1O0EA

1.9 angstrom crystal structure of a plant cysteine protease ervatamin c
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
208
structure length
208
Chain Sequence
b'LPEQIDWRKKGAVTPVKNQGSCGSCWAFSTVSTVESINQIRTGNLISLSEQELVDCDKKNHGCLGGAFVFAYQYIINNGGIDTQANYPYKAVQGPCQAASKVVSIDGYNGVPFCNEXALKQAVAVQPSTVAIDASSAQFQQYSSGIFSGPCGTKLNHGVTIVGYQANYWIVRNSWGRYWGEKGYIRMLRVGGCGLCGIARLPYYPTKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ervatamin C
molecule tags Hydrolase
publication title Structural Basis of the Unusual Stability and Substrate Specificity of Ervatamin C, a Plant Cysteine Protease from Ervatamia coronaria
pubmed doi rcsb
total genus 68
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1o0eA00
1ATKA 1BQIA 3BWKA 1TLOA 1ZIVA 1BGOA 4YVAA 2B1NA 3USVA 2VHSA 4AXLA 4YYRA 2FYEA 3K8UA 4X6IA 4RY2A 3CH2X 1U9VA 1S4VA 2GHUA 3I3TA 4DMYA 2R9CA 3C9EA 2CIOA 4BS6A 2G6DA 3OF8A 5EGWA 1KFUL 1MEGA 3M99A 1NB5A 1GECE 2P86A 4X6JA 1EWPA 2C0YA 4CZWA 3MORA 1U5IA 2O6XA 2NQAA 1CPJA 1CB5A 3KFQA 3BCNA 1SP4B 2ACTA 1AIMA 4YYUA 2R9OA 3NHEA 1ME3A 4AXMA 3H8BA 2HD5A 1U9QX 3WXEA 4PADA 3P5XA 5EF4A 2G8EA 1ITOA 5CHVA 2FT2A 2FUDA 3BOWA 2R6NA 3K24A 1AU2A 4P6EA 3IHPA 3V6CA 5JA7A 2AU1A 4ZUXU 1QOLA 1FH0A 2AYOA 2B1MA 3F75A 3V6EA 2PREA 3D6SA 1MIRA 3WXGA 1GMYA 4FJCA 2G8JA 4QRXA 3GCBA 1CVZA 4OELA 4XUIA 1AYWA 2YJBA 5FPWA 4MZSA 2XU1A 4I04A 2YJ2A 1ME4A 2DJGB 1F29A 2H7JA 4QRVA 1HUCB 4QBBA 1NQCA 1PIPA 1CJLA 2HXZA 2ARYA 2DCBA 1PPDA 1MHWA 4Q8HA 2CB5A 2XU3A 4YV8A 2AUXA 2PADA 1CTEA 4PI3A 4N4ZA 4W4UA 3MHSA 4QRGA 1CV8A 1MS6A 1CSBB 3P5UA 3OF9A 3KW9A 1EF7A 4P6GA 7PCKA 4XR7A 3LFYA 1Q6KA 2DC8A 5JH3A 3H89A 3O1GA 2DZZA 3F5VA 3H7DA 2GFOA 4KLBA 4DMXA 2P7UA 1TU6A 2DC6A 5CHTA 4YYWA 4N8WA 1CQDA 3KSEA 1QMYA 1F2BA 3N4CA 2AIMA 3CH3X 3QT4A 5CVMA 1VJVA 4YYVA 5K16A 1GCBA 3BPFA 3E1ZB 1PBHA 4W5CA 3H6SA 1BP4A 2R9FA 1U9WA 1EWMA 3B79A 3RVXA 1NB3A 3KX1A 4I07A 1AYVA 1NPZA 3CBJA 1PPNA 2G7YA 2AVWA 1MEMA 2DCDA 1DF0A 2IBIA 1VSNA 3P5VA 3PDFA 3KWZA 3IEJA 3AI8A 4BSQA 2DC9A 4BPVA 4G54A 1NLJA 3S3QA 8PCHA 3PNRA 4FK5A 6PADA 2IPPB 1KXRA 2WBFX 1K3BB 2E03A 1KHQA 2Y5BA 3RVWA 4YYSA 5CVOB 3OISA 4CDEB 3IMAA 4QH6A 1MDWA 1ICFA 1YALA 3BC3A 4BQVA 2JQFR 3OVZA 2NQIA 2FRAA 4PP2E 1NL6A 1ZCMA 3N3GA 1AYUA 1THEA 3CBKA 2HHNA 3IV2A 4CDCB 1QXPA 1PPPA 1XKGA 3N3KA 1JQPA 3P5WA 3PBHA 3PW3A 3ZUAA 2NQDB 2YJ8A 3LXSA 1SNKA 2R9NA 2OULA 1PCIA 3MHHA 1QDQA 3HD3A 3S3RA 2ATOA 2FTDA 3U8EA 3IOQA 2DCAA 1F2CA 9PAPA 2OZ2A 1EWOA 1YT7A 4K7CA 2F7DA 1CS8A 4PP1A 2YJ9A 1TL9A 5PADA 3IUTA 3I06A 2FO5A 3OVXA 1POPA 3HWNA 2HH5A 3TNXA 1F2AA 2DJFB 2OP3A 1IWDA 1YK7A 1X9YA 1AU3A 3KKUA 1DEUA 1M6DA 1A6RA 1Y08A 2AYNA 1O0EA 3QJ3A 2AS8A 3ERVA 4HWYA 3QSDA 4Q8GA 3WXFA 1GLOA 1YK8A 1PE6A 3KWBX 1AECA 2BDZA 1YVBA 2P0RA 2XU5A 4YYQA 4I05A 1PPOA 2E02A 2DC7A 2DCCA 2Y6EA 4FIPA 2E00A 1PADA 5F02A 2PNSA 4CDDB 3K9MA 1STFE 1KFXL 1PXVA 3RVVA 4N79A 5A24A 3HHIA 4W5BA 2YJCA 4MZOA 3MTNA 2AUZA 2JQGR 3DF0A 1AU4A 2PBHA 3O0UA 4MSXA 2DZYA 2F1GA 1BY8A 4OEMA 2FQ9A 1KHPA 1U9XA 4X6HA 3H8CA 5CVNB 2FRQA 3BPMA 2VHFA 4BS5A 4CDFB 2XU4A 2R9MA 2BDLA 2E01A 2NQGA 1EWLA 1AU0A 5J94A 1Y4HA 3HHAA 4WA6A
chains in the Genus database with same CATH superfamily
1ATKA 1BQIA 3BWKA 3PSEA 1TLOA 1ZIVA 1BGOA 4YVAA 2B1NA 4REZA 3USVA 4D8BA 2VHSA 4WURA 4AXLA 4YYRA 2FYEA 3K8UA 4X6IA 4RY2A 3CH2X 2JRIA 1U9VA 1S4VA 2GHUA 3I3TA 4DMYA 2R9CA 3C9EA 3RNVA 2CIOA 2BU3A 4BS6A 2G6DA 3OF8A 5EGWA 1KFUL 1MEGA 3M99A 5EZQA 3BY4A 1NB5A 1GECE 2P86A 4X6JA 1EWPA 2J7QA 2C0YA 1PVJA 4CZWA 3MORA 1U5IA 4BOZA 2O6XA 3PHUA 2NQAA 1CPJA 1CB5A 3KFQA 3BCNA 1SP4B 2ACTA 1AIMA 4YYUA 2R9OA 3NHEA 1ME3A 4AXMA 3H8BA 2HD5A 1U9QX 3WXEA 4PADA 3P5XA 5EF4A 2G8EA 1ITOA 5CHVA 2FT2A 2FUDA 3BOWA 2R6NA 3K24A 1AU2A 2JTCA 2UZJA 3W30A 4P6EA 3IHPA 3V6CA 5JA7A 2AU1A 4XZXA 4ZUXU 3W31A 1QOLA 1FH0A 2AYOA 4MI7A 2B1MA 3F75A 3V6EA 2PREA 4GUAA 3D6SA 1MIRA 3WXGA 1GMYA 4FJCA 2G8JA 4QRXA 3GCBA 1CVZA 4OELA 4XUIA 1AYWA 2YJBA 5FPWA 4MZSA 3C0RA 2XU1A 4I04A 2YJ2A 5EZSA 1ME4A 2DJGB 1F29A 4OW0A 2H7JA 4QRVA 1HUCB 4QBBA 1NQCA 1PIPA 1CJLA 2HXZA 2ARYA 2DCBA 1PPDA 3PRPA 1MHWA 4Q8HA 2CB5A 2XU3A 4YV8A 1UKFA 2AUXA 2PADA 1CTEA 4PI3A 4N4ZA 4W4UA 3MHSA 4QRGA 1CV8A 1MS6A 1CSBB 3P5UA 3OQCA 3OF9A 3KW9A 4IUMA 1EF7A 4P6GA 7PCKA 4XR7A 3LFYA 1Q6KA 2DC8A 5JH3A 3H89A 1DKIA 3O1GA 2DZZA 3F5VA 3H7DA 2GFOA 4KLBA 4DMXA 2P7UA 1TU6A 2DC6A 5CHTA 4YYWA 4N8WA 1CQDA 3KSEA 1QMYA 1F2BA 3N4CA 2AIMA 3PRMA 3CH3X 4MM3B 3QT4A 5CVMA 1VJVA 4A5UA 4YYVA 5K16A 1GCBA 3PHWA 3BPFA 3E1ZB 1PBHA 4W5CA 3TMPA 3MP2A 3H6SA 1BP4A 2R9FA 1U9WA 1EWMA 3B79A 3RVXA 1NB3A 3KX1A 4R3DA 2Z84A 4I07A 4BOQA 1AYVA 4BOPA 1NPZA 3CBJA 1PPNA 2G7YA 4RF1A 2AVWA 1MEMA 2DCDA 1DF0A 2IBIA 4M0WA 1VSNA 2DOSA 3P5VA 3O65A 3PDFA 3KWZA 3IEJA 3AI8A 4BSQA 1YZBA 4D8IA 4BOSA 2DC9A 4BPVA 4G54A 1NLJA 3S3QA 8PCHA 3PNRA 4FK5A 6PADA 2IPPB 1KXRA 2WBFX 1K3BB 2E03A 1KHQA 2Y5BA 4OVZA 3RVWA 4YYSA 5CVOB 3OISA 3PT2A 4CDEB 3IMAA 1MDWA 1ICFA 1YALA 3BC3A 4QH6A 4BQVA 2JQFR 3OVZA 2NQIA 2AGAA 3ZNHA 2FRAA 4PP2E 1NL6A 1ZCMA 3N3GA 1AYUA 1THEA 4P16A 3CBKA 2HHNA 3IV2A 3BBAA 4CDCB 1QXPA 1PPPA 3PHXA 1XKGA 3N3KA 1JQPA 3P5WA 3PBHA 3PW3A 3ZUAA 2NQDB 2YJ8A 3LXSA 1SNKA 2R9NA 2OULA 1PCIA 3MHHA 1QDQA 4PT5A 3HD3A 3S3RA 3E9SA 2ATOA 2BTWB 2FTDA 3U8EA 3IOQA 2DCAA 1F2CA 9PAPA 2OZ2A 1EWOA 1YT7A 4K7CA 2F7DA 2HWKA 4OVZB 2FE8A 1CS8A 4PP1A 2YJ9A 1TL9A 5PADA 3IUTA 4RF0A 3IFUA 3I06A 2FO5A 3OVXA 4BOUA 1POPA 3HWNA 2HH5A 3TNXA 1F2AA 4ZTBA 2DJFB 2OP3A 1IWDA 1YK7A 1X9YA 4HXDB 5E6JA 3MJ5A 1AU3A 3KKUA 1DEUA 4D8EA 1M6DA 1A6RA 1Y08A 2AYNA 1O0EA 3QJ3A 2J7QC 2AS8A 3ERVA 4HWYA 3QSDA 4Q8GA 3WXFA 1GLOA 1YK8A 3TRKA 1PE6A 3KWBX 1AECA 2BDZA 1YVBA 2P0RA 2XU5A 4RNAA 2BTWA 4I05A 1PPOA 4YYQA 2E02A 2DC7A 2DCCA 2Y6EA 4FIPA 2E00A 5KO3A 1PADA 5F02A 3B21A 2PNSA 3MTVA 4CDDB 3K9MA 1STFE 1KFXL 1PXVA 3RVVA 4N79A 5A24A 3HHIA 4W5BA 4MZOA 2YJCA 4IP3A 3MTNA 2AUZA 2JQGR 3DF0A 1AU4A 3BB7A 4MSXA 2PBHA 3O0UA 2DZYA 4RKXA 2F1GA 1BY8A 4OEMA 2FQ9A 1KHPA 1U9XA 4X6HA 3H8CA 5CVNB 2FRQA 5JZEA 3BPMA 2VHFA 4BS5A 4CDFB 2XU4A 2R9MA 2BDLA 2E01A 2NQGA 1EWLA 1AU0A 5J94A 1Y4HA 3HHAA 4WA6A
chains in the Genus database with same CATH topology
1ATKA 1BQIA 3BWKA 1TLOA 1ZIVA 1BGOA 4YVAA 2B1NA 3USVA 2VHSA 4AXLA 4YYRA 2FYEA 3K8UA 4X6IA 4RY2A 3CH2X 1U9VA 1S4VA 2GHUA 3I3TA 4DMYA 2R9CA 3C9EA 2CIOA 4BS6A 2G6DA 3OF8A 5EGWA 1KFUL 1MEGA 3M99A 1NB5A 1GECE 2P86A 4X6JA 1EWPA 2C0YA 4CZWA 3MORA 1U5IA 2O6XA 2NQAA 1CPJA 1CB5A 3KFQA 3BCNA 1SP4B 2ACTA 1AIMA 4YYUA 2R9OA 3NHEA 1ME3A 4AXMA 3H8BA 2HD5A 1U9QX 3WXEA 4PADA 3P5XA 5EF4A 2G8EA 1ITOA 5CHVA 2FT2A 2FUDA 3BOWA 2R6NA 3K24A 1AU2A 4P6EA 3IHPA 3V6CA 5JA7A 2AU1A 2VFBA 4ZUXU 1QOLA 1FH0A 2AYOA 2BSZA 2B1MA 3F75A 3V6EA 2PREA 3D6SA 1MIRA 3WXGA 1GMYA 4FJCA 2G8JA 4QRXA 3GCBA 1CVZA 4OELA 4XUIA 1AYWA 2YJBA 5FPWA 4MZSA 2XU1A 4I04A 2YJ2A 1ME4A 2DJGB 1F29A 2H7JA 1W5RA 4QRVA 1HUCB 4QBBA 1NQCA 1W4TA 1PIPA 1CJLA 2HXZA 2ARYA 2DCBA 1PPDA 1MHWA 4Q8HA 2CB5A 2XU3A 4YV8A 2AUXA 2PADA 4B55A 1CTEA 4PI3A 4N4ZA 4W4UA 3MHSA 4QRGA 1CV8A 1MS6A 4BGFA 1CSBB 3P5UA 4NV7A 3OF9A 3KW9A 1EF7A 4P6GA 7PCKA 4XR7A 3LFYA 1Q6KA 2DC8A 5JH3A 3H89A 3O1GA 2DZZA 3F5VA 3H7DA 2GFOA 4KLBA 4DMXA 2P7UA 1TU6A 2DC6A 5CHTA 4YYWA 4N8WA 1CQDA 1E2TA 3KSEA 1QMYA 1F2BA 3N4CA 2AIMA 3CH3X 3QT4A 5CVMA 1VJVA 4YYVA 5K16A 1GCBA 3BPFA 3E1ZB 1PBHA 4W5CA 3H6SA 1BP4A 2R9FA 1U9WA 1EWMA 1GX3A 3B79A 1NB3A 3RVXA 3KX1A 4I07A 1AYVA 1NPZA 3CBJA 1PPNA 1W6FA 2G7YA 2AVWA 1MEMA 2DCDA 1DF0A 2IBIA 1VSNA 3P5VA 3PDFA 3KWZA 3IEJA 3AI8A 4BSQA 2DC9A 4BPVA 4G54A 1NLJA 3S3QA 8PCHA 3PNRA 4FK5A 6PADA 2IPPB 1KXRA 2WBFX 1K3BB 2E03A 1KHQA 2Y5BA 3RVWA 4YYSA 5CVOB 3OISA 4CDEB 3IMAA 4QH6A 1MDWA 1ICFA 1YALA 3BC3A 4BQVA 2JQFR 3OVZA 2NQIA 2FRAA 4PP2E 1NL6A 1ZCMA 3N3GA 2VFCA 1AYUA 1THEA 3CBKA 2HHNA 3IV2A 4CDCB 1QXPA 1PPPA 1XKGA 3N3KA 1JQPA 3P5WA 3PBHA 3PW3A 3ZUAA 2NQDB 2YJ8A 3LXSA 1SNKA 2R9NA 2OULA 1PCIA 3MHHA 1QDQA 3HD3A 3S3RA 4NV8A 2ATOA 2FTDA 3U8EA 3IOQA 2DCAA 1F2CA 9PAPA 2OZ2A 1EWOA 1YT7A 4K7CA 2F7DA 1CS8A 4PP1A 2YJ9A 1TL9A 5PADA 3IUTA 3I06A 2FO5A 3OVXA 1POPA 3HWNA 2HH5A 3TNXA 1F2AA 2DJFB 2OP3A 1IWDA 1YK7A 1X9YA 1AU3A 3KKUA 1DEUA 1M6DA 1A6RA 1Y08A 4GUZA 2AYNA 1O0EA 3QJ3A 2AS8A 3ERVA 4HWYA 3QSDA 4Q8GA 3WXFA 1GLOA 1YK8A 1PE6A 3D9WA 3KWBX 1AECA 2BDZA 1YVBA 2P0RA 2XU5A 4YYQA 4I05A 1PPOA 2E02A 2DC7A 2DCCA 2Y6EA 4FIPA 2E00A 4C5PA 1PADA 5F02A 2PNSA 4CDDB 3K9MA 1STFE 1KFXL 1PXVA 3RVVA 4N79A 5A24A 3HHIA 4W5BA 2YJCA 4MZOA 3MTNA 2AUZA 2JQGR 3DF0A 1AU4A 2PBHA 3O0UA 4MSXA 2DZYA 3LTWA 2F1GA 1BY8A 4OEMA 2FQ9A 1KHPA 1U9XA 4X6HA 3H8CA 5CVNB 2FRQA 3BPMA 2VHFA 4BS5A 4CDFB 2XU4A 2R9MA 2BDLA 2E01A 2NQGA 1EWLA 1AU0A 5J94A 1Y4HA 3HHAA 4WA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ATK A;  1BQI A;  3BWK A;  1TLO A;  1ZIV A;  1BGO A;  4YVA A;  2B1N A;  3USV A;  2VHS A;  4AXL A;  4YYR A;  2FYE A;  3K8U A;  4X6I A;  4RY2 A;  3CH2 X;  1U9V A;  1S4V A;  2GHU A;  3I3T A;  4DMY A;  2R9C A;  3C9E A;  2CIO A;  4BS6 A;  2G6D A;  3OF8 A;  5EGW A;  1KFU L;  1MEG A;  3M99 A;  1NB5 A;  1GEC E;  2P86 A;  4X6J A;  1EWP A;  2C0Y A;  4CZW A;  3MOR A;  1U5I A;  2O6X A;  2NQA A;  1CPJ A;  1CB5 A;  3KFQ A;  3BCN A;  1SP4 B;  2ACT A;  1AIM A;  4YYU A;  2R9O A;  3NHE A;  1ME3 A;  4AXM A;  3H8B A;  2HD5 A;  1U9Q X;  3WXE A;  4PAD A;  3P5X A;  5EF4 A;  2G8E A;  1ITO A;  5CHV A;  2FT2 A;  2FUD A;  3BOW A;  2R6N A;  3K24 A;  1AU2 A;  4P6E A;  3IHP A;  3V6C A;  5JA7 A;  2AU1 A;  4ZUX U;  1QOL A;  1FH0 A;  2AYO A;  2B1M A;  3F75 A;  3V6E A;  2PRE A;  3D6S A;  1MIR A;  3WXG A;  1GMY A;  4FJC A;  2G8J A;  4QRX A;  3GCB A;  1CVZ A;  4OEL A;  4XUI A;  1AYW A;  2YJB A;  5FPW A;  4MZS A;  2XU1 A;  4I04 A;  2YJ2 A;  1ME4 A;  2DJG B;  1F29 A;  2H7J A;  4QRV A;  1HUC B;  4QBB A;  1NQC A;  1PIP A;  1CJL A;  2HXZ A;  2ARY A;  2DCB A;  1PPD A;  1MHW A;  4Q8H A;  2CB5 A;  2XU3 A;  4YV8 A;  2AUX A;  2PAD A;  1CTE A;  4PI3 A;  4N4Z A;  4W4U A;  3MHS A;  4QRG A;  1CV8 A;  1MS6 A;  1CSB B;  3P5U A;  3OF9 A;  3KW9 A;  1EF7 A;  4P6G A;  7PCK A;  4XR7 A;  3LFY A;  1Q6K A;  2DC8 A;  5JH3 A;  3H89 A;  3O1G A;  2DZZ A;  3F5V A;  3H7D A;  2GFO A;  4KLB A;  4DMX A;  2P7U A;  1TU6 A;  2DC6 A;  5CHT A;  4YYW A;  4N8W A;  1CQD A;  3KSE A;  1QMY A;  1F2B A;  3N4C A;  2AIM A;  3CH3 X;  3QT4 A;  5CVM A;  1VJV A;  4YYV A;  5K16 A;  1GCB A;  3BPF A;  3E1Z B;  1PBH A;  4W5C A;  3H6S A;  1BP4 A;  2R9F A;  1U9W A;  1EWM A;  3B79 A;  3RVX A;  1NB3 A;  3KX1 A;  4I07 A;  1AYV A;  1NPZ A;  3CBJ A;  1PPN A;  2G7Y A;  2AVW A;  1MEM A;  2DCD A;  1DF0 A;  2IBI A;  1VSN A;  3P5V A;  3PDF A;  3KWZ A;  3IEJ A;  3AI8 A;  4BSQ A;  2DC9 A;  4BPV A;  4G54 A;  1NLJ A;  3S3Q A;  8PCH A;  3PNR A;  4FK5 A;  6PAD A;  2IPP B;  1KXR A;  2WBF X;  1K3B B;  2E03 A;  1KHQ A;  2Y5B A;  3RVW A;  4YYS A;  5CVO B;  3OIS A;  4CDE B;  3IMA A;  4QH6 A;  1MDW A;  1ICF A;  1YAL A;  3BC3 A;  4BQV A;  2JQF R;  3OVZ A;  2NQI A;  2FRA A;  4PP2 E;  1NL6 A;  1ZCM A;  3N3G A;  1AYU A;  1THE A;  3CBK A;  2HHN A;  3IV2 A;  4CDC B;  1QXP A;  1PPP A;  1XKG A;  3N3K A;  1JQP A;  3P5W A;  3PBH A;  3PW3 A;  3ZUA A;  2NQD B;  2YJ8 A;  3LXS A;  1SNK A;  2R9N A;  2OUL A;  1PCI A;  3MHH A;  1QDQ A;  3HD3 A;  3S3R A;  2ATO A;  2FTD A;  3U8E A;  3IOQ A;  2DCA A;  1F2C A;  9PAP A;  2OZ2 A;  1EWO A;  1YT7 A;  4K7C A;  2F7D A;  1CS8 A;  4PP1 A;  2YJ9 A;  1TL9 A;  5PAD A;  3IUT A;  3I06 A;  2FO5 A;  3OVX A;  1POP A;  3HWN A;  2HH5 A;  3TNX A;  1F2A A;  2DJF B;  2OP3 A;  1IWD A;  1YK7 A;  1X9Y A;  1AU3 A;  3KKU A;  1DEU A;  1M6D A;  1A6R A;  1Y08 A;  2AYN A;  1O0E A;  3QJ3 A;  2AS8 A;  3ERV A;  4HWY A;  3QSD A;  4Q8G A;  3WXF A;  1GLO A;  1YK8 A;  1PE6 A;  3KWB X;  1AEC A;  2BDZ A;  1YVB A;  2P0R A;  2XU5 A;  4YYQ A;  4I05 A;  1PPO A;  2E02 A;  2DC7 A;  2DCC A;  2Y6E A;  4FIP A;  2E00 A;  1PAD A;  5F02 A;  2PNS A;  4CDD B;  3K9M A;  1STF E;  1KFX L;  1PXV A;  3RVV A;  4N79 A;  5A24 A;  3HHI A;  4W5B A;  2YJC A;  4MZO A;  3MTN A;  2AUZ A;  2JQG R;  3DF0 A;  1AU4 A;  2PBH A;  3O0U A;  4MSX A;  2DZY A;  2F1G A;  1BY8 A;  4OEM A;  2FQ9 A;  1KHP A;  1U9X A;  4X6H A;  3H8C A;  5CVN B;  2FRQ A;  3BPM A;  2VHF A;  4BS5 A;  4CDF B;  2XU4 A;  2R9M A;  2BDL A;  2E01 A;  2NQG A;  1EWL A;  1AU0 A;  5J94 A;  1Y4H A;  3HHA A;  4WA6 A; 
#chains in the Genus database with same CATH topology
 1ATK A;  1BQI A;  3BWK A;  3PSE A;  1TLO A;  1ZIV A;  1BGO A;  4YVA A;  2B1N A;  4REZ A;  3USV A;  4D8B A;  2VHS A;  4WUR A;  4AXL A;  4YYR A;  2FYE A;  3K8U A;  4X6I A;  4RY2 A;  3CH2 X;  2JRI A;  1U9V A;  1S4V A;  2GHU A;  3I3T A;  4DMY A;  2R9C A;  3C9E A;  3RNV A;  2CIO A;  2BU3 A;  4BS6 A;  2G6D A;  3OF8 A;  5EGW A;  1KFU L;  1MEG A;  3M99 A;  5EZQ A;  3BY4 A;  1NB5 A;  1GEC E;  2P86 A;  4X6J A;  1EWP A;  2J7Q A;  2C0Y A;  1PVJ A;  4CZW A;  3MOR A;  1U5I A;  4BOZ A;  2O6X A;  3PHU A;  2NQA A;  1CPJ A;  1CB5 A;  3KFQ A;  3BCN A;  1SP4 B;  2ACT A;  1AIM A;  4YYU A;  2R9O A;  3NHE A;  1ME3 A;  4AXM A;  3H8B A;  2HD5 A;  1U9Q X;  3WXE A;  4PAD A;  3P5X A;  5EF4 A;  2G8E A;  1ITO A;  5CHV A;  2FT2 A;  2FUD A;  3BOW A;  2R6N A;  3K24 A;  1AU2 A;  2JTC A;  2UZJ A;  3W30 A;  4P6E A;  3IHP A;  3V6C A;  5JA7 A;  2AU1 A;  4XZX A;  4ZUX U;  3W31 A;  1QOL A;  1FH0 A;  2AYO A;  4MI7 A;  2B1M A;  3F75 A;  3V6E A;  2PRE A;  4GUA A;  3D6S A;  1MIR A;  3WXG A;  1GMY A;  4FJC A;  2G8J A;  4QRX A;  3GCB A;  1CVZ A;  4OEL A;  4XUI A;  1AYW A;  2YJB A;  5FPW A;  4MZS A;  3C0R A;  2XU1 A;  4I04 A;  2YJ2 A;  5EZS A;  1ME4 A;  2DJG B;  1F29 A;  4OW0 A;  2H7J A;  4QRV A;  1HUC B;  4QBB A;  1NQC A;  1PIP A;  1CJL A;  2HXZ A;  2ARY A;  2DCB A;  1PPD A;  3PRP A;  1MHW A;  4Q8H A;  2CB5 A;  2XU3 A;  4YV8 A;  1UKF A;  2AUX A;  2PAD A;  1CTE A;  4PI3 A;  4N4Z A;  4W4U A;  3MHS A;  4QRG A;  1CV8 A;  1MS6 A;  1CSB B;  3P5U A;  3OQC A;  3OF9 A;  3KW9 A;  4IUM A;  1EF7 A;  4P6G A;  7PCK A;  4XR7 A;  3LFY A;  1Q6K A;  2DC8 A;  5JH3 A;  3H89 A;  1DKI A;  3O1G A;  2DZZ A;  3F5V A;  3H7D A;  2GFO A;  4KLB A;  4DMX A;  2P7U A;  1TU6 A;  2DC6 A;  5CHT A;  4YYW A;  4N8W A;  1CQD A;  3KSE A;  1QMY A;  1F2B A;  3N4C A;  2AIM A;  3PRM A;  3CH3 X;  4MM3 B;  3QT4 A;  5CVM A;  1VJV A;  4A5U A;  4YYV A;  5K16 A;  1GCB A;  3PHW A;  3BPF A;  3E1Z B;  1PBH A;  4W5C A;  3TMP A;  3MP2 A;  3H6S A;  1BP4 A;  2R9F A;  1U9W A;  1EWM A;  3B79 A;  3RVX A;  1NB3 A;  3KX1 A;  4R3D A;  2Z84 A;  4I07 A;  4BOQ A;  1AYV A;  4BOP A;  1NPZ A;  3CBJ A;  1PPN A;  2G7Y A;  4RF1 A;  2AVW A;  1MEM A;  2DCD A;  1DF0 A;  2IBI A;  4M0W A;  1VSN A;  2DOS A;  3P5V A;  3O65 A;  3PDF A;  3KWZ A;  3IEJ A;  3AI8 A;  4BSQ A;  1YZB A;  4D8I A;  4BOS A;  2DC9 A;  4BPV A;  4G54 A;  1NLJ A;  3S3Q A;  8PCH A;  3PNR A;  4FK5 A;  6PAD A;  2IPP B;  1KXR A;  2WBF X;  1K3B B;  2E03 A;  1KHQ A;  2Y5B A;  4OVZ A;  3RVW A;  4YYS A;  5CVO B;  3OIS A;  3PT2 A;  4CDE B;  3IMA A;  1MDW A;  1ICF A;  1YAL A;  3BC3 A;  4QH6 A;  4BQV A;  2JQF R;  3OVZ A;  2NQI A;  2AGA A;  3ZNH A;  2FRA A;  4PP2 E;  1NL6 A;  1ZCM A;  3N3G A;  1AYU A;  1THE A;  4P16 A;  3CBK A;  2HHN A;  3IV2 A;  3BBA A;  4CDC B;  1QXP A;  1PPP A;  3PHX A;  1XKG A;  3N3K A;  1JQP A;  3P5W A;  3PBH A;  3PW3 A;  3ZUA A;  2NQD B;  2YJ8 A;  3LXS A;  1SNK A;  2R9N A;  2OUL A;  1PCI A;  3MHH A;  1QDQ A;  4PT5 A;  3HD3 A;  3S3R A;  3E9S A;  2ATO A;  2BTW B;  2FTD A;  3U8E A;  3IOQ A;  2DCA A;  1F2C A;  9PAP A;  2OZ2 A;  1EWO A;  1YT7 A;  4K7C A;  2F7D A;  2HWK A;  4OVZ B;  2FE8 A;  1CS8 A;  4PP1 A;  2YJ9 A;  1TL9 A;  5PAD A;  3IUT A;  4RF0 A;  3IFU A;  3I06 A;  2FO5 A;  3OVX A;  4BOU A;  1POP A;  3HWN A;  2HH5 A;  3TNX A;  1F2A A;  4ZTB A;  2DJF B;  2OP3 A;  1IWD A;  1YK7 A;  1X9Y A;  4HXD B;  5E6J A;  3MJ5 A;  1AU3 A;  3KKU A;  1DEU A;  4D8E A;  1M6D A;  1A6R A;  1Y08 A;  2AYN A;  1O0E A;  3QJ3 A;  2J7Q C;  2AS8 A;  3ERV A;  4HWY A;  3QSD A;  4Q8G A;  3WXF A;  1GLO A;  1YK8 A;  3TRK A;  1PE6 A;  3KWB X;  1AEC A;  2BDZ A;  1YVB A;  2P0R A;  2XU5 A;  4RNA A;  2BTW A;  4I05 A;  1PPO A;  4YYQ A;  2E02 A;  2DC7 A;  2DCC A;  2Y6E A;  4FIP A;  2E00 A;  5KO3 A;  1PAD A;  5F02 A;  3B21 A;  2PNS A;  3MTV A;  4CDD B;  3K9M A;  1STF E;  1KFX L;  1PXV A;  3RVV A;  4N79 A;  5A24 A;  3HHI A;  4W5B A;  4MZO A;  2YJC A;  4IP3 A;  3MTN A;  2AUZ A;  2JQG R;  3DF0 A;  1AU4 A;  3BB7 A;  4MSX A;  2PBH A;  3O0U A;  2DZY A;  4RKX A;  2F1G A;  1BY8 A;  4OEM A;  2FQ9 A;  1KHP A;  1U9X A;  4X6H A;  3H8C A;  5CVN B;  2FRQ A;  5JZE A;  3BPM A;  2VHF A;  4BS5 A;  4CDF B;  2XU4 A;  2R9M A;  2BDL A;  2E01 A;  2NQG A;  1EWL A;  1AU0 A;  5J94 A;  1Y4H A;  3HHA A;  4WA6 A; 
#chains in the Genus database with same CATH homology
 1ATK A;  1BQI A;  3BWK A;  1TLO A;  1ZIV A;  1BGO A;  4YVA A;  2B1N A;  3USV A;  2VHS A;  4AXL A;  4YYR A;  2FYE A;  3K8U A;  4X6I A;  4RY2 A;  3CH2 X;  1U9V A;  1S4V A;  2GHU A;  3I3T A;  4DMY A;  2R9C A;  3C9E A;  2CIO A;  4BS6 A;  2G6D A;  3OF8 A;  5EGW A;  1KFU L;  1MEG A;  3M99 A;  1NB5 A;  1GEC E;  2P86 A;  4X6J A;  1EWP A;  2C0Y A;  4CZW A;  3MOR A;  1U5I A;  2O6X A;  2NQA A;  1CPJ A;  1CB5 A;  3KFQ A;  3BCN A;  1SP4 B;  2ACT A;  1AIM A;  4YYU A;  2R9O A;  3NHE A;  1ME3 A;  4AXM A;  3H8B A;  2HD5 A;  1U9Q X;  3WXE A;  4PAD A;  3P5X A;  5EF4 A;  2G8E A;  1ITO A;  5CHV A;  2FT2 A;  2FUD A;  3BOW A;  2R6N A;  3K24 A;  1AU2 A;  4P6E A;  3IHP A;  3V6C A;  5JA7 A;  2AU1 A;  2VFB A;  4ZUX U;  1QOL A;  1FH0 A;  2AYO A;  2BSZ A;  2B1M A;  3F75 A;  3V6E A;  2PRE A;  3D6S A;  1MIR A;  3WXG A;  1GMY A;  4FJC A;  2G8J A;  4QRX A;  3GCB A;  1CVZ A;  4OEL A;  4XUI A;  1AYW A;  2YJB A;  5FPW A;  4MZS A;  2XU1 A;  4I04 A;  2YJ2 A;  1ME4 A;  2DJG B;  1F29 A;  2H7J A;  1W5R A;  4QRV A;  1HUC B;  4QBB A;  1NQC A;  1W4T A;  1PIP A;  1CJL A;  2HXZ A;  2ARY A;  2DCB A;  1PPD A;  1MHW A;  4Q8H A;  2CB5 A;  2XU3 A;  4YV8 A;  2AUX A;  2PAD A;  4B55 A;  1CTE A;  4PI3 A;  4N4Z A;  4W4U A;  3MHS A;  4QRG A;  1CV8 A;  1MS6 A;  4BGF A;  1CSB B;  3P5U A;  4NV7 A;  3OF9 A;  3KW9 A;  1EF7 A;  4P6G A;  7PCK A;  4XR7 A;  3LFY A;  1Q6K A;  2DC8 A;  5JH3 A;  3H89 A;  3O1G A;  2DZZ A;  3F5V A;  3H7D A;  2GFO A;  4KLB A;  4DMX A;  2P7U A;  1TU6 A;  2DC6 A;  5CHT A;  4YYW A;  4N8W A;  1CQD A;  1E2T A;  3KSE A;  1QMY A;  1F2B A;  3N4C A;  2AIM A;  3CH3 X;  3QT4 A;  5CVM A;  1VJV A;  4YYV A;  5K16 A;  1GCB A;  3BPF A;  3E1Z B;  1PBH A;  4W5C A;  3H6S A;  1BP4 A;  2R9F A;  1U9W A;  1EWM A;  1GX3 A;  3B79 A;  1NB3 A;  3RVX A;  3KX1 A;  4I07 A;  1AYV A;  1NPZ A;  3CBJ A;  1PPN A;  1W6F A;  2G7Y A;  2AVW A;  1MEM A;  2DCD A;  1DF0 A;  2IBI A;  1VSN A;  3P5V A;  3PDF A;  3KWZ A;  3IEJ A;  3AI8 A;  4BSQ A;  2DC9 A;  4BPV A;  4G54 A;  1NLJ A;  3S3Q A;  8PCH A;  3PNR A;  4FK5 A;  6PAD A;  2IPP B;  1KXR A;  2WBF X;  1K3B B;  2E03 A;  1KHQ A;  2Y5B A;  3RVW A;  4YYS A;  5CVO B;  3OIS A;  4CDE B;  3IMA A;  4QH6 A;  1MDW A;  1ICF A;  1YAL A;  3BC3 A;  4BQV A;  2JQF R;  3OVZ A;  2NQI A;  2FRA A;  4PP2 E;  1NL6 A;  1ZCM A;  3N3G A;  2VFC A;  1AYU A;  1THE A;  3CBK A;  2HHN A;  3IV2 A;  4CDC B;  1QXP A;  1PPP A;  1XKG A;  3N3K A;  1JQP A;  3P5W A;  3PBH A;  3PW3 A;  3ZUA A;  2NQD B;  2YJ8 A;  3LXS A;  1SNK A;  2R9N A;  2OUL A;  1PCI A;  3MHH A;  1QDQ A;  3HD3 A;  3S3R A;  4NV8 A;  2ATO A;  2FTD A;  3U8E A;  3IOQ A;  2DCA A;  1F2C A;  9PAP A;  2OZ2 A;  1EWO A;  1YT7 A;  4K7C A;  2F7D A;  1CS8 A;  4PP1 A;  2YJ9 A;  1TL9 A;  5PAD A;  3IUT A;  3I06 A;  2FO5 A;  3OVX A;  1POP A;  3HWN A;  2HH5 A;  3TNX A;  1F2A A;  2DJF B;  2OP3 A;  1IWD A;  1YK7 A;  1X9Y A;  1AU3 A;  3KKU A;  1DEU A;  1M6D A;  1A6R A;  1Y08 A;  4GUZ A;  2AYN A;  1O0E A;  3QJ3 A;  2AS8 A;  3ERV A;  4HWY A;  3QSD A;  4Q8G A;  3WXF A;  1GLO A;  1YK8 A;  1PE6 A;  3D9W A;  3KWB X;  1AEC A;  2BDZ A;  1YVB A;  2P0R A;  2XU5 A;  4YYQ A;  4I05 A;  1PPO A;  2E02 A;  2DC7 A;  2DCC A;  2Y6E A;  4FIP A;  2E00 A;  4C5P A;  1PAD A;  5F02 A;  2PNS A;  4CDD B;  3K9M A;  1STF E;  1KFX L;  1PXV A;  3RVV A;  4N79 A;  5A24 A;  3HHI A;  4W5B A;  2YJC A;  4MZO A;  3MTN A;  2AUZ A;  2JQG R;  3DF0 A;  1AU4 A;  2PBH A;  3O0U A;  4MSX A;  2DZY A;  3LTW A;  2F1G A;  1BY8 A;  4OEM A;  2FQ9 A;  1KHP A;  1U9X A;  4X6H A;  3H8C A;  5CVN B;  2FRQ A;  3BPM A;  2VHF A;  4BS5 A;  4CDF B;  2XU4 A;  2R9M A;  2BDL A;  2E01 A;  2NQG A;  1EWL A;  1AU0 A;  5J94 A;  1Y4H A;  3HHA A;  4WA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...