1O0EA

1.9 angstrom crystal structure of a plant cysteine protease ervatamin c
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
208
structure length
208
Chain Sequence
LPEQIDWRKKGAVTPVKNQGSCGSCWAFSTVSTVESINQIRTGNLISLSEQELVDCDKKNHGCLGGAFVFAYQYIINNGGIDTQANYPYKAVQGPCQAASKVVSIDGYNGVPFCNEXALKQAVAVQPSTVAIDASSAQFQQYSSGIFSGPCGTKLNHGVTIVGYQANYWIVRNSWGRYWGEKGYIRMLRVGGCGLCGIARLPYYPTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ervatamin C
publication title Structural Basis of the Unusual Stability and Substrate Specificity of Ervatamin C, a Plant Cysteine Protease from Ervatamia coronaria
pubmed doi rcsb
molecule tags Hydrolase
total genus 68
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1o0eA00
4OELA 1DEUA 2P7UA 2PBHA 4N79A 1AYWA 3WXFA 3OF9A 1AYUA 1CJLA 3HWNA 3IUTA 3OVXA 4RY2A 1KHQA 3RVXA 2OP3A 1U9QX 1POPA 1ME4A 3C9EA 4FK5A 1PPNA 2F1GA 3PW3A 2FUDA 2XU1A 4K7CA 3ZUAA 1MEMA 4MSXA 2YJ2A 2G8EA 4YYQA 4YYUA 2YJBA 1EF7A 4CDCB 1NL6A 2CIOA 1CQDA 3OISA 5F02A 1TU6A 2P0RA 3BCNA 1DF0A 4N8WA 3IOQA 3IMAA 3CH3X 4PP2E 1PE6A 2JQFR 1MHWA 1JQPA 3KKUA 4X6IA 5EGWA 1X9YA 1BQIA 3ERVA 2Y6EA 1NPZA 3BWKA 4DMYA 1QXPA 3USVA 8PCHA 2FRQA 4YV8A 2AUXA 2B1NA 2G6DA 1XKGA 2DC7A 1CSBB 3HHAA 2YJ8A 2E02A 4BSQA 1U5IA 3OF8A 2PNSA 3IV2A 3KX1A 1BGOA 1QDQA 1F2AA 2NQIA 1NB3A 5EF4A 1NLJA 4I05A 2Y5BA 1QOLA 2YJ9A 5CHTA 3DF0A 3E1ZB 1AU0A 1NB5A 2WBFX 2XU5A 4YVAA 3I3TA 1SNKA 1ATKA 1AU3A 4BS6A 1PIPA 3K8UA 2DCAA 2HH5A 4X6JA 1F2CA 4YYRA 2HD5A 1ZIVA 1ME3A 2FTDA 3NHEA 3LXSA 2IPPB 2HXZA 1YK7A 2DJFB 4X6HA 1GMYA 4CDDB 4N4ZA 2E00A 4W4UA 2NQDB 1PPPA 2R9NA 4CDEB 3M99A 2G7YA 3RVWA 1BY8A 2YJCA 2DC8A 4PI3A 2PADA 1CPJA 2H7JA 3TNXA 4FJCA 2FO5A 3OVZA 4AXMA 5CVMA 1CS8A 3N4CA 4W5CA 2B1MA 1YT7A 5PADA 5CHVA 4PADA 2O6XA 3AI8A 3GCBA 3B79A 1KFUL 3P5VA 4QRXA 4QBBA 1U9WA 2XU3A 1U9VA 1YK8A 4G54A 1GLOA 1AIMA 3PNRA 1GECE 3QJ3A 3KW9A 2DC9A 1M6DA 1THEA 4HWYA 1Y08A 1KHPA 3H8BA 1CTEA 9PAPA 1S4VA 3S3RA 2E01A 1EWLA 3MTNA 5K16A 4BQVA 3CBKA 1EWMA 2GFOA 3N3GA 1MS6A 4P6GA 3IHPA 2XU4A 5FPWA 2R9OA 2AU1A 3D6SA 2FYEA 2VHSA 2DCDA 2DCBA 2OULA 4PP1A 2AYNA 1PADA 3WXGA 1MDWA 2DZZA 2ATOA 3O0UA 4P6EA 3MHHA 2BDZA 3MORA 1IWDA 1VSNA 3IEJA 4CZWA 4CDFB 3RVVA 1A6RA 3KFQA 2AS8A 1AU2A 2HHNA 3BC3A 3F75A 1AYVA 3WXEA 1EWPA 4MZSA 1SP4B 2JQGR 3P5WA 2G8JA 2BDLA 5JA7A 4WA6A 3HD3A 2FRAA 2VHFA 5JH3A 1HUCB 7PCKA 1KFXL 3H6SA 3K9MA 4W5BA 1TLOA 2AYOA 4ZUXU 1K3BB 3K24A 3PDFA 4BPVA 3P5XA 3H8CA 3KWBX 4XR7A 3O1GA 4MZOA 2AUZA 2ACTA 1TL9A 1VJVA 4QRGA 3V6CA 2DZYA 2GHUA 2C0YA 1U9XA 2DCCA 1F29A 5CVNB 3BOWA 3I06A 3KSEA 2R6NA 1AU4A 3QSDA 3H7DA 2R9MA 2PREA 2R9CA 4I07A 1AECA 3HHIA 1O0EA 3P5UA 4YYWA 3N3KA 4Q8GA 1CVZA 4QRVA 4AXLA 1GCBA 3BPFA 3BPMA 1Q6KA 2DJGB 4Q8HA 2E03A 3CBJA 1PXVA 2FQ9A 4YYVA 1BP4A 3S3QA 1PPOA 3U8EA 1PPDA 4I04A 2NQAA 3LFYA 3CH2X 1EWOA 1ICFA 3KWZA 4KLBA 2OZ2A 1F2BA 2R9FA 5J94A 5CVOB 4FIPA 4QH6A 3V6EA 1STFE 1QMYA 4BS5A 1ITOA 3H89A 1YALA 2FT2A 1PCIA 1YVBA 5A24A 1MIRA 4XUIA 2NQGA 2P86A 2CB5A 1NQCA 2AVWA 1KXRA 2AIMA 2ARYA 1CB5A 1CV8A 3F5VA 2IBIA 1MEGA 1PBHA 4DMXA 1ZCMA 6PADA 3PBHA 2DC6A 2F7DA 4OEMA 1Y4HA 3MHSA 4YYSA 3QT4A 1FH0A
chains in the Genus database with same CATH superfamily
3W31A 4OELA 1DEUA 2P7UA 2BTWA 2PBHA 4N79A 1AYWA 4BOPA 2DOSA 3WXFA 3OF9A 1AYUA 1CJLA 3HWNA 3IUTA 4GUAA 5KO3A 3OVXA 4RY2A 1KHQA 3RVXA 2OP3A 1U9QX 1POPA 1ME4A 3C9EA 4FK5A 1PPNA 2F1GA 3PW3A 2FUDA 2XU1A 4K7CA 3ZUAA 4D8IA 1MEMA 4MSXA 2YJ2A 3PSEA 2G8EA 2J7QC 3PRPA 4YYQA 4YYUA 3PHXA 2YJBA 1EF7A 4CDCB 1NL6A 4M0WA 2CIOA 1CQDA 3OISA 5F02A 1TU6A 2P0RA 3BCNA 1DF0A 4N8WA 3IOQA 3IMAA 3CH3X 4PP2E 1PE6A 2JQFR 1MHWA 1JQPA 3KKUA 4BOQA 4X6IA 5EGWA 1X9YA 1BQIA 3ERVA 2Y6EA 4ZTBA 1NPZA 3BWKA 4DMYA 1QXPA 3USVA 8PCHA 2FRQA 4YV8A 2AUXA 2B1NA 2G6DA 1XKGA 2DC7A 1CSBB 3HHAA 2YJ8A 2E02A 4BSQA 1U5IA 3OF8A 2PNSA 3IV2A 3TRKA 3KX1A 1BGOA 1QDQA 1F2AA 2NQIA 1NB3A 5EF4A 1NLJA 4I05A 2Y5BA 4BOUA 1QOLA 2YJ9A 5CHTA 3DF0A 3E1ZB 1AU0A 1NB5A 2WBFX 2XU5A 4YVAA 3I3TA 1SNKA 4HXDB 1ATKA 4MI7A 1AU3A 4BS6A 1PIPA 3K8UA 2AGAA 2DCAA 2HH5A 4X6JA 1F2CA 4REZA 3MP2A 3C0RA 4YYRA 2HD5A 1ZIVA 1ME3A 2FTDA 3NHEA 3LXSA 2IPPB 2HXZA 1YK7A 2DJFB 4X6HA 1GMYA 4CDDB 4N4ZA 2E00A 3ZNHA 1YZBA 3RNVA 4W4UA 2NQDB 1PPPA 2R9NA 4RNAA 4CDEB 3M99A 2JRIA 2G7YA 3RVWA 1BY8A 2YJCA 2DC8A 4PI3A 2PADA 1CPJA 2H7JA 3TNXA 4FJCA 2FO5A 3OVZA 4AXMA 5CVMA 1CS8A 3N4CA 4W5CA 2B1MA 1YT7A 5PADA 5CHVA 4PADA 2O6XA 3AI8A 3GCBA 3B79A 1KFUL 3P5VA 3PHWA 4QRXA 4QBBA 1U9WA 2XU3A 1U9VA 1YK8A 4G54A 3PT2A 1GLOA 1AIMA 3PNRA 1GECE 3QJ3A 3KW9A 2DC9A 3BY4A 1M6DA 1THEA 3PRMA 4HWYA 1Y08A 1KHPA 3H8BA 1CTEA 9PAPA 1S4VA 3S3RA 2E01A 1EWLA 3MTNA 5K16A 4BQVA 3CBKA 1EWMA 2GFOA 3N3GA 1MS6A 4P6GA 5EZSA 3IHPA 2XU4A 5FPWA 4RF1A 2R9OA 2AU1A 3BBAA 3D6SA 2FYEA 4RKXA 2VHSA 2DCDA 3BB7A 2DCBA 2OULA 4PP1A 4IUMA 2AYNA 1PADA 3WXGA 1MDWA 2DZZA 2ATOA 3O0UA 4PT5A 4P6EA 3MHHA 2BDZA 3MORA 1IWDA 1VSNA 3IEJA 4CZWA 4CDFB 3RVVA 1A6RA 3KFQA 2AS8A 1AU2A 2HHNA 3BC3A 3F75A 4OVZB 1AYVA 3WXEA 3W30A 1EWPA 4MZSA 1SP4B 2JQGR 3P5WA 2G8JA 2BDLA 5JA7A 4WA6A 3HD3A 2FRAA 2VHFA 5JH3A 1HUCB 7PCKA 1KFXL 3H6SA 3K9MA 4W5BA 1TLOA 2Z84A 2AYOA 3IFUA 4ZUXU 1K3BB 3K24A 3PDFA 4BPVA 3P5XA 3H8CA 3KWBX 4XR7A 3O1GA 4MZOA 4R3DA 2AUZA 2ACTA 1TL9A 1VJVA 4QRGA 3V6CA 2DZYA 4D8BA 2GHUA 2C0YA 1U9XA 4IP3A 2DCCA 1F29A 5CVNB 3BOWA 5EZQA 2FE8A 3I06A 3B21A 3KSEA 2R6NA 1AU4A 3QSDA 3H7DA 2R9MA 2PREA 1PVJA 2R9CA 4I07A 1AECA 4A5UA 3HHIA 1O0EA 3O65A 3MJ5A 3P5UA 3E9SA 4YYWA 3N3KA 1DKIA 4OVZA 4Q8GA 1CVZA 4QRVA 4AXLA 1GCBA 3BPFA 3BPMA 2BTWB 4D8EA 1Q6KA 3TMPA 2DJGB 4Q8HA 3OQCA 2E03A 3CBJA 1PXVA 2FQ9A 4YYVA 1BP4A 3S3QA 3MTVA 1PPOA 3U8EA 1PPDA 4I04A 2NQAA 3LFYA 3CH2X 2UZJA 1EWOA 1ICFA 3KWZA 2JTCA 4KLBA 2OZ2A 1F2BA 2R9FA 5J94A 5CVOB 4FIPA 4QH6A 3V6EA 1STFE 1QMYA 4BS5A 1ITOA 3H89A 4BOSA 1YALA 4P16A 2FT2A 2J7QA 1PCIA 1YVBA 5A24A 1MIRA 4XUIA 2NQGA 4BOZA 2P86A 2CB5A 1NQCA 2AVWA 4RF0A 1KXRA 2AIMA 2ARYA 1CB5A 4OW0A 1CV8A 3F5VA 2HWKA 2IBIA 1MEGA 5JZEA 1PBHA 2BU3A 4DMXA 1UKFA 1ZCMA 6PADA 3PBHA 3PHUA 2DC6A 2F7DA 4OEMA 1Y4HA 3MHSA 4YYSA 4WURA 3QT4A 4XZXA 4MM3B 5E6JA 1FH0A
chains in the Genus database with same CATH topology
4OELA 1DEUA 2P7UA 2PBHA 4N79A 1AYWA 3WXFA 3OF9A 1AYUA 1CJLA 3HWNA 3IUTA 3OVXA 4RY2A 1KHQA 3RVXA 2OP3A 1U9QX 1POPA 1ME4A 3C9EA 4FK5A 1PPNA 2F1GA 3PW3A 2FUDA 2XU1A 3LTWA 4K7CA 3ZUAA 1MEMA 4MSXA 2YJ2A 2G8EA 4YYQA 4YYUA 2YJBA 1EF7A 4CDCB 1NL6A 2CIOA 1CQDA 3OISA 5F02A 1TU6A 2P0RA 3BCNA 1DF0A 4N8WA 3IOQA 3IMAA 3CH3X 4PP2E 1PE6A 2JQFR 1MHWA 1JQPA 3KKUA 4X6IA 5EGWA 1X9YA 1BQIA 3ERVA 2Y6EA 1NPZA 3BWKA 4DMYA 1QXPA 3USVA 8PCHA 2FRQA 4YV8A 2AUXA 2B1NA 2G6DA 1XKGA 1W6FA 2DC7A 1CSBB 3HHAA 2YJ8A 3D9WA 2E02A 4BSQA 1U5IA 4B55A 4BGFA 3OF8A 2PNSA 3IV2A 3KX1A 1BGOA 1QDQA 1F2AA 2NQIA 1NB3A 5EF4A 1NLJA 4I05A 2Y5BA 1QOLA 2YJ9A 5CHTA 3DF0A 3E1ZB 1AU0A 2VFCA 1NB5A 2WBFX 2XU5A 4YVAA 3I3TA 1SNKA 1ATKA 1AU3A 4BS6A 1PIPA 3K8UA 2DCAA 2HH5A 4X6JA 1F2CA 2VFBA 4YYRA 2HD5A 1ZIVA 1ME3A 2FTDA 3NHEA 3LXSA 2IPPB 2HXZA 1YK7A 2DJFB 4X6HA 1GMYA 4CDDB 4N4ZA 2E00A 4W4UA 2NQDB 1PPPA 2R9NA 4CDEB 4GUZA 3M99A 2G7YA 3RVWA 1BY8A 2YJCA 2DC8A 4PI3A 2PADA 1CPJA 2H7JA 3TNXA 4FJCA 2FO5A 3OVZA 4AXMA 5CVMA 1CS8A 3N4CA 4W5CA 2B1MA 1YT7A 5PADA 5CHVA 4PADA 2O6XA 3AI8A 3GCBA 3B79A 1KFUL 3P5VA 4QRXA 4QBBA 1U9WA 2XU3A 1U9VA 1YK8A 4G54A 1GLOA 1AIMA 3PNRA 1GECE 3QJ3A 3KW9A 2DC9A 1M6DA 1THEA 4HWYA 1Y08A 1KHPA 3H8BA 1CTEA 9PAPA 1S4VA 3S3RA 2E01A 1EWLA 3MTNA 5K16A 4BQVA 3CBKA 1EWMA 2GFOA 3N3GA 1MS6A 4P6GA 3IHPA 2XU4A 5FPWA 2R9OA 2AU1A 3D6SA 2FYEA 2VHSA 2DCDA 2DCBA 2OULA 4PP1A 1W4TA 2BSZA 2AYNA 4NV7A 1PADA 3WXGA 1MDWA 2DZZA 2ATOA 3O0UA 4P6EA 3MHHA 2BDZA 3MORA 1IWDA 1VSNA 3IEJA 4CZWA 4CDFB 3RVVA 1A6RA 3KFQA 2AS8A 1AU2A 2HHNA 3BC3A 3F75A 1AYVA 3WXEA 1EWPA 4MZSA 1SP4B 2JQGR 3P5WA 4NV8A 2G8JA 2BDLA 5JA7A 4WA6A 3HD3A 2FRAA 2VHFA 5JH3A 1HUCB 7PCKA 1KFXL 3H6SA 3K9MA 4W5BA 1TLOA 2AYOA 4ZUXU 1K3BB 3K24A 3PDFA 4BPVA 3P5XA 3H8CA 3KWBX 4XR7A 3O1GA 4MZOA 2AUZA 2ACTA 1TL9A 1VJVA 4QRGA 3V6CA 2DZYA 2GHUA 2C0YA 1U9XA 2DCCA 1F29A 5CVNB 3BOWA 3I06A 3KSEA 2R6NA 1AU4A 3QSDA 3H7DA 2R9MA 2PREA 2R9CA 4I07A 1AECA 3HHIA 1O0EA 3P5UA 4YYWA 3N3KA 4Q8GA 1CVZA 4QRVA 4AXLA 1GCBA 3BPFA 1E2TA 3BPMA 4C5PA 1Q6KA 2DJGB 4Q8HA 2E03A 3CBJA 1PXVA 2FQ9A 4YYVA 1BP4A 3S3QA 1PPOA 3U8EA 1PPDA 4I04A 2NQAA 3LFYA 3CH2X 1EWOA 1ICFA 3KWZA 4KLBA 2OZ2A 1F2BA 2R9FA 5J94A 5CVOB 4FIPA 4QH6A 3V6EA 1STFE 1QMYA 4BS5A 1W5RA 1ITOA 3H89A 1YALA 2FT2A 1PCIA 1YVBA 5A24A 1MIRA 4XUIA 2NQGA 2P86A 2CB5A 1NQCA 2AVWA 1KXRA 2AIMA 2ARYA 1CB5A 1CV8A 3F5VA 2IBIA 1MEGA 1PBHA 4DMXA 1ZCMA 6PADA 3PBHA 2DC6A 2F7DA 4OEMA 1Y4HA 3MHSA 4YYSA 3QT4A 1GX3A 1FH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OEL A;  1DEU A;  2P7U A;  2PBH A;  4N79 A;  1AYW A;  3WXF A;  3OF9 A;  1AYU A;  1CJL A;  3HWN A;  3IUT A;  3OVX A;  4RY2 A;  1KHQ A;  3RVX A;  2OP3 A;  1U9Q X;  1POP A;  1ME4 A;  3C9E A;  4FK5 A;  1PPN A;  2F1G A;  3PW3 A;  2FUD A;  2XU1 A;  4K7C A;  3ZUA A;  1MEM A;  4MSX A;  2YJ2 A;  2G8E A;  4YYQ A;  4YYU A;  2YJB A;  1EF7 A;  4CDC B;  1NL6 A;  2CIO A;  1CQD A;  3OIS A;  5F02 A;  1TU6 A;  2P0R A;  3BCN A;  1DF0 A;  4N8W A;  3IOQ A;  3IMA A;  3CH3 X;  4PP2 E;  1PE6 A;  2JQF R;  1MHW A;  1JQP A;  3KKU A;  4X6I A;  5EGW A;  1X9Y A;  1BQI A;  3ERV A;  2Y6E A;  1NPZ A;  3BWK A;  4DMY A;  1QXP A;  3USV A;  8PCH A;  2FRQ A;  4YV8 A;  2AUX A;  2B1N A;  2G6D A;  1XKG A;  2DC7 A;  1CSB B;  3HHA A;  2YJ8 A;  2E02 A;  4BSQ A;  1U5I A;  3OF8 A;  2PNS A;  3IV2 A;  3KX1 A;  1BGO A;  1QDQ A;  1F2A A;  2NQI A;  1NB3 A;  5EF4 A;  1NLJ A;  4I05 A;  2Y5B A;  1QOL A;  2YJ9 A;  5CHT A;  3DF0 A;  3E1Z B;  1AU0 A;  1NB5 A;  2WBF X;  2XU5 A;  4YVA A;  3I3T A;  1SNK A;  1ATK A;  1AU3 A;  4BS6 A;  1PIP A;  3K8U A;  2DCA A;  2HH5 A;  4X6J A;  1F2C A;  4YYR A;  2HD5 A;  1ZIV A;  1ME3 A;  2FTD A;  3NHE A;  3LXS A;  2IPP B;  2HXZ A;  1YK7 A;  2DJF B;  4X6H A;  1GMY A;  4CDD B;  4N4Z A;  2E00 A;  4W4U A;  2NQD B;  1PPP A;  2R9N A;  4CDE B;  3M99 A;  2G7Y A;  3RVW A;  1BY8 A;  2YJC A;  2DC8 A;  4PI3 A;  2PAD A;  1CPJ A;  2H7J A;  3TNX A;  4FJC A;  2FO5 A;  3OVZ A;  4AXM A;  5CVM A;  1CS8 A;  3N4C A;  4W5C A;  2B1M A;  1YT7 A;  5PAD A;  5CHV A;  4PAD A;  2O6X A;  3AI8 A;  3GCB A;  3B79 A;  1KFU L;  3P5V A;  4QRX A;  4QBB A;  1U9W A;  2XU3 A;  1U9V A;  1YK8 A;  4G54 A;  1GLO A;  1AIM A;  3PNR A;  1GEC E;  3QJ3 A;  3KW9 A;  2DC9 A;  1M6D A;  1THE A;  4HWY A;  1Y08 A;  1KHP A;  3H8B A;  1CTE A;  9PAP A;  1S4V A;  3S3R A;  2E01 A;  1EWL A;  3MTN A;  5K16 A;  4BQV A;  3CBK A;  1EWM A;  2GFO A;  3N3G A;  1MS6 A;  4P6G A;  3IHP A;  2XU4 A;  5FPW A;  2R9O A;  2AU1 A;  3D6S A;  2FYE A;  2VHS A;  2DCD A;  2DCB A;  2OUL A;  4PP1 A;  2AYN A;  1PAD A;  3WXG A;  1MDW A;  2DZZ A;  2ATO A;  3O0U A;  4P6E A;  3MHH A;  2BDZ A;  3MOR A;  1IWD A;  1VSN A;  3IEJ A;  4CZW A;  4CDF B;  3RVV A;  1A6R A;  3KFQ A;  2AS8 A;  1AU2 A;  2HHN A;  3BC3 A;  3F75 A;  1AYV A;  3WXE A;  1EWP A;  4MZS A;  1SP4 B;  2JQG R;  3P5W A;  2G8J A;  2BDL A;  5JA7 A;  4WA6 A;  3HD3 A;  2FRA A;  2VHF A;  5JH3 A;  1HUC B;  7PCK A;  1KFX L;  3H6S A;  3K9M A;  4W5B A;  1TLO A;  2AYO A;  4ZUX U;  1K3B B;  3K24 A;  3PDF A;  4BPV A;  3P5X A;  3H8C A;  3KWB X;  4XR7 A;  3O1G A;  4MZO A;  2AUZ A;  2ACT A;  1TL9 A;  1VJV A;  4QRG A;  3V6C A;  2DZY A;  2GHU A;  2C0Y A;  1U9X A;  2DCC A;  1F29 A;  5CVN B;  3BOW A;  3I06 A;  3KSE A;  2R6N A;  1AU4 A;  3QSD A;  3H7D A;  2R9M A;  2PRE A;  2R9C A;  4I07 A;  1AEC A;  3HHI A;  1O0E A;  3P5U A;  4YYW A;  3N3K A;  4Q8G A;  1CVZ A;  4QRV A;  4AXL A;  1GCB A;  3BPF A;  3BPM A;  1Q6K A;  2DJG B;  4Q8H A;  2E03 A;  3CBJ A;  1PXV A;  2FQ9 A;  4YYV A;  1BP4 A;  3S3Q A;  1PPO A;  3U8E A;  1PPD A;  4I04 A;  2NQA A;  3LFY A;  3CH2 X;  1EWO A;  1ICF A;  3KWZ A;  4KLB A;  2OZ2 A;  1F2B A;  2R9F A;  5J94 A;  5CVO B;  4FIP A;  4QH6 A;  3V6E A;  1STF E;  1QMY A;  4BS5 A;  1ITO A;  3H89 A;  1YAL A;  2FT2 A;  1PCI A;  1YVB A;  5A24 A;  1MIR A;  4XUI A;  2NQG A;  2P86 A;  2CB5 A;  1NQC A;  2AVW A;  1KXR A;  2AIM A;  2ARY A;  1CB5 A;  1CV8 A;  3F5V A;  2IBI A;  1MEG A;  1PBH A;  4DMX A;  1ZCM A;  6PAD A;  3PBH A;  2DC6 A;  2F7D A;  4OEM A;  1Y4H A;  3MHS A;  4YYS A;  3QT4 A;  1FH0 A; 
#chains in the Genus database with same CATH topology
 3W31 A;  4OEL A;  1DEU A;  2P7U A;  2BTW A;  2PBH A;  4N79 A;  1AYW A;  4BOP A;  2DOS A;  3WXF A;  3OF9 A;  1AYU A;  1CJL A;  3HWN A;  3IUT A;  4GUA A;  5KO3 A;  3OVX A;  4RY2 A;  1KHQ A;  3RVX A;  2OP3 A;  1U9Q X;  1POP A;  1ME4 A;  3C9E A;  4FK5 A;  1PPN A;  2F1G A;  3PW3 A;  2FUD A;  2XU1 A;  4K7C A;  3ZUA A;  4D8I A;  1MEM A;  4MSX A;  2YJ2 A;  3PSE A;  2G8E A;  2J7Q C;  3PRP A;  4YYQ A;  4YYU A;  3PHX A;  2YJB A;  1EF7 A;  4CDC B;  1NL6 A;  4M0W A;  2CIO A;  1CQD A;  3OIS A;  5F02 A;  1TU6 A;  2P0R A;  3BCN A;  1DF0 A;  4N8W A;  3IOQ A;  3IMA A;  3CH3 X;  4PP2 E;  1PE6 A;  2JQF R;  1MHW A;  1JQP A;  3KKU A;  4BOQ A;  4X6I A;  5EGW A;  1X9Y A;  1BQI A;  3ERV A;  2Y6E A;  4ZTB A;  1NPZ A;  3BWK A;  4DMY A;  1QXP A;  3USV A;  8PCH A;  2FRQ A;  4YV8 A;  2AUX A;  2B1N A;  2G6D A;  1XKG A;  2DC7 A;  1CSB B;  3HHA A;  2YJ8 A;  2E02 A;  4BSQ A;  1U5I A;  3OF8 A;  2PNS A;  3IV2 A;  3TRK A;  3KX1 A;  1BGO A;  1QDQ A;  1F2A A;  2NQI A;  1NB3 A;  5EF4 A;  1NLJ A;  4I05 A;  2Y5B A;  4BOU A;  1QOL A;  2YJ9 A;  5CHT A;  3DF0 A;  3E1Z B;  1AU0 A;  1NB5 A;  2WBF X;  2XU5 A;  4YVA A;  3I3T A;  1SNK A;  4HXD B;  1ATK A;  4MI7 A;  1AU3 A;  4BS6 A;  1PIP A;  3K8U A;  2AGA A;  2DCA A;  2HH5 A;  4X6J A;  1F2C A;  4REZ A;  3MP2 A;  3C0R A;  4YYR A;  2HD5 A;  1ZIV A;  1ME3 A;  2FTD A;  3NHE A;  3LXS A;  2IPP B;  2HXZ A;  1YK7 A;  2DJF B;  4X6H A;  1GMY A;  4CDD B;  4N4Z A;  2E00 A;  3ZNH A;  1YZB A;  3RNV A;  4W4U A;  2NQD B;  1PPP A;  2R9N A;  4RNA A;  4CDE B;  3M99 A;  2JRI A;  2G7Y A;  3RVW A;  1BY8 A;  2YJC A;  2DC8 A;  4PI3 A;  2PAD A;  1CPJ A;  2H7J A;  3TNX A;  4FJC A;  2FO5 A;  3OVZ A;  4AXM A;  5CVM A;  1CS8 A;  3N4C A;  4W5C A;  2B1M A;  1YT7 A;  5PAD A;  5CHV A;  4PAD A;  2O6X A;  3AI8 A;  3GCB A;  3B79 A;  1KFU L;  3P5V A;  3PHW A;  4QRX A;  4QBB A;  1U9W A;  2XU3 A;  1U9V A;  1YK8 A;  4G54 A;  3PT2 A;  1GLO A;  1AIM A;  3PNR A;  1GEC E;  3QJ3 A;  3KW9 A;  2DC9 A;  3BY4 A;  1M6D A;  1THE A;  3PRM A;  4HWY A;  1Y08 A;  1KHP A;  3H8B A;  1CTE A;  9PAP A;  1S4V A;  3S3R A;  2E01 A;  1EWL A;  3MTN A;  5K16 A;  4BQV A;  3CBK A;  1EWM A;  2GFO A;  3N3G A;  1MS6 A;  4P6G A;  5EZS A;  3IHP A;  2XU4 A;  5FPW A;  4RF1 A;  2R9O A;  2AU1 A;  3BBA A;  3D6S A;  2FYE A;  4RKX A;  2VHS A;  2DCD A;  3BB7 A;  2DCB A;  2OUL A;  4PP1 A;  4IUM A;  2AYN A;  1PAD A;  3WXG A;  1MDW A;  2DZZ A;  2ATO A;  3O0U A;  4PT5 A;  4P6E A;  3MHH A;  2BDZ A;  3MOR A;  1IWD A;  1VSN A;  3IEJ A;  4CZW A;  4CDF B;  3RVV A;  1A6R A;  3KFQ A;  2AS8 A;  1AU2 A;  2HHN A;  3BC3 A;  3F75 A;  4OVZ B;  1AYV A;  3WXE A;  3W30 A;  1EWP A;  4MZS A;  1SP4 B;  2JQG R;  3P5W A;  2G8J A;  2BDL A;  5JA7 A;  4WA6 A;  3HD3 A;  2FRA A;  2VHF A;  5JH3 A;  1HUC B;  7PCK A;  1KFX L;  3H6S A;  3K9M A;  4W5B A;  1TLO A;  2Z84 A;  2AYO A;  3IFU A;  4ZUX U;  1K3B B;  3K24 A;  3PDF A;  4BPV A;  3P5X A;  3H8C A;  3KWB X;  4XR7 A;  3O1G A;  4MZO A;  4R3D A;  2AUZ A;  2ACT A;  1TL9 A;  1VJV A;  4QRG A;  3V6C A;  2DZY A;  4D8B A;  2GHU A;  2C0Y A;  1U9X A;  4IP3 A;  2DCC A;  1F29 A;  5CVN B;  3BOW A;  5EZQ A;  2FE8 A;  3I06 A;  3B21 A;  3KSE A;  2R6N A;  1AU4 A;  3QSD A;  3H7D A;  2R9M A;  2PRE A;  1PVJ A;  2R9C A;  4I07 A;  1AEC A;  4A5U A;  3HHI A;  1O0E A;  3O65 A;  3MJ5 A;  3P5U A;  3E9S A;  4YYW A;  3N3K A;  1DKI A;  4OVZ A;  4Q8G A;  1CVZ A;  4QRV A;  4AXL A;  1GCB A;  3BPF A;  3BPM A;  2BTW B;  4D8E A;  1Q6K A;  3TMP A;  2DJG B;  4Q8H A;  3OQC A;  2E03 A;  3CBJ A;  1PXV A;  2FQ9 A;  4YYV A;  1BP4 A;  3S3Q A;  3MTV A;  1PPO A;  3U8E A;  1PPD A;  4I04 A;  2NQA A;  3LFY A;  3CH2 X;  2UZJ A;  1EWO A;  1ICF A;  3KWZ A;  2JTC A;  4KLB A;  2OZ2 A;  1F2B A;  2R9F A;  5J94 A;  5CVO B;  4FIP A;  4QH6 A;  3V6E A;  1STF E;  1QMY A;  4BS5 A;  1ITO A;  3H89 A;  4BOS A;  1YAL A;  4P16 A;  2FT2 A;  2J7Q A;  1PCI A;  1YVB A;  5A24 A;  1MIR A;  4XUI A;  2NQG A;  4BOZ A;  2P86 A;  2CB5 A;  1NQC A;  2AVW A;  4RF0 A;  1KXR A;  2AIM A;  2ARY A;  1CB5 A;  4OW0 A;  1CV8 A;  3F5V A;  2HWK A;  2IBI A;  1MEG A;  5JZE A;  1PBH A;  2BU3 A;  4DMX A;  1UKF A;  1ZCM A;  6PAD A;  3PBH A;  3PHU A;  2DC6 A;  2F7D A;  4OEM A;  1Y4H A;  3MHS A;  4YYS A;  4WUR A;  3QT4 A;  4XZX A;  4MM3 B;  5E6J A;  1FH0 A; 
#chains in the Genus database with same CATH homology
 4OEL A;  1DEU A;  2P7U A;  2PBH A;  4N79 A;  1AYW A;  3WXF A;  3OF9 A;  1AYU A;  1CJL A;  3HWN A;  3IUT A;  3OVX A;  4RY2 A;  1KHQ A;  3RVX A;  2OP3 A;  1U9Q X;  1POP A;  1ME4 A;  3C9E A;  4FK5 A;  1PPN A;  2F1G A;  3PW3 A;  2FUD A;  2XU1 A;  3LTW A;  4K7C A;  3ZUA A;  1MEM A;  4MSX A;  2YJ2 A;  2G8E A;  4YYQ A;  4YYU A;  2YJB A;  1EF7 A;  4CDC B;  1NL6 A;  2CIO A;  1CQD A;  3OIS A;  5F02 A;  1TU6 A;  2P0R A;  3BCN A;  1DF0 A;  4N8W A;  3IOQ A;  3IMA A;  3CH3 X;  4PP2 E;  1PE6 A;  2JQF R;  1MHW A;  1JQP A;  3KKU A;  4X6I A;  5EGW A;  1X9Y A;  1BQI A;  3ERV A;  2Y6E A;  1NPZ A;  3BWK A;  4DMY A;  1QXP A;  3USV A;  8PCH A;  2FRQ A;  4YV8 A;  2AUX A;  2B1N A;  2G6D A;  1XKG A;  1W6F A;  2DC7 A;  1CSB B;  3HHA A;  2YJ8 A;  3D9W A;  2E02 A;  4BSQ A;  1U5I A;  4B55 A;  4BGF A;  3OF8 A;  2PNS A;  3IV2 A;  3KX1 A;  1BGO A;  1QDQ A;  1F2A A;  2NQI A;  1NB3 A;  5EF4 A;  1NLJ A;  4I05 A;  2Y5B A;  1QOL A;  2YJ9 A;  5CHT A;  3DF0 A;  3E1Z B;  1AU0 A;  2VFC A;  1NB5 A;  2WBF X;  2XU5 A;  4YVA A;  3I3T A;  1SNK A;  1ATK A;  1AU3 A;  4BS6 A;  1PIP A;  3K8U A;  2DCA A;  2HH5 A;  4X6J A;  1F2C A;  2VFB A;  4YYR A;  2HD5 A;  1ZIV A;  1ME3 A;  2FTD A;  3NHE A;  3LXS A;  2IPP B;  2HXZ A;  1YK7 A;  2DJF B;  4X6H A;  1GMY A;  4CDD B;  4N4Z A;  2E00 A;  4W4U A;  2NQD B;  1PPP A;  2R9N A;  4CDE B;  4GUZ A;  3M99 A;  2G7Y A;  3RVW A;  1BY8 A;  2YJC A;  2DC8 A;  4PI3 A;  2PAD A;  1CPJ A;  2H7J A;  3TNX A;  4FJC A;  2FO5 A;  3OVZ A;  4AXM A;  5CVM A;  1CS8 A;  3N4C A;  4W5C A;  2B1M A;  1YT7 A;  5PAD A;  5CHV A;  4PAD A;  2O6X A;  3AI8 A;  3GCB A;  3B79 A;  1KFU L;  3P5V A;  4QRX A;  4QBB A;  1U9W A;  2XU3 A;  1U9V A;  1YK8 A;  4G54 A;  1GLO A;  1AIM A;  3PNR A;  1GEC E;  3QJ3 A;  3KW9 A;  2DC9 A;  1M6D A;  1THE A;  4HWY A;  1Y08 A;  1KHP A;  3H8B A;  1CTE A;  9PAP A;  1S4V A;  3S3R A;  2E01 A;  1EWL A;  3MTN A;  5K16 A;  4BQV A;  3CBK A;  1EWM A;  2GFO A;  3N3G A;  1MS6 A;  4P6G A;  3IHP A;  2XU4 A;  5FPW A;  2R9O A;  2AU1 A;  3D6S A;  2FYE A;  2VHS A;  2DCD A;  2DCB A;  2OUL A;  4PP1 A;  1W4T A;  2BSZ A;  2AYN A;  4NV7 A;  1PAD A;  3WXG A;  1MDW A;  2DZZ A;  2ATO A;  3O0U A;  4P6E A;  3MHH A;  2BDZ A;  3MOR A;  1IWD A;  1VSN A;  3IEJ A;  4CZW A;  4CDF B;  3RVV A;  1A6R A;  3KFQ A;  2AS8 A;  1AU2 A;  2HHN A;  3BC3 A;  3F75 A;  1AYV A;  3WXE A;  1EWP A;  4MZS A;  1SP4 B;  2JQG R;  3P5W A;  4NV8 A;  2G8J A;  2BDL A;  5JA7 A;  4WA6 A;  3HD3 A;  2FRA A;  2VHF A;  5JH3 A;  1HUC B;  7PCK A;  1KFX L;  3H6S A;  3K9M A;  4W5B A;  1TLO A;  2AYO A;  4ZUX U;  1K3B B;  3K24 A;  3PDF A;  4BPV A;  3P5X A;  3H8C A;  3KWB X;  4XR7 A;  3O1G A;  4MZO A;  2AUZ A;  2ACT A;  1TL9 A;  1VJV A;  4QRG A;  3V6C A;  2DZY A;  2GHU A;  2C0Y A;  1U9X A;  2DCC A;  1F29 A;  5CVN B;  3BOW A;  3I06 A;  3KSE A;  2R6N A;  1AU4 A;  3QSD A;  3H7D A;  2R9M A;  2PRE A;  2R9C A;  4I07 A;  1AEC A;  3HHI A;  1O0E A;  3P5U A;  4YYW A;  3N3K A;  4Q8G A;  1CVZ A;  4QRV A;  4AXL A;  1GCB A;  3BPF A;  1E2T A;  3BPM A;  4C5P A;  1Q6K A;  2DJG B;  4Q8H A;  2E03 A;  3CBJ A;  1PXV A;  2FQ9 A;  4YYV A;  1BP4 A;  3S3Q A;  1PPO A;  3U8E A;  1PPD A;  4I04 A;  2NQA A;  3LFY A;  3CH2 X;  1EWO A;  1ICF A;  3KWZ A;  4KLB A;  2OZ2 A;  1F2B A;  2R9F A;  5J94 A;  5CVO B;  4FIP A;  4QH6 A;  3V6E A;  1STF E;  1QMY A;  4BS5 A;  1W5R A;  1ITO A;  3H89 A;  1YAL A;  2FT2 A;  1PCI A;  1YVB A;  5A24 A;  1MIR A;  4XUI A;  2NQG A;  2P86 A;  2CB5 A;  1NQC A;  2AVW A;  1KXR A;  2AIM A;  2ARY A;  1CB5 A;  1CV8 A;  3F5V A;  2IBI A;  1MEG A;  1PBH A;  4DMX A;  1ZCM A;  6PAD A;  3PBH A;  2DC6 A;  2F7D A;  4OEM A;  1Y4H A;  3MHS A;  4YYS A;  3QT4 A;  1GX3 A;  1FH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...