1O0EA

1.9 angstrom crystal structure of a plant cysteine protease ervatamin c
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
208
structure length
208
Chain Sequence
LPEQIDWRKKGAVTPVKNQGSCGSCWAFSTVSTVESINQIRTGNLISLSEQELVDCDKKNHGCLGGAFVFAYQYIINNGGIDTQANYPYKAVQGPCQAASKVVSIDGYNGVPFCNEXALKQAVAVQPSTVAIDASSAQFQQYSSGIFSGPCGTKLNHGVTIVGYQANYWIVRNSWGRYWGEKGYIRMLRVGGCGLCGIARLPYYPTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of the Unusual Stability and Substrate Specificity of Ervatamin C, a Plant Cysteine Protease from Ervatamia coronaria
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Ervatamin C
total genus 68
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1o0eA00
3H7DA 3KW9A 9PAPA 2R9CA 4FJCA 2JQGR 2AU1A 3OISA 1NL6A 2AYNA 4PP1A 2HXZA 3KKUA 2G7YA 1GLOA 1NLJA 2YJCA 4ZUXU 1PPNA 1POPA 1Y4HA 2GFOA 2H7JA 3ZUAA 4CDCB 2HHNA 1F2CA 1BY8A 5CHTA 1YT7A 3S3QA 1CVZA 3GCBA 3MHSA 2AVWA 1GECE 2OZ2A 2GHUA 3RVVA 2O6XA 4BS6A 3LXSA 4N4ZA 1YK8A 2YJ9A 3MTNA 4BQVA 1EF7A 1U9QX 2Y5BA 4QRXA 1NB3A 2JQFR 3TNXA 4CZWA 3O1GA 4QH6A 1XKGA 5FPWA 1VSNA 2E02A 2AS8A 1KHPA 2Y6EA 4I07A 3WXGA 1AYVA 1YALA 2DC6A 2FUDA 4P6EA 2ATOA 3DF0A 2XU1A 2NQAA 4AXMA 2FYEA 1SP4B 1AU0A 1Y08A 2PNSA 3QT4A 2CB5A 3BCNA 2CIOA 3KX1A 3OVZA 1PADA 3F75A 3OF9A 3RVXA 1EWOA 4QRVA 3H8CA 1ATKA 4YYSA 3IUTA 3I3TA 2IPPB 1KHQA 4DMYA 2FRAA 4QBBA 2B1NA 4W5BA 3K24A 2XU4A 3P5VA 1U9XA 3WXEA 3C9EA 1CPJA 3K8UA 1AECA 1X9YA 5F02A 1BP4A 4XUIA 2IBIA 4G54A 1M6DA 1AU4A 3H6SA 4BSQA 3NHEA 3ERVA 4FK5A 2HH5A 2DC7A 2FQ9A 3IV2A 1F29A 2E00A 2P7UA 3E1ZB 3PBHA 3CH2X 3V6EA 2FT2A 3O0UA 1S4VA 3BWKA 5CVOB 5K16A 2C0YA 1CV8A 1U9WA 2DCDA 2OULA 2XU3A 1ZIVA 4AXLA 4N79A 2NQDB 2VHSA 3MHHA 3U8EA 3OF8A 7PCKA 1ME3A 1MEMA 3KWBX 3N4CA 4KLBA 4OEMA 2DJFB 1THEA 2DZYA 2NQIA 1MEGA 1MS6A 2B1MA 1PPPA 3HD3A 1YVBA 3IEJA 4YV8A 4YYWA 2R6NA 3OVXA 3WXFA 1EWMA 1NPZA 1PPOA 4RY2A 3IHPA 3KFQA 4HWYA 2AIMA 1F2BA 4P6GA 1ITOA 1DF0A 1MDWA 2PBHA 1MHWA 3BPMA 1GMYA 2AUZA 3F5VA 3P5WA 2AYOA 2DCBA 3HHAA 1EWLA 3P5XA 1CB5A 2HD5A 1QMYA 1CS8A 4N8WA 2FTDA 1NQCA 1BGOA 3CH3X 5PADA 3LFYA 1PE6A 3BC3A 3QSDA 5CVNB 3N3GA 5EGWA 4MSXA 4YYQA 3P5UA 1A6RA 1AIMA 3M99A 2DCCA 3RVWA 2G8JA 4X6IA 1AU2A 1IWDA 1KFXL 3HWNA 1CTEA 1DEUA 6PADA 1NB5A 4PP2E 1TL9A 1TU6A 1EWPA 3N3KA 3IOQA 1QDQA 2F1GA 1Q6KA 2E03A 4W4UA 2OP3A 2BDZA 4QRGA 2DZZA 1BQIA 2PREA 3CBJA 1AU3A 1PIPA 5J94A 2G6DA 2YJ2A 3AI8A 1U5IA 1STFE 1TLOA 4CDDB 4YYVA 2YJBA 3H89A 4K7CA 3H8BA 3B79A 4CDEB 5JA7A 3KSEA 2FRQA 2R9FA 2DCAA 2R9OA 1FH0A 1ICFA 1QOLA 4MZOA 3I06A 5CVMA 2FO5A 1VJVA 1HUCB 1MIRA 5EF4A 1K3BB 2DC8A 3PNRA 8PCHA 5A24A 1QXPA 4BS5A 2PADA 2P0RA 2P86A 1ME4A 4I04A 2E01A 4YVAA 2ARYA 3QJ3A 4X6HA 2XU5A 4MZSA 4Q8HA 3BPFA 3D6SA 4PADA 1CJLA 3PDFA 2BDLA 3V6CA 4CDFB 4W5CA 3K9MA 4OELA 1PXVA 1CQDA 5CHVA 1ZCMA 4PI3A 4WA6A 2DJGB 3PW3A 3CBKA 2AUXA 2R9MA 2G8EA 3IMAA 4YYRA 2NQGA 5JH3A 1AYWA 1YK7A 1F2AA 2R9NA 2WBFX 3KWZA 2ACTA 1KFUL 1JQPA 2F7DA 2YJ8A 3S3RA 4DMXA 1GCBA 1SNKA 1PBHA 4X6JA 4BPVA 4XR7A 2DC9A 1KXRA 1PPDA 1PCIA 3USVA 3BOWA 1U9VA 4YYUA 3HHIA 3MORA 1O0EA 1AYUA 2VHFA 4Q8GA 4FIPA 1CSBB 4I05A
chains in the Genus database with same CATH superfamily
3H7DA 3PHWA 3KW9A 9PAPA 2R9CA 4FJCA 2JQGR 2AU1A 3OISA 1NL6A 2AYNA 4PP1A 2HXZA 3KKUA 2G7YA 1GLOA 1NLJA 4HXDB 2YJCA 4ZUXU 1PPNA 1POPA 3BBAA 1Y4HA 2GFOA 2H7JA 3ZUAA 4CDCB 2HHNA 3OQCA 4OVZB 1F2CA 1BY8A 5CHTA 1YT7A 3GCBA 1CVZA 3S3QA 3MHSA 2AVWA 1GECE 2J7QC 2OZ2A 2GHUA 3RVVA 2O6XA 4BS6A 3LXSA 3BY4A 4N4ZA 1YK8A 2YJ9A 3MTNA 4BQVA 4OW0A 1EF7A 1U9QX 2Y5BA 4QRXA 1NB3A 2JRIA 2BU3A 2JQFR 3TNXA 4CZWA 3O1GA 4QH6A 3MTVA 1XKGA 5FPWA 1VSNA 2E02A 2AS8A 1KHPA 2Y6EA 4I07A 2J7QA 3WXGA 1AYVA 1YALA 5EZQA 2DC6A 2FUDA 4P6EA 2ATOA 3DF0A 2XU1A 2NQAA 4REZA 4AXMA 2FYEA 1SP4B 1AU0A 4MI7A 1Y08A 2PNSA 3QT4A 2CB5A 3BCNA 2CIOA 3KX1A 3OVZA 1PADA 3F75A 3OF9A 3RVXA 2HWKA 1EWOA 4PT5A 4QRVA 3H8CA 3TMPA 1ATKA 4YYSA 3IUTA 3I3TA 2IPPB 1KHQA 4DMYA 2FRAA 4QBBA 2B1NA 4W5BA 3K24A 2XU4A 3P5VA 3PRPA 2FE8A 1U9XA 3WXEA 3C9EA 1CPJA 4RF0A 3K8UA 1AECA 1X9YA 3TRKA 5F02A 2UZJA 1BP4A 2Z84A 4XUIA 2IBIA 4G54A 1M6DA 1AU4A 3H6SA 4BSQA 3NHEA 3ERVA 4FK5A 2HH5A 2DC7A 2FQ9A 3PRMA 3IV2A 4WURA 3PHUA 1F29A 2E00A 2P7UA 3E1ZB 3PBHA 3CH2X 3V6EA 2FT2A 3O0UA 1S4VA 3BWKA 5CVOB 5K16A 2C0YA 4A5UA 1CV8A 1U9WA 4RKXA 2DCDA 2OULA 2XU3A 1ZIVA 4BOPA 4AXLA 4N79A 2NQDB 2VHSA 3MHHA 3U8EA 3OF8A 7PCKA 1ME3A 4D8EA 1MEMA 3KWBX 3N4CA 4KLBA 4OEMA 2DJFB 1THEA 2DZYA 2NQIA 1MEGA 4R3DA 1MS6A 2B1MA 1PPPA 3HD3A 1YVBA 3IEJA 4YV8A 4YYWA 2R6NA 3OVXA 3WXFA 5EZSA 1EWMA 1NPZA 1PPOA 4RY2A 4D8BA 3IHPA 4ZTBA 3KFQA 4HWYA 2AIMA 4GUAA 4IP3A 4OVZA 1F2BA 4P6GA 1ITOA 1DF0A 1MDWA 2PBHA 1MHWA 3BPMA 1GMYA 2AUZA 3F5VA 3P5WA 2AYOA 4MM3B 2DCBA 3HHAA 4XZXA 1EWLA 3P5XA 1CB5A 3C0RA 2HD5A 1QMYA 1CS8A 4N8WA 2FTDA 1NQCA 1BGOA 3CH3X 5PADA 3LFYA 1PE6A 3BC3A 3QSDA 5CVNB 3N3GA 5EGWA 4MSXA 4YYQA 3P5UA 1A6RA 1AIMA 3M99A 2DCCA 3RVWA 2G8JA 4X6IA 1AU2A 1IWDA 1KFXL 3HWNA 1CTEA 1DEUA 6PADA 1NB5A 2AGAA 4PP2E 5KO3A 3E9SA 1TL9A 1TU6A 1EWPA 3PT2A 3N3KA 3IOQA 4BOSA 2JTCA 1QDQA 2F1GA 1Q6KA 2E03A 4W4UA 2OP3A 2BDZA 3PHXA 4QRGA 2DZZA 1BQIA 2PREA 3CBJA 1AU3A 1PIPA 4D8IA 5J94A 2G6DA 2YJ2A 3AI8A 1U5IA 3B21A 1STFE 1TLOA 3W31A 4CDDB 4BOZA 4YYVA 1PVJA 2YJBA 3H89A 4K7CA 3H8BA 3B79A 4CDEB 5JA7A 3KSEA 2FRQA 2R9FA 3O65A 2DCAA 1YZBA 2R9OA 1FH0A 1ICFA 1QOLA 1DKIA 4MZOA 3I06A 5CVMA 2FO5A 1VJVA 1HUCB 1MIRA 5EF4A 5JZEA 1K3BB 2DC8A 3PNRA 8PCHA 5A24A 3RNVA 1QXPA 4BS5A 2PADA 2P0RA 4RF1A 2P86A 1ME4A 2BTWB 4I04A 2E01A 4YVAA 2ARYA 3QJ3A 4X6HA 2XU5A 4MZSA 4Q8HA 3BPFA 3D6SA 4PADA 1CJLA 3PDFA 3BB7A 2BDLA 2DOSA 4P16A 3V6CA 4CDFB 4W5CA 3K9MA 4OELA 1PXVA 1CQDA 5CHVA 1ZCMA 4PI3A 4WA6A 2DJGB 3PW3A 3CBKA 2AUXA 2R9MA 2G8EA 3W30A 2BTWA 3IMAA 3MJ5A 4YYRA 4IUMA 2NQGA 5JH3A 1AYWA 1YK7A 1F2AA 2R9NA 2WBFX 3KWZA 2ACTA 4M0WA 1KFUL 1JQPA 2F7DA 2YJ8A 3S3RA 4DMXA 1GCBA 1SNKA 1PBHA 4X6JA 4BPVA 4XR7A 2DC9A 1KXRA 4BOQA 1PPDA 4BOUA 1PCIA 3USVA 3BOWA 5E6JA 1U9VA 4YYUA 3MP2A 3HHIA 3MORA 3IFUA 1O0EA 1UKFA 1AYUA 2VHFA 4Q8GA 4FIPA 1CSBB 3ZNHA 4I05A 3PSEA 4RNAA
chains in the Genus database with same CATH topology
3H7DA 3KW9A 9PAPA 2R9CA 4FJCA 2JQGR 2AU1A 3OISA 1NL6A 2AYNA 4PP1A 2HXZA 3KKUA 2G7YA 1GLOA 1NLJA 2YJCA 4ZUXU 1PPNA 1POPA 1Y4HA 2GFOA 2H7JA 3ZUAA 4CDCB 2HHNA 1E2TA 1BY8A 1F2CA 5CHTA 1YT7A 3GCBA 1CVZA 3S3QA 3MHSA 2AVWA 1GECE 2OZ2A 2GHUA 3RVVA 2O6XA 4BS6A 3LXSA 3LTWA 4N4ZA 1YK8A 2YJ9A 3MTNA 4BQVA 1EF7A 1U9QX 2Y5BA 4GUZA 4QRXA 1NB3A 2JQFR 3TNXA 4CZWA 3O1GA 4QH6A 1XKGA 5FPWA 1VSNA 2E02A 2AS8A 1KHPA 2Y6EA 4I07A 3WXGA 1AYVA 1YALA 2DC6A 2FUDA 4P6EA 2ATOA 3DF0A 2XU1A 2NQAA 4AXMA 2FYEA 1W4TA 1SP4B 1AU0A 1Y08A 2PNSA 3QT4A 2CB5A 3BCNA 2CIOA 3KX1A 3OVZA 1PADA 3F75A 3OF9A 3RVXA 1EWOA 4QRVA 3H8CA 1ATKA 4YYSA 3IUTA 3I3TA 2IPPB 1KHQA 4DMYA 2FRAA 4QBBA 2B1NA 4W5BA 3K24A 2XU4A 3P5VA 1U9XA 3WXEA 3C9EA 1CPJA 3K8UA 1AECA 1X9YA 5F02A 1BP4A 4XUIA 2IBIA 1GX3A 4G54A 1M6DA 1AU4A 3H6SA 4BSQA 3NHEA 3ERVA 4FK5A 2HH5A 2DC7A 2FQ9A 3IV2A 1F29A 2E00A 2P7UA 3E1ZB 3PBHA 3CH2X 3V6EA 2FT2A 3O0UA 1S4VA 3BWKA 5CVOB 5K16A 2C0YA 1CV8A 1U9WA 2DCDA 2OULA 4BGFA 2XU3A 1ZIVA 4NV8A 4AXLA 4N79A 2NQDB 2VHSA 3MHHA 3U8EA 3OF8A 7PCKA 1ME3A 1MEMA 3KWBX 3N4CA 4KLBA 4OEMA 2DJFB 1THEA 2DZYA 2NQIA 1MEGA 1MS6A 2B1MA 1PPPA 3HD3A 1YVBA 3IEJA 4YV8A 4YYWA 2R6NA 3OVXA 3WXFA 1EWMA 1NPZA 1PPOA 4RY2A 3IHPA 3KFQA 4HWYA 2AIMA 1F2BA 4P6GA 1ITOA 1DF0A 1MDWA 2PBHA 1MHWA 3BPMA 1GMYA 2AUZA 3F5VA 3P5WA 2AYOA 2DCBA 3HHAA 1EWLA 3P5XA 1CB5A 2HD5A 1QMYA 1CS8A 4N8WA 2FTDA 1NQCA 1BGOA 3CH3X 5PADA 3LFYA 1PE6A 3BC3A 3QSDA 5CVNB 3N3GA 5EGWA 4MSXA 4YYQA 3P5UA 1A6RA 1AIMA 2VFCA 3M99A 2DCCA 3RVWA 2G8JA 4X6IA 1AU2A 1IWDA 1KFXL 3D9WA 3HWNA 1CTEA 1DEUA 6PADA 1NB5A 4PP2E 1TL9A 1TU6A 1EWPA 3N3KA 3IOQA 1QDQA 2F1GA 1Q6KA 2E03A 4W4UA 2OP3A 2BDZA 2VFBA 4QRGA 2DZZA 1BQIA 2PREA 3CBJA 1AU3A 1PIPA 5J94A 2G6DA 2YJ2A 3AI8A 1U5IA 1STFE 1TLOA 4CDDB 4YYVA 2YJBA 3H89A 4K7CA 3H8BA 3B79A 4CDEB 5JA7A 3KSEA 2FRQA 2R9FA 2DCAA 2R9OA 1FH0A 1ICFA 1QOLA 4MZOA 3I06A 5CVMA 2FO5A 1VJVA 1HUCB 1MIRA 5EF4A 1K3BB 2DC8A 3PNRA 8PCHA 5A24A 1QXPA 4BS5A 2PADA 2P0RA 2P86A 1ME4A 4I04A 2E01A 1W6FA 4YVAA 2ARYA 3QJ3A 4X6HA 2XU5A 4MZSA 4Q8HA 3BPFA 3D6SA 4PADA 1CJLA 3PDFA 2BDLA 3V6CA 4CDFB 4W5CA 3K9MA 4OELA 1PXVA 1CQDA 5CHVA 1ZCMA 4PI3A 4WA6A 2DJGB 3PW3A 3CBKA 2AUXA 2R9MA 2G8EA 4NV7A 3IMAA 4YYRA 2NQGA 5JH3A 1AYWA 1YK7A 1F2AA 2R9NA 2WBFX 3KWZA 2ACTA 1KFUL 4C5PA 1JQPA 1W5RA 2F7DA 2YJ8A 3S3RA 4DMXA 4B55A 1GCBA 1SNKA 1PBHA 4X6JA 4BPVA 4XR7A 2DC9A 1KXRA 1PPDA 1PCIA 3USVA 3BOWA 1U9VA 4YYUA 3HHIA 3MORA 1O0EA 1AYUA 2VHFA 2BSZA 4Q8GA 4FIPA 1CSBB 4I05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H7D A;  3KW9 A;  9PAP A;  2R9C A;  4FJC A;  2JQG R;  2AU1 A;  3OIS A;  1NL6 A;  2AYN A;  4PP1 A;  2HXZ A;  3KKU A;  2G7Y A;  1GLO A;  1NLJ A;  2YJC A;  4ZUX U;  1PPN A;  1POP A;  1Y4H A;  2GFO A;  2H7J A;  3ZUA A;  4CDC B;  2HHN A;  1F2C A;  1BY8 A;  5CHT A;  1YT7 A;  3S3Q A;  1CVZ A;  3GCB A;  3MHS A;  2AVW A;  1GEC E;  2OZ2 A;  2GHU A;  3RVV A;  2O6X A;  4BS6 A;  3LXS A;  4N4Z A;  1YK8 A;  2YJ9 A;  3MTN A;  4BQV A;  1EF7 A;  1U9Q X;  2Y5B A;  4QRX A;  1NB3 A;  2JQF R;  3TNX A;  4CZW A;  3O1G A;  4QH6 A;  1XKG A;  5FPW A;  1VSN A;  2E02 A;  2AS8 A;  1KHP A;  2Y6E A;  4I07 A;  3WXG A;  1AYV A;  1YAL A;  2DC6 A;  2FUD A;  4P6E A;  2ATO A;  3DF0 A;  2XU1 A;  2NQA A;  4AXM A;  2FYE A;  1SP4 B;  1AU0 A;  1Y08 A;  2PNS A;  3QT4 A;  2CB5 A;  3BCN A;  2CIO A;  3KX1 A;  3OVZ A;  1PAD A;  3F75 A;  3OF9 A;  3RVX A;  1EWO A;  4QRV A;  3H8C A;  1ATK A;  4YYS A;  3IUT A;  3I3T A;  2IPP B;  1KHQ A;  4DMY A;  2FRA A;  4QBB A;  2B1N A;  4W5B A;  3K24 A;  2XU4 A;  3P5V A;  1U9X A;  3WXE A;  3C9E A;  1CPJ A;  3K8U A;  1AEC A;  1X9Y A;  5F02 A;  1BP4 A;  4XUI A;  2IBI A;  4G54 A;  1M6D A;  1AU4 A;  3H6S A;  4BSQ A;  3NHE A;  3ERV A;  4FK5 A;  2HH5 A;  2DC7 A;  2FQ9 A;  3IV2 A;  1F29 A;  2E00 A;  2P7U A;  3E1Z B;  3PBH A;  3CH2 X;  3V6E A;  2FT2 A;  3O0U A;  1S4V A;  3BWK A;  5CVO B;  5K16 A;  2C0Y A;  1CV8 A;  1U9W A;  2DCD A;  2OUL A;  2XU3 A;  1ZIV A;  4AXL A;  4N79 A;  2NQD B;  2VHS A;  3MHH A;  3U8E A;  3OF8 A;  7PCK A;  1ME3 A;  1MEM A;  3KWB X;  3N4C A;  4KLB A;  4OEM A;  2DJF B;  1THE A;  2DZY A;  2NQI A;  1MEG A;  1MS6 A;  2B1M A;  1PPP A;  3HD3 A;  1YVB A;  3IEJ A;  4YV8 A;  4YYW A;  2R6N A;  3OVX A;  3WXF A;  1EWM A;  1NPZ A;  1PPO A;  4RY2 A;  3IHP A;  3KFQ A;  4HWY A;  2AIM A;  1F2B A;  4P6G A;  1ITO A;  1DF0 A;  1MDW A;  2PBH A;  1MHW A;  3BPM A;  1GMY A;  2AUZ A;  3F5V A;  3P5W A;  2AYO A;  2DCB A;  3HHA A;  1EWL A;  3P5X A;  1CB5 A;  2HD5 A;  1QMY A;  1CS8 A;  4N8W A;  2FTD A;  1NQC A;  1BGO A;  3CH3 X;  5PAD A;  3LFY A;  1PE6 A;  3BC3 A;  3QSD A;  5CVN B;  3N3G A;  5EGW A;  4MSX A;  4YYQ A;  3P5U A;  1A6R A;  1AIM A;  3M99 A;  2DCC A;  3RVW A;  2G8J A;  4X6I A;  1AU2 A;  1IWD A;  1KFX L;  3HWN A;  1CTE A;  1DEU A;  6PAD A;  1NB5 A;  4PP2 E;  1TL9 A;  1TU6 A;  1EWP A;  3N3K A;  3IOQ A;  1QDQ A;  2F1G A;  1Q6K A;  2E03 A;  4W4U A;  2OP3 A;  2BDZ A;  4QRG A;  2DZZ A;  1BQI A;  2PRE A;  3CBJ A;  1AU3 A;  1PIP A;  5J94 A;  2G6D A;  2YJ2 A;  3AI8 A;  1U5I A;  1STF E;  1TLO A;  4CDD B;  4YYV A;  2YJB A;  3H89 A;  4K7C A;  3H8B A;  3B79 A;  4CDE B;  5JA7 A;  3KSE A;  2FRQ A;  2R9F A;  2DCA A;  2R9O A;  1FH0 A;  1ICF A;  1QOL A;  4MZO A;  3I06 A;  5CVM A;  2FO5 A;  1VJV A;  1HUC B;  1MIR A;  5EF4 A;  1K3B B;  2DC8 A;  3PNR A;  8PCH A;  5A24 A;  1QXP A;  4BS5 A;  2PAD A;  2P0R A;  2P86 A;  1ME4 A;  4I04 A;  2E01 A;  4YVA A;  2ARY A;  3QJ3 A;  4X6H A;  2XU5 A;  4MZS A;  4Q8H A;  3BPF A;  3D6S A;  4PAD A;  1CJL A;  3PDF A;  2BDL A;  3V6C A;  4CDF B;  4W5C A;  3K9M A;  4OEL A;  1PXV A;  1CQD A;  5CHV A;  1ZCM A;  4PI3 A;  4WA6 A;  2DJG B;  3PW3 A;  3CBK A;  2AUX A;  2R9M A;  2G8E A;  3IMA A;  4YYR A;  2NQG A;  5JH3 A;  1AYW A;  1YK7 A;  1F2A A;  2R9N A;  2WBF X;  3KWZ A;  2ACT A;  1KFU L;  1JQP A;  2F7D A;  2YJ8 A;  3S3R A;  4DMX A;  1GCB A;  1SNK A;  1PBH A;  4X6J A;  4BPV A;  4XR7 A;  2DC9 A;  1KXR A;  1PPD A;  1PCI A;  3USV A;  3BOW A;  1U9V A;  4YYU A;  3HHI A;  3MOR A;  1O0E A;  1AYU A;  2VHF A;  4Q8G A;  4FIP A;  1CSB B;  4I05 A; 
#chains in the Genus database with same CATH topology
 3H7D A;  3PHW A;  3KW9 A;  9PAP A;  2R9C A;  4FJC A;  2JQG R;  2AU1 A;  3OIS A;  1NL6 A;  2AYN A;  4PP1 A;  2HXZ A;  3KKU A;  2G7Y A;  1GLO A;  1NLJ A;  4HXD B;  2YJC A;  4ZUX U;  1PPN A;  1POP A;  3BBA A;  1Y4H A;  2GFO A;  2H7J A;  3ZUA A;  4CDC B;  2HHN A;  3OQC A;  4OVZ B;  1F2C A;  1BY8 A;  5CHT A;  1YT7 A;  3GCB A;  1CVZ A;  3S3Q A;  3MHS A;  2AVW A;  1GEC E;  2J7Q C;  2OZ2 A;  2GHU A;  3RVV A;  2O6X A;  4BS6 A;  3LXS A;  3BY4 A;  4N4Z A;  1YK8 A;  2YJ9 A;  3MTN A;  4BQV A;  4OW0 A;  1EF7 A;  1U9Q X;  2Y5B A;  4QRX A;  1NB3 A;  2JRI A;  2BU3 A;  2JQF R;  3TNX A;  4CZW A;  3O1G A;  4QH6 A;  3MTV A;  1XKG A;  5FPW A;  1VSN A;  2E02 A;  2AS8 A;  1KHP A;  2Y6E A;  4I07 A;  2J7Q A;  3WXG A;  1AYV A;  1YAL A;  5EZQ A;  2DC6 A;  2FUD A;  4P6E A;  2ATO A;  3DF0 A;  2XU1 A;  2NQA A;  4REZ A;  4AXM A;  2FYE A;  1SP4 B;  1AU0 A;  4MI7 A;  1Y08 A;  2PNS A;  3QT4 A;  2CB5 A;  3BCN A;  2CIO A;  3KX1 A;  3OVZ A;  1PAD A;  3F75 A;  3OF9 A;  3RVX A;  2HWK A;  1EWO A;  4PT5 A;  4QRV A;  3H8C A;  3TMP A;  1ATK A;  4YYS A;  3IUT A;  3I3T A;  2IPP B;  1KHQ A;  4DMY A;  2FRA A;  4QBB A;  2B1N A;  4W5B A;  3K24 A;  2XU4 A;  3P5V A;  3PRP A;  2FE8 A;  1U9X A;  3WXE A;  3C9E A;  1CPJ A;  4RF0 A;  3K8U A;  1AEC A;  1X9Y A;  3TRK A;  5F02 A;  2UZJ A;  1BP4 A;  2Z84 A;  4XUI A;  2IBI A;  4G54 A;  1M6D A;  1AU4 A;  3H6S A;  4BSQ A;  3NHE A;  3ERV A;  4FK5 A;  2HH5 A;  2DC7 A;  2FQ9 A;  3PRM A;  3IV2 A;  4WUR A;  3PHU A;  1F29 A;  2E00 A;  2P7U A;  3E1Z B;  3PBH A;  3CH2 X;  3V6E A;  2FT2 A;  3O0U A;  1S4V A;  3BWK A;  5CVO B;  5K16 A;  2C0Y A;  4A5U A;  1CV8 A;  1U9W A;  4RKX A;  2DCD A;  2OUL A;  2XU3 A;  1ZIV A;  4BOP A;  4AXL A;  4N79 A;  2NQD B;  2VHS A;  3MHH A;  3U8E A;  3OF8 A;  7PCK A;  1ME3 A;  4D8E A;  1MEM A;  3KWB X;  3N4C A;  4KLB A;  4OEM A;  2DJF B;  1THE A;  2DZY A;  2NQI A;  1MEG A;  4R3D A;  1MS6 A;  2B1M A;  1PPP A;  3HD3 A;  1YVB A;  3IEJ A;  4YV8 A;  4YYW A;  2R6N A;  3OVX A;  3WXF A;  5EZS A;  1EWM A;  1NPZ A;  1PPO A;  4RY2 A;  4D8B A;  3IHP A;  4ZTB A;  3KFQ A;  4HWY A;  2AIM A;  4GUA A;  4IP3 A;  4OVZ A;  1F2B A;  4P6G A;  1ITO A;  1DF0 A;  1MDW A;  2PBH A;  1MHW A;  3BPM A;  1GMY A;  2AUZ A;  3F5V A;  3P5W A;  2AYO A;  4MM3 B;  2DCB A;  3HHA A;  4XZX A;  1EWL A;  3P5X A;  1CB5 A;  3C0R A;  2HD5 A;  1QMY A;  1CS8 A;  4N8W A;  2FTD A;  1NQC A;  1BGO A;  3CH3 X;  5PAD A;  3LFY A;  1PE6 A;  3BC3 A;  3QSD A;  5CVN B;  3N3G A;  5EGW A;  4MSX A;  4YYQ A;  3P5U A;  1A6R A;  1AIM A;  3M99 A;  2DCC A;  3RVW A;  2G8J A;  4X6I A;  1AU2 A;  1IWD A;  1KFX L;  3HWN A;  1CTE A;  1DEU A;  6PAD A;  1NB5 A;  2AGA A;  4PP2 E;  5KO3 A;  3E9S A;  1TL9 A;  1TU6 A;  1EWP A;  3PT2 A;  3N3K A;  3IOQ A;  4BOS A;  2JTC A;  1QDQ A;  2F1G A;  1Q6K A;  2E03 A;  4W4U A;  2OP3 A;  2BDZ A;  3PHX A;  4QRG A;  2DZZ A;  1BQI A;  2PRE A;  3CBJ A;  1AU3 A;  1PIP A;  4D8I A;  5J94 A;  2G6D A;  2YJ2 A;  3AI8 A;  1U5I A;  3B21 A;  1STF E;  1TLO A;  3W31 A;  4CDD B;  4BOZ A;  4YYV A;  1PVJ A;  2YJB A;  3H89 A;  4K7C A;  3H8B A;  3B79 A;  4CDE B;  5JA7 A;  3KSE A;  2FRQ A;  2R9F A;  3O65 A;  2DCA A;  1YZB A;  2R9O A;  1FH0 A;  1ICF A;  1QOL A;  1DKI A;  4MZO A;  3I06 A;  5CVM A;  2FO5 A;  1VJV A;  1HUC B;  1MIR A;  5EF4 A;  5JZE A;  1K3B B;  2DC8 A;  3PNR A;  8PCH A;  5A24 A;  3RNV A;  1QXP A;  4BS5 A;  2PAD A;  2P0R A;  4RF1 A;  2P86 A;  1ME4 A;  2BTW B;  4I04 A;  2E01 A;  4YVA A;  2ARY A;  3QJ3 A;  4X6H A;  2XU5 A;  4MZS A;  4Q8H A;  3BPF A;  3D6S A;  4PAD A;  1CJL A;  3PDF A;  3BB7 A;  2BDL A;  2DOS A;  4P16 A;  3V6C A;  4CDF B;  4W5C A;  3K9M A;  4OEL A;  1PXV A;  1CQD A;  5CHV A;  1ZCM A;  4PI3 A;  4WA6 A;  2DJG B;  3PW3 A;  3CBK A;  2AUX A;  2R9M A;  2G8E A;  3W30 A;  2BTW A;  3IMA A;  3MJ5 A;  4YYR A;  4IUM A;  2NQG A;  5JH3 A;  1AYW A;  1YK7 A;  1F2A A;  2R9N A;  2WBF X;  3KWZ A;  2ACT A;  4M0W A;  1KFU L;  1JQP A;  2F7D A;  2YJ8 A;  3S3R A;  4DMX A;  1GCB A;  1SNK A;  1PBH A;  4X6J A;  4BPV A;  4XR7 A;  2DC9 A;  1KXR A;  4BOQ A;  1PPD A;  4BOU A;  1PCI A;  3USV A;  3BOW A;  5E6J A;  1U9V A;  4YYU A;  3MP2 A;  3HHI A;  3MOR A;  3IFU A;  1O0E A;  1UKF A;  1AYU A;  2VHF A;  4Q8G A;  4FIP A;  1CSB B;  3ZNH A;  4I05 A;  3PSE A;  4RNA A; 
#chains in the Genus database with same CATH homology
 3H7D A;  3KW9 A;  9PAP A;  2R9C A;  4FJC A;  2JQG R;  2AU1 A;  3OIS A;  1NL6 A;  2AYN A;  4PP1 A;  2HXZ A;  3KKU A;  2G7Y A;  1GLO A;  1NLJ A;  2YJC A;  4ZUX U;  1PPN A;  1POP A;  1Y4H A;  2GFO A;  2H7J A;  3ZUA A;  4CDC B;  2HHN A;  1E2T A;  1BY8 A;  1F2C A;  5CHT A;  1YT7 A;  3GCB A;  1CVZ A;  3S3Q A;  3MHS A;  2AVW A;  1GEC E;  2OZ2 A;  2GHU A;  3RVV A;  2O6X A;  4BS6 A;  3LXS A;  3LTW A;  4N4Z A;  1YK8 A;  2YJ9 A;  3MTN A;  4BQV A;  1EF7 A;  1U9Q X;  2Y5B A;  4GUZ A;  4QRX A;  1NB3 A;  2JQF R;  3TNX A;  4CZW A;  3O1G A;  4QH6 A;  1XKG A;  5FPW A;  1VSN A;  2E02 A;  2AS8 A;  1KHP A;  2Y6E A;  4I07 A;  3WXG A;  1AYV A;  1YAL A;  2DC6 A;  2FUD A;  4P6E A;  2ATO A;  3DF0 A;  2XU1 A;  2NQA A;  4AXM A;  2FYE A;  1W4T A;  1SP4 B;  1AU0 A;  1Y08 A;  2PNS A;  3QT4 A;  2CB5 A;  3BCN A;  2CIO A;  3KX1 A;  3OVZ A;  1PAD A;  3F75 A;  3OF9 A;  3RVX A;  1EWO A;  4QRV A;  3H8C A;  1ATK A;  4YYS A;  3IUT A;  3I3T A;  2IPP B;  1KHQ A;  4DMY A;  2FRA A;  4QBB A;  2B1N A;  4W5B A;  3K24 A;  2XU4 A;  3P5V A;  1U9X A;  3WXE A;  3C9E A;  1CPJ A;  3K8U A;  1AEC A;  1X9Y A;  5F02 A;  1BP4 A;  4XUI A;  2IBI A;  1GX3 A;  4G54 A;  1M6D A;  1AU4 A;  3H6S A;  4BSQ A;  3NHE A;  3ERV A;  4FK5 A;  2HH5 A;  2DC7 A;  2FQ9 A;  3IV2 A;  1F29 A;  2E00 A;  2P7U A;  3E1Z B;  3PBH A;  3CH2 X;  3V6E A;  2FT2 A;  3O0U A;  1S4V A;  3BWK A;  5CVO B;  5K16 A;  2C0Y A;  1CV8 A;  1U9W A;  2DCD A;  2OUL A;  4BGF A;  2XU3 A;  1ZIV A;  4NV8 A;  4AXL A;  4N79 A;  2NQD B;  2VHS A;  3MHH A;  3U8E A;  3OF8 A;  7PCK A;  1ME3 A;  1MEM A;  3KWB X;  3N4C A;  4KLB A;  4OEM A;  2DJF B;  1THE A;  2DZY A;  2NQI A;  1MEG A;  1MS6 A;  2B1M A;  1PPP A;  3HD3 A;  1YVB A;  3IEJ A;  4YV8 A;  4YYW A;  2R6N A;  3OVX A;  3WXF A;  1EWM A;  1NPZ A;  1PPO A;  4RY2 A;  3IHP A;  3KFQ A;  4HWY A;  2AIM A;  1F2B A;  4P6G A;  1ITO A;  1DF0 A;  1MDW A;  2PBH A;  1MHW A;  3BPM A;  1GMY A;  2AUZ A;  3F5V A;  3P5W A;  2AYO A;  2DCB A;  3HHA A;  1EWL A;  3P5X A;  1CB5 A;  2HD5 A;  1QMY A;  1CS8 A;  4N8W A;  2FTD A;  1NQC A;  1BGO A;  3CH3 X;  5PAD A;  3LFY A;  1PE6 A;  3BC3 A;  3QSD A;  5CVN B;  3N3G A;  5EGW A;  4MSX A;  4YYQ A;  3P5U A;  1A6R A;  1AIM A;  2VFC A;  3M99 A;  2DCC A;  3RVW A;  2G8J A;  4X6I A;  1AU2 A;  1IWD A;  1KFX L;  3D9W A;  3HWN A;  1CTE A;  1DEU A;  6PAD A;  1NB5 A;  4PP2 E;  1TL9 A;  1TU6 A;  1EWP A;  3N3K A;  3IOQ A;  1QDQ A;  2F1G A;  1Q6K A;  2E03 A;  4W4U A;  2OP3 A;  2BDZ A;  2VFB A;  4QRG A;  2DZZ A;  1BQI A;  2PRE A;  3CBJ A;  1AU3 A;  1PIP A;  5J94 A;  2G6D A;  2YJ2 A;  3AI8 A;  1U5I A;  1STF E;  1TLO A;  4CDD B;  4YYV A;  2YJB A;  3H89 A;  4K7C A;  3H8B A;  3B79 A;  4CDE B;  5JA7 A;  3KSE A;  2FRQ A;  2R9F A;  2DCA A;  2R9O A;  1FH0 A;  1ICF A;  1QOL A;  4MZO A;  3I06 A;  5CVM A;  2FO5 A;  1VJV A;  1HUC B;  1MIR A;  5EF4 A;  1K3B B;  2DC8 A;  3PNR A;  8PCH A;  5A24 A;  1QXP A;  4BS5 A;  2PAD A;  2P0R A;  2P86 A;  1ME4 A;  4I04 A;  2E01 A;  1W6F A;  4YVA A;  2ARY A;  3QJ3 A;  4X6H A;  2XU5 A;  4MZS A;  4Q8H A;  3BPF A;  3D6S A;  4PAD A;  1CJL A;  3PDF A;  2BDL A;  3V6C A;  4CDF B;  4W5C A;  3K9M A;  4OEL A;  1PXV A;  1CQD A;  5CHV A;  1ZCM A;  4PI3 A;  4WA6 A;  2DJG B;  3PW3 A;  3CBK A;  2AUX A;  2R9M A;  2G8E A;  4NV7 A;  3IMA A;  4YYR A;  2NQG A;  5JH3 A;  1AYW A;  1YK7 A;  1F2A A;  2R9N A;  2WBF X;  3KWZ A;  2ACT A;  1KFU L;  4C5P A;  1JQP A;  1W5R A;  2F7D A;  2YJ8 A;  3S3R A;  4DMX A;  4B55 A;  1GCB A;  1SNK A;  1PBH A;  4X6J A;  4BPV A;  4XR7 A;  2DC9 A;  1KXR A;  1PPD A;  1PCI A;  3USV A;  3BOW A;  1U9V A;  4YYU A;  3HHI A;  3MOR A;  1O0E A;  1AYU A;  2VHF A;  2BSZ A;  4Q8G A;  4FIP A;  1CSB B;  4I05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...