IA 2YJ2A 4DMXA 2DC8A 1EWMA 4HWYA 3O0UA 5JH3A 2DZYA 3PBHA 4I04A 1CTEA 1YK8A 2HD5A 4YYVA 4BSQA 2E00A 1ZIVA 4Q8GA 1NQCA 4MZSA 1KHPA 5PADA 3P5VA 4YYUA 1ATKA 3D6SA 3CBJA 2HXZA 5CHVA 1NPZA 3OF8A 2DCBA 1SP4B 2O6XA 1MEGA 3WXFA 2OULA 4YYQA 4X6JA 1QOLA 4QRXA 2VHSA 2R9NA 2R9OA 1THEA 2FT2A 5CVOB 4AXLA 2E03A 2AYOA 4YYRA 1GECE 4ZUXU 4FIPA 1BY8A 1CJLA 3AI8A 4XUIA 4MZOA 5JA7A 3IV2A 4DMYA 3KW9A 2FQ9A 2H7JA 1AYUA 3CBKA 3KWBX 3H7DA 2AUXA 1TL9A 1YT7A 2E01A 7PCKA 1MEMA 1O0EA 1QXPA 2PNSA 3CH3X 3H8BA 4AXMA 4W5BA 3IEJA 1PPOA 1Q6KA 1PXVA 5CVNB 2G8JA 4FK5A 5A24A 2R6NA 3N3GA 5CHTA 1GMYA 2DC6A 2OZ2A 3F75A 3IMAA 1MDWA 4G54A 1CQDA 1NB3A 3S3QA 1Y4HA 2C0YA 1ME3A 2OP3A 1HUCB 2FRQA 3MHSA 3QJ3A 3RVVA 2R9MA 3K24A 4I05A 1CVZA 1VSNA 1S4VA 2G8EA 1JQPA 2DCDA 1FH0A 1F29A 2YJBA 2DZZA 1EF7A 3USVA 1BP4A 2CB5A 1AU4A 4Q8HA 2R9CA 2AIMA 3LXSA 4N79A 4QH6A 4QBBA
chains in the Genus database with same CATH superfamily
3DF0A 4QRGA 2B1NA 3HHAA 3OISA 1QDQA 2E02A 2P0RA 5EF4A 4XR7A 1CSBB 3TNXA 3OVXA 3MTNA 3BWKA 4PADA 2ACTA 2G6DA 3RVXA 2PADA 3U8EA 4BS5A 3F5VA 3K9MA 4CDDB 1ZCMA 3MORA 1U5IA 2ARYA 1U9WA 4YV8A 3CH2X 4KLBA 4BOPA 1ME4A 3KFQA 2JRIA 1YK7A 4PT5A 1GLOA 3PNRA 2DJFB 1DKIA 1ICFA 1MHWA 2F7DA 2NQDB 3MTVA 1MIRA 2BDLA 2AUZA 3NHEA 3RNVA 1KXRA 1U9VA 1U9QX 2JQFR 3N4CA 2YJ9A 3MHHA 1F2BA 2R9FA 2DOSA 3O1GA 4MM3B 2NQGA 2IPPB 4RF1A 1DEUA 8PCHA 3S3RA 3TMPA 3KSEA 2DJGB 4GUAA 2XU4A 2XU1A 3MJ5A 3IUTA 4BS6A 4P6EA 1PBHA 1X9YA 1AIMA 3KWZA 3BOWA 4X6HA 1KFXL 1AU2A 4MSXA 2FRAA 2FYEA 2HWKA 2BU3A 3I3TA 2AYNA 2NQIA 1PPNA 3PRMA 3BB7A 2DC9A 3P5WA 2FTDA 3ERVA 3RVWA 3E9SA 3PHWA 3BC3A 9PAPA 1A6RA 2PREA 1POPA 1YZBA 4CDEB 1PIPA 6PADA 4REZA 4OEMA 4W5CA 1PPDA 3BPFA 3P5UA 1NB5A 3W30A 2FE8A 4P6GA 2Z84A 4BPVA 3B79A 4W4UA 3OF9A 5F02A 4CDCB 4OELA 2AVWA 1U9XA 3V6CA 2WBFX 2YJCA 3LFYA 2F1GA 1Y08A 4CDFB 2DCCA 4K7CA 4N4ZA 3H89A 3PW3A 3ZUAA 3V6EA 1AU3A 4PI3A 3N3KA 3HD3A 2P7UA 2CIOA 1ITOA 4IP3A 4WA6A 3KX1A 1CB5A 4YYSA 1PCIA 2FUDA 2JQGR 1CS8A 5EZQA 2FO5A 2J7QA 1GCBA 1PADA 2DCAA 3HWNA 1KFUL 5CVMA 1K3BB 4RY2A 3BPMA 3C9EA 1YVBA 1AYWA 1AYVA 3PSEA 4BOUA 4D8BA 1VJVA 2HH5A 1EWPA 2J7QC 4FJCA 2GHUA 2B1MA 3H6SA 4I07A 1NLJA 3QSDA 4QRVA 5FPWA 2VHFA 1PPPA 2NQAA 3PHXA 3KKUA 1NL6A 4CZWA 2BDZA 1TLOA 2AU1A 3PHUA 1BQIA 1F2AA 2AS8A 1CV8A 2YJ8A 4XZXA 2P86A 2ATOA 2XU5A 1SNKA 1STFE 3BBAA 1EWOA 2BTWA 5J94A 3I06A 4ZTBA 3QT4A 1MS6A 4OVZA 3PT2A 1UKFA 1KHQA 5K16A 4N8WA 2IBIA 3ZNHA 1AU0A 3BCNA 3H8CA 3B21A 2DC7A 4BOZA 4YVAA 3IHPA 3WXGA 2GFOA 3HHIA 4YYWA 1BGOA 1AECA 2Y5BA 1EWLA 5EGWA 1XKGA 4BOSA 3M99A 2HHNA 2Y6EA 3WXEA 1CPJA 2XU3A 3IOQA 4IUMA 3E1ZB 1IWDA 2G7YA 3PDFA 1F2CA 1PE6A 1TU6A 1DF0A 4BQVA 4PP2E 3OVZA 3P5XA 2PBHA 3K8UA 1YALA 3GCBA 3W31A 4PP1A 1M6DA 1QMYA 4X6IA 2YJ2A 4DMXA 2DC8A 1EWMA 4HWYA 3O0UA 5JH3A 2DZYA 3IFUA 3PBHA 4I04A 1CTEA 1YK8A 2HD5A 4YYVA 4BSQA 2E00A 1ZIVA 4Q8GA 1NQCA 4MZSA 1KHPA 4WURA 3P5VA 5PADA 4YYUA 1ATKA 3D6SA 3C0RA 3CBJA 2HXZA 5CHVA 3OF8A 1NPZA 4A5UA 2DCBA 1SP4B 2O6XA 1MEGA 3WXFA 2OULA 4YYQA 3OQCA 4X6JA 3MP2A 2UZJA 1QOLA 4QRXA 2VHSA 2R9NA 4R3DA 2R9OA 1THEA 2FT2A 5CVOB 4AXLA 2E03A 4HXDB 2AYOA 4YYRA 1GECE 4P16A 4ZUXU 4FIPA 1BY8A 1CJLA 3AI8A 4XUIA 4MZOA 4OW0A 5JA7A 3IV2A 4DMYA 1PVJA 3KW9A 2FQ9A 2H7JA 1AYUA 3CBKA 3KWBX 3PRPA 4M0WA 3H7DA 2AUXA 1TL9A 1YT7A 2E01A 7PCKA 1MEMA 1O0EA 4BOQA 1QXPA 2PNSA 3CH3X 3H8BA 4AXMA 4W5BA 3IEJA 1PPOA 3TRKA 5E6JA 1Q6KA 1PXVA 5CVNB 2G8JA 4FK5A 5A24A 4D8IA 2R6NA 3N3GA 5CHTA 1GMYA 2DC6A 2OZ2A 3F75A 3IMAA 4RF0A 1MDWA 4G54A 1CQDA 1NB3A 3S3QA 1Y4HA 2C0YA 1ME3A 3BY4A 2OP3A 2AGAA 1HUCB 2FRQA 3MHSA 3QJ3A 3RVVA 2R9MA 3K24A 4I05A 1CVZA 1VSNA 4D8EA 5KO3A 1S4VA 2BTWB 2G8EA 4OVZB 2JTCA 4RKXA 5JZEA 1JQPA 4RNAA 2DCDA 4MI7A 1FH0A 1F29A 2YJBA 2DZZA 1EF7A 3USVA 3O65A 1BP4A 2CB5A 1AU4A 4Q8HA 2R9CA 2AIMA 3LXSA 4N79A 4QH6A 4QBBA 5EZSA
chains in the Genus database with same CATH topology
3DF0A 4QRGA 2B1NA 3HHAA 3OISA 1QDQA 2E02A 2P0RA 5EF4A 4XR7A 1CSBB 3TNXA 3OVXA 3MTNA 3BWKA 4PADA 2ACTA 2VFBA 2G6DA 3RVXA 2PADA 3U8EA 4BS5A 1E2TA 3F5VA 1GX3A 3K9MA 4CDDB 4NV8A 1ZCMA 3MORA 1U5IA 2ARYA 1U9WA 4YV8A 3CH2X 4KLBA 1ME4A 3KFQA 4B55A 1YK7A 1GLOA 3PNRA 2DJFB 1ICFA 1MHWA 2F7DA 2NQDB 1MIRA 2BDLA 2AUZA 3NHEA 1KXRA 1U9VA 1U9QX 2JQFR 3N4CA 2YJ9A 3MHHA 1F2BA 2R9FA 3O1GA 2NQGA 2IPPB 1DEUA 8PCHA 3S3RA 3KSEA 2DJGB 2XU4A 2XU1A 3IUTA 4BS6A 4P6EA 1PBHA 1X9YA 1AIMA 3KWZA 3BOWA 4X6HA 4MSXA 1KFXL 1AU2A 1W4TA 2FRAA 2FYEA 3I3TA 2AYNA 2NQIA 1PPNA 2DC9A 3P5WA 2FTDA 3ERVA 3RVWA 3BC3A 9PAPA 1A6RA 2PREA 1POPA 4CDEB 1PIPA 3LTWA 6PADA 4C5PA 4OEMA 4W5CA 1PPDA 3BPFA 3P5UA 1NB5A 4P6GA 4BPVA 3B79A 4W4UA 3OF9A 5F02A 4CDCB 4OELA 2AVWA 4QBBA 1U9XA 3V6CA 2WBFX 2YJCA 3LFYA 2F1GA 1Y08A 4CDFB 2DCCA 4K7CA 4N4ZA 3H89A 3PW3A 3ZUAA 3V6EA 1AU3A 4PI3A 3N3KA 3HD3A 2P7UA 2CIOA 1ITOA 4WA6A 3KX1A 1CB5A 4YYSA 1PCIA 2FUDA 2JQGR 1CS8A 2FO5A 1GCBA 1PADA 2DCAA 3HWNA 1KFUL 5CVMA 1K3BB 4RY2A 3BPMA 3C9EA 3D9WA 1YVBA 1AYWA 1AYVA 1VJVA 2HH5A 1EWPA 4FJCA 2GHUA 2B1MA 3H6SA 4I07A 1NLJA 3QSDA 4QRVA 5FPWA 2VHFA 1PPPA 2NQAA 3KKUA 1NL6A 4CZWA 2BDZA 1TLOA 2AU1A 1BQIA 1F2AA 2AS8A 1CV8A 2YJ8A 2P86A 2ATOA 2XU5A 1SNKA 4BGFA 1STFE 5J94A 1EWOA 3I06A 3QT4A 1MS6A 1KHQA 5K16A 4N8WA 2IBIA 1AU0A 3BCNA 3H8CA 2DC7A 4YVAA 3IHPA 3WXGA 2GFOA 3HHIA 4YYWA 1BGOA 1AECA 2Y5BA 1EWLA 5EGWA 1XKGA 3M99A 2HHNA 2Y6EA 3WXEA 1CPJA 2XU3A 3IOQA 3E1ZB 1IWDA 2G7YA 3PDFA 1F2CA 1PE6A 1TU6A 1DF0A 4BQVA 4PP2E 3OVZA 3P5XA 2PBHA 3K8UA 1YALA 3GCBA 4PP1A 1M6DA 1QMYA 4X6IA 2YJ2A 4DMXA 2DC8A 1EWMA 4HWYA 3O0UA 5JH3A 2DZYA 3PBHA 4I04A 1CTEA 1YK8A 2HD5A 4YYVA 4BSQA 2E00A 1ZIVA 4Q8GA 1NQCA 4MZSA 1KHPA 5PADA 3P5VA 4YYUA 1ATKA 3D6SA 1W6FA 3CBJA 2HXZA 5CHVA 1NPZA 3OF8A 2DCBA 1SP4B 2O6XA 1MEGA 3WXFA 2OULA 4YYQA 4X6JA 4NV7A 1QOLA 4QRXA 2VHSA 2R9NA 2R9OA 1THEA 2FT2A 5CVOB 4AXLA 2E03A 2AYOA 4YYRA 1GECE 2BSZA 4ZUXU 4FIPA 1BY8A 1CJLA 3AI8A 4XUIA 4MZOA 5JA7A 3IV2A 4DMYA 3KW9A 2FQ9A 2H7JA 1AYUA 2VFCA 3CBKA 3KWBX 3H7DA 2AUXA 1TL9A 1YT7A 2E01A 7PCKA 1MEMA 1O0EA 1QXPA 2PNSA 3CH3X 3H8BA 4AXMA 4W5BA 3IEJA 1PPOA 1Q6KA 1PXVA 5CVNB 2G8JA 4FK5A 5A24A 2R6NA 3N3GA 5CHTA 1GMYA 2DC6A 2OZ2A 3F75A 3IMAA 4GUZA 1MDWA 4G54A 1CQDA 1NB3A 3S3QA 1Y4HA 2C0YA 1ME3A 2OP3A 1HUCB 2FRQA 3MHSA 3QJ3A 3RVVA 2R9MA 3K24A 4I05A 1CVZA 1VSNA 1S4VA 2G8EA 1JQPA 2DCDA 1FH0A 1F29A 2YJBA 2DZZA 1EF7A 3USVA 1BP4A 2CB5A 1AU4A 4Q8HA 2R9CA 2AIMA 3LXSA 4N79A 4QH6A 1W5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DF0 A;  4QRG A;  2B1N A;  3HHA A;  3OIS A;  1QDQ A;  2E02 A;  2P0R A;  5EF4 A;  4XR7 A;  1CSB B;  3TNX A;  3OVX A;  3MTN A;  3BWK A;  4PAD A;  2ACT A;  2G6D A;  3RVX A;  2PAD A;  3U8E A;  4BS5 A;  3F5V A;  3K9M A;  4CDD B;  1ZCM A;  3MOR A;  1U5I A;  2ARY A;  1U9W A;  4YV8 A;  3CH2 X;  4KLB A;  1ME4 A;  3KFQ A;  1YK7 A;  1GLO A;  3PNR A;  2DJF B;  1ICF A;  1MHW A;  2F7D A;  2NQD B;  1MIR A;  2BDL A;  2AUZ A;  3NHE A;  1KXR A;  1U9V A;  1U9Q X;  2JQF R;  3N4C A;  2YJ9 A;  3MHH A;  1F2B A;  2R9F A;  3O1G A;  2NQG A;  2IPP B;  1DEU A;  8PCH A;  3S3R A;  3KSE A;  2DJG B;  2XU4 A;  2XU1 A;  3IUT A;  4BS6 A;  4P6E A;  1PBH A;  1X9Y A;  1AIM A;  3KWZ A;  3BOW A;  4X6H A;  4MSX A;  1KFX L;  1AU2 A;  2FRA A;  2FYE A;  3I3T A;  2AYN A;  2NQI A;  1PPN A;  2DC9 A;  3P5W A;  2FTD A;  3ERV A;  3RVW A;  3BC3 A;  9PAP A;  1A6R A;  2PRE A;  1POP A;  4CDE B;  1PIP A;  6PAD A;  4OEM A;  4W5C A;  1PPD A;  3BPF A;  3P5U A;  1NB5 A;  4P6G A;  4BPV A;  3B79 A;  4W4U A;  3OF9 A;  5F02 A;  4CDC B;  4OEL A;  2AVW A;  1U9X A;  3V6C A;  2WBF X;  2YJC A;  3LFY A;  2F1G A;  1Y08 A;  4CDF B;  2DCC A;  4K7C A;  4N4Z A;  3H89 A;  3PW3 A;  3ZUA A;  3V6E A;  1AU3 A;  4PI3 A;  3N3K A;  3HD3 A;  2P7U A;  2CIO A;  1ITO A;  4WA6 A;  3KX1 A;  1CB5 A;  4YYS A;  1PCI A;  2FUD A;  2JQG R;  1CS8 A;  2FO5 A;  1GCB A;  1PAD A;  2DCA A;  3HWN A;  1KFU L;  5CVM A;  1K3B B;  4RY2 A;  3BPM A;  3C9E A;  1YVB A;  1AYW A;  1AYV A;  1VJV A;  2HH5 A;  1EWP A;  4FJC A;  2GHU A;  2B1M A;  3H6S A;  4I07 A;  1NLJ A;  3QSD A;  4QRV A;  5FPW A;  2VHF A;  1PPP A;  2NQA A;  3KKU A;  1NL6 A;  4CZW A;  2BDZ A;  1TLO A;  2AU1 A;  1BQI A;  1F2A A;  2AS8 A;  1CV8 A;  2YJ8 A;  2P86 A;  2ATO A;  2XU5 A;  1SNK A;  1STF E;  5J94 A;  1EWO A;  3I06 A;  3QT4 A;  1MS6 A;  1KHQ A;  5K16 A;  4N8W A;  2IBI A;  1AU0 A;  3BCN A;  3H8C A;  2DC7 A;  4YVA A;  3IHP A;  3WXG A;  2GFO A;  3HHI A;  4YYW A;  1BGO A;  1AEC A;  2Y5B A;  1EWL A;  5EGW A;  1XKG A;  3M99 A;  2HHN A;  2Y6E A;  3WXE A;  1CPJ A;  2XU3 A;  3IOQ A;  3E1Z B;  1IWD A;  2G7Y A;  3PDF A;  1F2C A;  1PE6 A;  1TU6 A;  1DF0 A;  4BQV A;  4PP2 E;  3OVZ A;  3P5X A;  2PBH A;  3K8U A;  1YAL A;  3GCB A;  4PP1 A;  1M6D A;  1QMY A;  4X6I A;  2YJ2 A;  4DMX A;  2DC8 A;  1EWM A;  4HWY A;  3O0U A;  5JH3 A;  2DZY A;  3PBH A;  4I04 A;  1CTE A;  1YK8 A;  2HD5 A;  4YYV A;  4BSQ A;  2E00 A;  1ZIV A;  4Q8G A;  1NQC A;  4MZS A;  1KHP A;  5PAD A;  3P5V A;  4YYU A;  1ATK A;  3D6S A;  3CBJ A;  2HXZ A;  5CHV A;  1NPZ A;  3OF8 A;  2DCB A;  1SP4 B;  2O6X A;  1MEG A;  3WXF A;  2OUL A;  4YYQ A;  4X6J A;  1QOL A;  4QRX A;  2VHS A;  2R9N A;  2R9O A;  1THE A;  2FT2 A;  5CVO B;  4AXL A;  2E03 A;  2AYO A;  4YYR A;  1GEC E;  4ZUX U;  4FIP A;  1BY8 A;  1CJL A;  3AI8 A;  4XUI A;  4MZO A;  5JA7 A;  3IV2 A;  4DMY A;  3KW9 A;  2FQ9 A;  2H7J A;  1AYU A;  3CBK A;  3KWB X;  3H7D A;  2AUX A;  1TL9 A;  1YT7 A;  2E01 A;  7PCK A;  1MEM A;  1O0E A;  1QXP A;  2PNS A;  3CH3 X;  3H8B A;  4AXM A;  4W5B A;  3IEJ A;  1PPO A;  1Q6K A;  1PXV A;  5CVN B;  2G8J A;  4FK5 A;  5A24 A;  2R6N A;  3N3G A;  5CHT A;  1GMY A;  2DC6 A;  2OZ2 A;  3F75 A;  3IMA A;  1MDW A;  4G54 A;  1CQD A;  1NB3 A;  3S3Q A;  1Y4H A;  2C0Y A;  1ME3 A;  2OP3 A;  1HUC B;  2FRQ A;  3MHS A;  3QJ3 A;  3RVV A;  2R9M A;  3K24 A;  4I05 A;  1CVZ A;  1VSN A;  1S4V A;  2G8E A;  1JQP A;  2DCD A;  1FH0 A;  1F29 A;  2YJB A;  2DZZ A;  1EF7 A;  3USV A;  1BP4 A;  2CB5 A;  1AU4 A;  4Q8H A;  2R9C A;  2AIM A;  3LXS A;  4N79 A;  4QH6 A;  4QBB A; 
#chains in the Genus database with same CATH topology
 3DF0 A;  4QRG A;  2B1N A;  3HHA A;  3OIS A;  1QDQ A;  2E02 A;  2P0R A;  5EF4 A;  4XR7 A;  1CSB B;  3TNX A;  3OVX A;  3MTN A;  3BWK A;  4PAD A;  2ACT A;  2G6D A;  3RVX A;  2PAD A;  3U8E A;  4BS5 A;  3F5V A;  3K9M A;  4CDD B;  1ZCM A;  3MOR A;  1U5I A;  2ARY A;  1U9W A;  4YV8 A;  3CH2 X;  4KLB A;  4BOP A;  1ME4 A;  3KFQ A;  2JRI A;  1YK7 A;  4PT5 A;  1GLO A;  3PNR A;  2DJF B;  1DKI A;  1ICF A;  1MHW A;  2F7D A;  2NQD B;  3MTV A;  1MIR A;  2BDL A;  2AUZ A;  3NHE A;  3RNV A;  1KXR A;  1U9V A;  1U9Q X;  2JQF R;  3N4C A;  2YJ9 A;  3MHH A;  1F2B A;  2R9F A;  2DOS A;  3O1G A;  4MM3 B;  2NQG A;  2IPP B;  4RF1 A;  1DEU A;  8PCH A;  3S3R A;  3TMP A;  3KSE A;  2DJG B;  4GUA A;  2XU4 A;  2XU1 A;  3MJ5 A;  3IUT A;  4BS6 A;  4P6E A;  1PBH A;  1X9Y A;  1AIM A;  3KWZ A;  3BOW A;  4X6H A;  1KFX L;  1AU2 A;  4MSX A;  2FRA A;  2FYE A;  2HWK A;  2BU3 A;  3I3T A;  2AYN A;  2NQI A;  1PPN A;  3PRM A;  3BB7 A;  2DC9 A;  3P5W A;  2FTD A;  3ERV A;  3RVW A;  3E9S A;  3PHW A;  3BC3 A;  9PAP A;  1A6R A;  2PRE A;  1POP A;  1YZB A;  4CDE B;  1PIP A;  6PAD A;  4REZ A;  4OEM A;  4W5C A;  1PPD A;  3BPF A;  3P5U A;  1NB5 A;  3W30 A;  2FE8 A;  4P6G A;  2Z84 A;  4BPV A;  3B79 A;  4W4U A;  3OF9 A;  5F02 A;  4CDC B;  4OEL A;  2AVW A;  1U9X A;  3V6C A;  2WBF X;  2YJC A;  3LFY A;  2F1G A;  1Y08 A;  4CDF B;  2DCC A;  4K7C A;  4N4Z A;  3H89 A;  3PW3 A;  3ZUA A;  3V6E A;  1AU3 A;  4PI3 A;  3N3K A;  3HD3 A;  2P7U A;  2CIO A;  1ITO A;  4IP3 A;  4WA6 A;  3KX1 A;  1CB5 A;  4YYS A;  1PCI A;  2FUD A;  2JQG R;  1CS8 A;  5EZQ A;  2FO5 A;  2J7Q A;  1GCB A;  1PAD A;  2DCA A;  3HWN A;  1KFU L;  5CVM A;  1K3B B;  4RY2 A;  3BPM A;  3C9E A;  1YVB A;  1AYW A;  1AYV A;  3PSE A;  4BOU A;  4D8B A;  1VJV A;  2HH5 A;  1EWP A;  2J7Q C;  4FJC A;  2GHU A;  2B1M A;  3H6S A;  4I07 A;  1NLJ A;  3QSD A;  4QRV A;  5FPW A;  2VHF A;  1PPP A;  2NQA A;  3PHX A;  3KKU A;  1NL6 A;  4CZW A;  2BDZ A;  1TLO A;  2AU1 A;  3PHU A;  1BQI A;  1F2A A;  2AS8 A;  1CV8 A;  2YJ8 A;  4XZX A;  2P86 A;  2ATO A;  2XU5 A;  1SNK A;  1STF E;  3BBA A;  1EWO A;  2BTW A;  5J94 A;  3I06 A;  4ZTB A;  3QT4 A;  1MS6 A;  4OVZ A;  3PT2 A;  1UKF A;  1KHQ A;  5K16 A;  4N8W A;  2IBI A;  3ZNH A;  1AU0 A;  3BCN A;  3H8C A;  3B21 A;  2DC7 A;  4BOZ A;  4YVA A;  3IHP A;  3WXG A;  2GFO A;  3HHI A;  4YYW A;  1BGO A;  1AEC A;  2Y5B A;  1EWL A;  5EGW A;  1XKG A;  4BOS A;  3M99 A;  2HHN A;  2Y6E A;  3WXE A;  1CPJ A;  2XU3 A;  3IOQ A;  4IUM A;  3E1Z B;  1IWD A;  2G7Y A;  3PDF A;  1F2C A;  1PE6 A;  1TU6 A;  1DF0 A;  4BQV A;  4PP2 E;  3OVZ A;  3P5X A;  2PBH A;  3K8U A;  1YAL A;  3GCB A;  3W31 A;  4PP1 A;  1M6D A;  1QMY A;  4X6I A;  2YJ2 A;  4DMX A;  2DC8 A;  1EWM A;  4HWY A;  3O0U A;  5JH3 A;  2DZY A;  3IFU A;  3PBH A;  4I04 A;  1CTE A;  1YK8 A;  2HD5 A;  4YYV A;  4BSQ A;  2E00 A;  1ZIV A;  4Q8G A;  1NQC A;  4MZS A;  1KHP A;  4WUR A;  3P5V A;  5PAD A;  4YYU A;  1ATK A;  3D6S A;  3C0R A;  3CBJ A;  2HXZ A;  5CHV A;  3OF8 A;  1NPZ A;  4A5U A;  2DCB A;  1SP4 B;  2O6X A;  1MEG A;  3WXF A;  2OUL A;  4YYQ A;  3OQC A;  4X6J A;  3MP2 A;  2UZJ A;  1QOL A;  4QRX A;  2VHS A;  2R9N A;  4R3D A;  2R9O A;  1THE A;  2FT2 A;  5CVO B;  4AXL A;  2E03 A;  4HXD B;  2AYO A;  4YYR A;  1GEC E;  4P16 A;  4ZUX U;  4FIP A;  1BY8 A;  1CJL A;  3AI8 A;  4XUI A;  4MZO A;  4OW0 A;  5JA7 A;  3IV2 A;  4DMY A;  1PVJ A;  3KW9 A;  2FQ9 A;  2H7J A;  1AYU A;  3CBK A;  3KWB X;  3PRP A;  4M0W A;  3H7D A;  2AUX A;  1TL9 A;  1YT7 A;  2E01 A;  7PCK A;  1MEM A;  1O0E A;  4BOQ A;  1QXP A;  2PNS A;  3CH3 X;  3H8B A;  4AXM A;  4W5B A;  3IEJ A;  1PPO A;  3TRK A;  5E6J A;  1Q6K A;  1PXV A;  5CVN B;  2G8J A;  4FK5 A;  5A24 A;  4D8I A;  2R6N A;  3N3G A;  5CHT A;  1GMY A;  2DC6 A;  2OZ2 A;  3F75 A;  3IMA A;  4RF0 A;  1MDW A;  4G54 A;  1CQD A;  1NB3 A;  3S3Q A;  1Y4H A;  2C0Y A;  1ME3 A;  3BY4 A;  2OP3 A;  2AGA A;  1HUC B;  2FRQ A;  3MHS A;  3QJ3 A;  3RVV A;  2R9M A;  3K24 A;  4I05 A;  1CVZ A;  1VSN A;  4D8E A;  5KO3 A;  1S4V A;  2BTW B;  2G8E A;  4OVZ B;  2JTC A;  4RKX A;  5JZE A;  1JQP A;  4RNA A;  2DCD A;  4MI7 A;  1FH0 A;  1F29 A;  2YJB A;  2DZZ A;  1EF7 A;  3USV A;  3O65 A;  1BP4 A;  2CB5 A;  1AU4 A;  4Q8H A;  2R9C A;  2AIM A;  3LXS A;  4N79 A;  4QH6 A;  4QBB A;  5EZS A; 
#chains in the Genus database with same CATH homology
 3DF0 A;  4QRG A;  2B1N A;  3HHA A;  3OIS A;  1QDQ A;  2E02 A;  2P0R A;  5EF4 A;  4XR7 A;  1CSB B;  3TNX A;  3OVX A;  3MTN A;  3BWK A;  4PAD A;  2ACT A;  2VFB A;  2G6D A;  3RVX A;  2PAD A;  3U8E A;  4BS5 A;  1E2T A;  3F5V A;  1GX3 A;  3K9M A;  4CDD B;  4NV8 A;  1ZCM A;  3MOR A;  1U5I A;  2ARY A;  1U9W A;  4YV8 A;  3CH2 X;  4KLB A;  1ME4 A;  3KFQ A;  4B55 A;  1YK7 A;  1GLO A;  3PNR A;  2DJF B;  1ICF A;  1MHW A;  2F7D A;  2NQD B;  1MIR A;  2BDL A;  2AUZ A;  3NHE A;  1KXR A;  1U9V A;  1U9Q X;  2JQF R;  3N4C A;  2YJ9 A;  3MHH A;  1F2B A;  2R9F A;  3O1G A;  2NQG A;  2IPP B;  1DEU A;  8PCH A;  3S3R A;  3KSE A;  2DJG B;  2XU4 A;  2XU1 A;  3IUT A;  4BS6 A;  4P6E A;  1PBH A;  1X9Y A;  1AIM A;  3KWZ A;  3BOW A;  4X6H A;  4MSX A;  1KFX L;  1AU2 A;  1W4T A;  2FRA A;  2FYE A;  3I3T A;  2AYN A;  2NQI A;  1PPN A;  2DC9 A;  3P5W A;  2FTD A;  3ERV A;  3RVW A;  3BC3 A;  9PAP A;  1A6R A;  2PRE A;  1POP A;  4CDE B;  1PIP A;  3LTW A;  6PAD A;  4C5P A;  4OEM A;  4W5C A;  1PPD A;  3BPF A;  3P5U A;  1NB5 A;  4P6G A;  4BPV A;  3B79 A;  4W4U A;  3OF9 A;  5F02 A;  4CDC B;  4OEL A;  2AVW A;  4QBB A;  1U9X A;  3V6C A;  2WBF X;  2YJC A;  3LFY A;  2F1G A;  1Y08 A;  4CDF B;  2DCC A;  4K7C A;  4N4Z A;  3H89 A;  3PW3 A;  3ZUA A;  3V6E A;  1AU3 A;  4PI3 A;  3N3K A;  3HD3 A;  2P7U A;  2CIO A;  1ITO A;  4WA6 A;  3KX1 A;  1CB5 A;  4YYS A;  1PCI A;  2FUD A;  2JQG R;  1CS8 A;  2FO5 A;  1GCB A;  1PAD A;  2DCA A;  3HWN A;  1KFU L;  5CVM A;  1K3B B;  4RY2 A;  3BPM A;  3C9E A;  3D9W A;  1YVB A;  1AYW A;  1AYV A;  1VJV A;  2HH5 A;  1EWP A;  4FJC A;  2GHU A;  2B1M A;  3H6S A;  4I07 A;  1NLJ A;  3QSD A;  4QRV A;  5FPW A;  2VHF A;  1PPP A;  2NQA A;  3KKU A;  1NL6 A;  4CZW A;  2BDZ A;  1TLO A;  2AU1 A;  1BQI A;  1F2A A;  2AS8 A;  1CV8 A;  2YJ8 A;  2P86 A;  2ATO A;  2XU5 A;  1SNK A;  4BGF A;  1STF E;  5J94 A;  1EWO A;  3I06 A;  3QT4 A;  1MS6 A;  1KHQ A;  5K16 A;  4N8W A;  2IBI A;  1AU0 A;  3BCN A;  3H8C A;  2DC7 A;  4YVA A;  3IHP A;  3WXG A;  2GFO A;  3HHI A;  4YYW A;  1BGO A;  1AEC A;  2Y5B A;  1EWL A;  5EGW A;  1XKG A;  3M99 A;  2HHN A;  2Y6E A;  3WXE A;  1CPJ A;  2XU3 A;  3IOQ A;  3E1Z B;  1IWD A;  2G7Y A;  3PDF A;  1F2C A;  1PE6 A;  1TU6 A;  1DF0 A;  4BQV A;  4PP2 E;  3OVZ A;  3P5X A;  2PBH A;  3K8U A;  1YAL A;  3GCB A;  4PP1 A;  1M6D A;  1QMY A;  4X6I A;  2YJ2 A;  4DMX A;  2DC8 A;  1EWM A;  4HWY A;  3O0U A;  5JH3 A;  2DZY A;  3PBH A;  4I04 A;  1CTE A;  1YK8 A;  2HD5 A;  4YYV A;  4BSQ A;  2E00 A;  1ZIV A;  4Q8G A;  1NQC A;  4MZS A;  1KHP A;  5PAD A;  3P5V A;  4YYU A;  1ATK A;  3D6S A;  1W6F A;  3CBJ A;  2HXZ A;  5CHV A;  1NPZ A;  3OF8 A;  2DCB A;  1SP4 B;  2O6X A;  1MEG A;  3WXF A;  2OUL A;  4YYQ A;  4X6J A;  4NV7 A;  1QOL A;  4QRX A;  2VHS A;  2R9N A;  2R9O A;  1THE A;  2FT2 A;  5CVO B;  4AXL A;  2E03 A;  2AYO A;  4YYR A;  1GEC E;  2BSZ A;  4ZUX U;  4FIP A;  1BY8 A;  1CJL A;  3AI8 A;  4XUI A;  4MZO A;  5JA7 A;  3IV2 A;  4DMY A;  3KW9 A;  2FQ9 A;  2H7J A;  1AYU A;  2VFC A;  3CBK A;  3KWB X;  3H7D A;  2AUX A;  1TL9 A;  1YT7 A;  2E01 A;  7PCK A;  1MEM A;  1O0E A;  1QXP A;  2PNS A;  3CH3 X;  3H8B A;  4AXM A;  4W5B A;  3IEJ A;  1PPO A;  1Q6K A;  1PXV A;  5CVN B;  2G8J A;  4FK5 A;  5A24 A;  2R6N A;  3N3G A;  5CHT A;  1GMY A;  2DC6 A;  2OZ2 A;  3F75 A;  3IMA A;  4GUZ A;  1MDW A;  4G54 A;  1CQD A;  1NB3 A;  3S3Q A;  1Y4H A;  2C0Y A;  1ME3 A;  2OP3 A;  1HUC B;  2FRQ A;  3MHS A;  3QJ3 A;  3RVV A;  2R9M A;  3K24 A;  4I05 A;  1CVZ A;  1VSN A;  1S4V A;  2G8E A;  1JQP A;  2DCD A;  1FH0 A;  1F29 A;  2YJB A;  2DZZ A;  1EF7 A;  3USV A;  1BP4 A;  2CB5 A;  1AU4 A;  4Q8H A;  2R9C A;  2AIM A;  3LXS A;  4N79 A;  4QH6 A;  1W5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...