2VHSA

Cathsilicatein, a chimera
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
217
structure length
215
Chain Sequence
APRSVDWREKGYVTPVKNQGQCGASYAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDVGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFSSDCSSSSLNHAMLVVGYGFISQKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CATHSILICATEIN
publication title Crystal Structure and Silica Condensing Activities of Silicatein Alpha-Cathepsin L Chimeras.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 215
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.15: Cathepsin L.
pdb deposition date 2007-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2vhsA00
3KSEA 2AS8A 3N3GA 2B1MA 3IV2A 1F2AA 3HHAA 1PBHA 4QRXA 1AIMA 1BGOA 1AYWA 4P6GA 2B1NA 2G8EA 3RVWA 2FRAA 3KFQA 3H6SA 4CZWA 3H89A 2FT2A 1THEA 6PADA 5CHVA 5CVMA 3WXGA 1CPJA 1PIPA 5J94A 4N8WA 2HD5A 2ATOA 3NHEA 5CHTA 1AU2A 2P7UA 1F29A 3DF0A 1YT7A 4DMYA 3IOQA 1PXVA 4QH6A 3HWNA 1U9WA 2F7DA 3BC3A 4YYWA 4OELA 1YALA 3WXFA 1IWDA 3LXSA 4PADA 1ATKA 3ERVA 2CIOA 3MHHA 4AXMA 4FJCA 3BPFA 3ZUAA 4CDDB 4YV8A 1TU6A 3IHPA 4FIPA 4X6IA 1POPA 2PBHA 1AYVA 1CV8A 2AUZA 1QMYA 1QXPA 2YJBA 1HUCB 2JQFR 1NLJA 3O1GA 4YYSA 1ZIVA 3KWZA 4PP2E 1ZCMA 3RVVA 2ACTA 4YVAA 1AECA 1AU3A 2IPPB 2DCAA 1ME3A 2FO5A 3CBKA 2AYNA 3I3TA 5PADA 3P5VA 1U9VA 2E00A 4BSQA 3BWKA 4QRGA 4W4UA 3O0UA 1S4VA 4N79A 2R6NA 5K16A 1EWOA 2E02A 2AVWA 4K7CA 2BDZA 3GCBA 1MEMA 3N3KA 1CQDA 2YJCA 3H8BA 2DCCA 2AUXA 2HHNA 3M99A 3AI8A 1EWLA 3WXEA 2F1GA 4MSXA 4DMXA 2P0RA 4W5CA 2DJGB 1BY8A 3HD3A 4FK5A 1GECE 1YVBA 3H8CA 3S3QA 2P86A 1F2CA 2R9NA 2OP3A 1M6DA 3LFYA 4Q8HA 1CS8A 2XU5A 2Y5BA 1YK7A 3H7DA 3K8UA 2ARYA 4QBBA 7PCKA 1Y08A 2FTDA 1QOLA 2FQ9A 2NQAA 2E03A 3MTNA 1SNKA 2VHFA 2GFOA 3P5XA 4G54A 3KW9A 2DJFB 3V6EA 3BCNA 2GHUA 3PW3A 3C9EA 4RY2A 3OF8A 3IEJA 4CDCB 4ZUXU 1KHQA 2R9MA 4I05A 3MORA 4YYUA 2AYOA 5CVNB 4QRVA 1KXRA 3PNRA 5FPWA 2PREA 1ICFA 1NQCA 3PBHA 3OVZA 2DC9A 3QT4A 1PE6A 4X6HA 2C0YA 1MS6A 2WBFX 2DC8A 3K9MA 2DZZA 4AXLA 3PDFA 3USVA 2DZYA 2HXZA 2PADA 2G7YA 2DC6A 1U9QX 1SP4B 1BP4A 1CSBB 1CB5A 1NB5A 1KFUL 3F75A 4HWYA 1ITOA 2YJ9A 3P5UA 3IUTA 1X9YA 3RVXA 2AIMA 5EF4A 4MZSA 2G8JA 2NQIA 1Y4HA 3KKUA 1AYUA 4YYQA 3HHIA 1PADA 1MDWA 2Y6EA 3P5WA 3D6SA 2FRQA 3MHSA 4I04A 3IMAA 4I07A 1GMYA 3B79A 5JH3A 2BDLA 1VSNA 1STFE 2XU3A 3KX1A 3U8EA 4MZOA 8PCHA 4N4ZA 1VJVA 3E1ZB 2PNSA 3KWBX 1EF7A 1PPOA 4X6JA 2OULA 1DEUA 3I06A 1CJLA 1U9XA 4WA6A 2FYEA 1PPDA 2H7JA 3N4CA 4YYRA 1TL9A 1XKGA 4OEMA 1EWMA 2JQGR 4XUIA 4CDFB 1BQIA 4BQVA 3BOWA 3QJ3A 2HH5A 2DCDA 3CH3X 1NL6A 4BS5A 2XU4A 1FH0A 1PPPA 9PAPA 3OISA 4KLBA 2R9OA 3OF9A 2R9CA 4BS6A 1JQPA 1YK8A 2OZ2A 2DCBA 5A24A 2AU1A 3QSDA 1MIRA 1CTEA 2CB5A 1U5IA 1DF0A 1MEGA 5EGWA 2YJ2A 1AU4A 2FUDA 3K24A 5CVOB 1AU0A 3TNXA 2NQDB 1QDQA 3CH2X 2DC7A 1TLOA 1NB3A 1K3BB 3OVXA 4YYVA 4Q8GA 2G6DA 4CDEB 1PCIA 1A6RA 3V6CA 3CBJA 4BPVA 2O6XA 5JA7A 4P6EA 3BPMA 1KFXL 4PP1A 1MHWA 4PI3A 4W5BA 2IBIA 1F2BA 2E01A 2NQGA 2VHSA 1NPZA 3S3RA 1O0EA 2R9FA 3F5VA 1ME4A 2XU1A 1Q6KA 1KHPA 4XR7A 1CVZA 1EWPA 1GCBA 2YJ8A 1GLOA 5F02A 1PPNA
chains in the Genus database with same CATH superfamily
3KSEA 2AS8A 3N3GA 2B1MA 3IV2A 1F2AA 3HHAA 1PBHA 4QRXA 4RF0A 1AIMA 1BGOA 4D8BA 1AYWA 3C0RA 4P6GA 2B1NA 2G8EA 3RVWA 2FRAA 3KFQA 3BBAA 5KO3A 3H6SA 4CZWA 3H89A 4BOUA 2FT2A 1THEA 4D8IA 6PADA 5CHVA 5CVMA 3WXGA 1CPJA 1PIPA 5J94A 4N8WA 2HD5A 2ATOA 3NHEA 5CHTA 3PHUA 1AU2A 2FE8A 2P7UA 1F29A 3DF0A 1YT7A 4REZA 4DMYA 3IOQA 1PXVA 4QH6A 1DKIA 3PHWA 3HWNA 5E6JA 1U9WA 2F7DA 3BC3A 4YYWA 4OELA 1YALA 3WXFA 1IWDA 3LXSA 4IP3A 2UZJA 1ATKA 4PADA 3ERVA 4WURA 2CIOA 3MHHA 4AXMA 4FJCA 3PRPA 3BPFA 3ZUAA 4CDDB 4YV8A 1TU6A 3IHPA 4FIPA 4X6IA 1POPA 2PBHA 2BTWB 1AYVA 1CV8A 2AUZA 1QMYA 1QXPA 2YJBA 1HUCB 2JQFR 3BB7A 4BOSA 1NLJA 3O1GA 4YYSA 1ZIVA 3KWZA 4PP2E 1ZCMA 4M0WA 3RVVA 4MI7A 2ACTA 4YVAA 1AECA 4R3DA 1AU3A 2IPPB 2DCAA 1ME3A 2FO5A 2Z84A 3CBKA 2AYNA 3I3TA 5PADA 3P5VA 1U9VA 2E00A 4BSQA 4BOPA 3BWKA 4QRGA 4W4UA 3O0UA 1S4VA 4N79A 2R6NA 4GUAA 5K16A 4HXDB 1EWOA 2E02A 2AVWA 1UKFA 4K7CA 2BDZA 3GCBA 1MEMA 3PRMA 2BTWA 3N3KA 4A5UA 1CQDA 2YJCA 3H8BA 2DCCA 2AUXA 2HHNA 3M99A 3AI8A 1EWLA 3WXEA 2F1GA 4MSXA 2J7QC 3PHXA 4DMXA 2P0RA 4W5CA 2DJGB 1BY8A 3HD3A 4FK5A 1GECE 1YVBA 3H8CA 3S3QA 3PSEA 2HWKA 4PT5A 4ZTBA 2P86A 4BOZA 1F2CA 2R9NA 2OP3A 1M6DA 3LFYA 4Q8HA 1CS8A 2XU5A 2Y5BA 4BOQA 1YK7A 3H7DA 3K8UA 2ARYA 4QBBA 7PCKA 1Y08A 2FTDA 1QOLA 2FQ9A 2NQAA 3MTVA 4RNAA 2E03A 3PT2A 3MTNA 1SNKA 2VHFA 2GFOA 3P5XA 4G54A 3KW9A 2DJFB 3V6EA 3BCNA 2GHUA 3PW3A 3C9EA 4RY2A 3OF8A 3IEJA 4CDCB 4ZUXU 1KHQA 2R9MA 4I05A 3MORA 4YYUA 2AYOA 5CVNB 4QRVA 1KXRA 3RNVA 3PNRA 5FPWA 2PREA 1ICFA 1NQCA 3PBHA 4MM3B 4OVZB 3OVZA 2DC9A 1PE6A 3QT4A 4X6HA 2C0YA 1MS6A 2WBFX 2DC8A 3K9MA 2DZZA 3O65A 4AXLA 3PDFA 3USVA 2DZYA 2HXZA 2BU3A 2PADA 2G7YA 2DC6A 5EZQA 1U9QX 1SP4B 1BP4A 1CSBB 1CB5A 3W31A 1NB5A 1KFUL 3F75A 4HWYA 1ITOA 2YJ9A 3P5UA 3IUTA 1X9YA 3RVXA 2AGAA 2AIMA 4IUMA 3B21A 5EF4A 4MZSA 4OVZA 2G8JA 2NQIA 1Y4HA 3KKUA 1AYUA 4YYQA 3HHIA 2JRIA 1PADA 1MDWA 2Y6EA 3P5WA 3D6SA 2FRQA 3MHSA 4I04A 3IMAA 4I07A 1GMYA 3B79A 5JH3A 2BDLA 1VSNA 1STFE 2J7QA 2XU3A 3KX1A 3U8EA 4MZOA 8PCHA 4N4ZA 1VJVA 3E1ZB 2PNSA 3KWBX 1EF7A 1PPOA 4X6JA 5JZEA 2OULA 1DEUA 3I06A 1PVJA 1CJLA 1U9XA 4WA6A 2FYEA 1PPDA 2H7JA 3N4CA 4YYRA 1TL9A 1XKGA 4OEMA 1EWMA 2JQGR 4XUIA 4CDFB 4D8EA 1BQIA 4BQVA 3BOWA 3QJ3A 2HH5A 2DCDA 3CH3X 1NL6A 4BS5A 2XU4A 1FH0A 1PPPA 9PAPA 3OISA 4KLBA 2R9OA 1YZBA 3OF9A 2R9CA 4BS6A 1JQPA 1YK8A 2OZ2A 4RKXA 2DCBA 5A24A 2AU1A 3QSDA 2DOSA 1MIRA 1CTEA 3E9SA 2CB5A 1U5IA 1DF0A 1MEGA 5EGWA 3MP2A 2YJ2A 1AU4A 2FUDA 3K24A 5CVOB 3TMPA 4XZXA 1AU0A 3TNXA 2NQDB 3TRKA 2JTCA 1QDQA 3CH2X 3W30A 2DC7A 1TLOA 5EZSA 1NB3A 1K3BB 3OVXA 4YYVA 4Q8GA 2G6DA 4CDEB 3BY4A 1PCIA 4RF1A 1A6RA 3V6CA 3CBJA 4BPVA 2O6XA 5JA7A 4P6EA 3BPMA 1KFXL 4PP1A 3ZNHA 1MHWA 4PI3A 4W5BA 3IFUA 2IBIA 1F2BA 2E01A 2NQGA 2VHSA 1NPZA 4OW0A 3S3RA 1O0EA 2R9FA 3F5VA 1ME4A 2XU1A 3MJ5A 4P16A 3OQCA 1Q6KA 1KHPA 4XR7A 1CVZA 1EWPA 1GCBA 2YJ8A 1GLOA 5F02A 1PPNA
chains in the Genus database with same CATH topology
3KSEA 2AS8A 3N3GA 2B1MA 3IV2A 1F2AA 3HHAA 4GUZA 1PBHA 4QRXA 1AIMA 1BGOA 1AYWA 4P6GA 2B1NA 2G8EA 3RVWA 2FRAA 3KFQA 3H6SA 4CZWA 4BGFA 3H89A 2FT2A 1THEA 6PADA 5CHVA 5CVMA 3WXGA 1CPJA 1PIPA 5J94A 4N8WA 2HD5A 2ATOA 3NHEA 5CHTA 1AU2A 2P7UA 1F29A 4NV8A 3DF0A 1YT7A 4DMYA 3IOQA 1PXVA 4QH6A 3HWNA 1U9WA 2F7DA 3BC3A 4YYWA 4OELA 1YALA 3WXFA 1IWDA 3LXSA 4PADA 1ATKA 3ERVA 2CIOA 3MHHA 4AXMA 4FJCA 3BPFA 3ZUAA 4CDDB 4YV8A 1TU6A 3IHPA 4FIPA 4X6IA 1POPA 2PBHA 1AYVA 1CV8A 2AUZA 1QMYA 1QXPA 2YJBA 1HUCB 2JQFR 1NLJA 3O1GA 4YYSA 1ZIVA 3KWZA 4PP2E 1ZCMA 3RVVA 2ACTA 4YVAA 1AECA 1AU3A 2IPPB 2DCAA 1ME3A 2FO5A 3CBKA 2AYNA 3I3TA 5PADA 3P5VA 1W6FA 1U9VA 2E00A 4BSQA 3BWKA 4QRGA 4W4UA 3O0UA 1S4VA 4N79A 2R6NA 5K16A 1EWOA 2E02A 2AVWA 4K7CA 2BDZA 3GCBA 1MEMA 3N3KA 1CQDA 2YJCA 3H8BA 2DCCA 2AUXA 2HHNA 3M99A 3AI8A 1EWLA 3WXEA 2F1GA 4MSXA 4DMXA 2P0RA 4W5CA 2DJGB 1BY8A 3HD3A 3LTWA 4FK5A 1GECE 1YVBA 3H8CA 3S3QA 2P86A 1F2CA 2R9NA 2OP3A 1M6DA 3LFYA 1W4TA 1CS8A 4Q8HA 2XU5A 2Y5BA 1YK7A 3H7DA 3K8UA 2ARYA 4QBBA 7PCKA 1Y08A 2FTDA 1QOLA 2FQ9A 2NQAA 2E03A 3MTNA 1SNKA 2VHFA 2GFOA 3P5XA 4G54A 3KW9A 2DJFB 3V6EA 3BCNA 2GHUA 3PW3A 3C9EA 4RY2A 3OF8A 3IEJA 4CDCB 4ZUXU 1KHQA 2R9MA 4I05A 3MORA 4YYUA 2AYOA 5CVNB 4QRVA 1KXRA 3PNRA 5FPWA 2PREA 1ICFA 1NQCA 3PBHA 4B55A 3OVZA 2DC9A 3QT4A 1PE6A 4X6HA 2C0YA 1MS6A 2WBFX 2DC8A 3K9MA 2DZZA 4AXLA 3PDFA 3USVA 2DZYA 4NV7A 2HXZA 2PADA 2G7YA 2DC6A 1U9QX 1SP4B 1BP4A 1CSBB 1CB5A 1NB5A 1E2TA 1KFUL 3F75A 4HWYA 1ITOA 2YJ9A 3P5UA 3IUTA 1X9YA 3RVXA 2AIMA 5EF4A 4MZSA 3D9WA 2G8JA 2NQIA 1Y4HA 3KKUA 1AYUA 4YYQA 3HHIA 1PADA 1MDWA 2Y6EA 3P5WA 3D6SA 2FRQA 3MHSA 4I04A 3IMAA 4I07A 1GMYA 3B79A 1GX3A 5JH3A 2BDLA 1VSNA 1STFE 2XU3A 3KX1A 3U8EA 4MZOA 8PCHA 4N4ZA 1VJVA 3E1ZB 2PNSA 3KWBX 1EF7A 1PPOA 4X6JA 2OULA 1DEUA 3I06A 1CJLA 1U9XA 4WA6A 2FYEA 1PPDA 2H7JA 3N4CA 4YYRA 1TL9A 1XKGA 4OEMA 1EWMA 2JQGR 4XUIA 4CDFB 1BQIA 4BQVA 3BOWA 3QJ3A 2HH5A 2DCDA 3CH3X 1NL6A 4BS5A 2XU4A 1FH0A 1PPPA 9PAPA 3OISA 4KLBA 2R9OA 3OF9A 2R9CA 4BS6A 1JQPA 1YK8A 2OZ2A 2DCBA 5A24A 2AU1A 3QSDA 1MIRA 1CTEA 2CB5A 1U5IA 1DF0A 1MEGA 5EGWA 2YJ2A 1AU4A 2FUDA 3K24A 5CVOB 1AU0A 3TNXA 4C5PA 2NQDB 1QDQA 3CH2X 2DC7A 1TLOA 1NB3A 1K3BB 3OVXA 4YYVA 4Q8GA 2G6DA 4CDEB 1PCIA 2VFBA 1A6RA 3V6CA 2BSZA 3CBJA 4BPVA 2O6XA 5JA7A 4P6EA 3BPMA 1KFXL 4PP1A 1MHWA 4PI3A 4W5BA 1W5RA 2IBIA 1F2BA 2E01A 2NQGA 2VHSA 1NPZA 2VFCA 3S3RA 1O0EA 2R9FA 3F5VA 1ME4A 2XU1A 1Q6KA 1KHPA 4XR7A 1CVZA 1EWPA 1GCBA 2YJ8A 1GLOA 5F02A 1PPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KSE A;  2AS8 A;  3N3G A;  2B1M A;  3IV2 A;  1F2A A;  3HHA A;  1PBH A;  4QRX A;  1AIM A;  1BGO A;  1AYW A;  4P6G A;  2B1N A;  2G8E A;  3RVW A;  2FRA A;  3KFQ A;  3H6S A;  4CZW A;  3H89 A;  2FT2 A;  1THE A;  6PAD A;  5CHV A;  5CVM A;  3WXG A;  1CPJ A;  1PIP A;  5J94 A;  4N8W A;  2HD5 A;  2ATO A;  3NHE A;  5CHT A;  1AU2 A;  2P7U A;  1F29 A;  3DF0 A;  1YT7 A;  4DMY A;  3IOQ A;  1PXV A;  4QH6 A;  3HWN A;  1U9W A;  2F7D A;  3BC3 A;  4YYW A;  4OEL A;  1YAL A;  3WXF A;  1IWD A;  3LXS A;  4PAD A;  1ATK A;  3ERV A;  2CIO A;  3MHH A;  4AXM A;  4FJC A;  3BPF A;  3ZUA A;  4CDD B;  4YV8 A;  1TU6 A;  3IHP A;  4FIP A;  4X6I A;  1POP A;  2PBH A;  1AYV A;  1CV8 A;  2AUZ A;  1QMY A;  1QXP A;  2YJB A;  1HUC B;  2JQF R;  1NLJ A;  3O1G A;  4YYS A;  1ZIV A;  3KWZ A;  4PP2 E;  1ZCM A;  3RVV A;  2ACT A;  4YVA A;  1AEC A;  1AU3 A;  2IPP B;  2DCA A;  1ME3 A;  2FO5 A;  3CBK A;  2AYN A;  3I3T A;  5PAD A;  3P5V A;  1U9V A;  2E00 A;  4BSQ A;  3BWK A;  4QRG A;  4W4U A;  3O0U A;  1S4V A;  4N79 A;  2R6N A;  5K16 A;  1EWO A;  2E02 A;  2AVW A;  4K7C A;  2BDZ A;  3GCB A;  1MEM A;  3N3K A;  1CQD A;  2YJC A;  3H8B A;  2DCC A;  2AUX A;  2HHN A;  3M99 A;  3AI8 A;  1EWL A;  3WXE A;  2F1G A;  4MSX A;  4DMX A;  2P0R A;  4W5C A;  2DJG B;  1BY8 A;  3HD3 A;  4FK5 A;  1GEC E;  1YVB A;  3H8C A;  3S3Q A;  2P86 A;  1F2C A;  2R9N A;  2OP3 A;  1M6D A;  3LFY A;  4Q8H A;  1CS8 A;  2XU5 A;  2Y5B A;  1YK7 A;  3H7D A;  3K8U A;  2ARY A;  4QBB A;  7PCK A;  1Y08 A;  2FTD A;  1QOL A;  2FQ9 A;  2NQA A;  2E03 A;  3MTN A;  1SNK A;  2VHF A;  2GFO A;  3P5X A;  4G54 A;  3KW9 A;  2DJF B;  3V6E A;  3BCN A;  2GHU A;  3PW3 A;  3C9E A;  4RY2 A;  3OF8 A;  3IEJ A;  4CDC B;  4ZUX U;  1KHQ A;  2R9M A;  4I05 A;  3MOR A;  4YYU A;  2AYO A;  5CVN B;  4QRV A;  1KXR A;  3PNR A;  5FPW A;  2PRE A;  1ICF A;  1NQC A;  3PBH A;  3OVZ A;  2DC9 A;  3QT4 A;  1PE6 A;  4X6H A;  2C0Y A;  1MS6 A;  2WBF X;  2DC8 A;  3K9M A;  2DZZ A;  4AXL A;  3PDF A;  3USV A;  2DZY A;  2HXZ A;  2PAD A;  2G7Y A;  2DC6 A;  1U9Q X;  1SP4 B;  1BP4 A;  1CSB B;  1CB5 A;  1NB5 A;  1KFU L;  3F75 A;  4HWY A;  1ITO A;  2YJ9 A;  3P5U A;  3IUT A;  1X9Y A;  3RVX A;  2AIM A;  5EF4 A;  4MZS A;  2G8J A;  2NQI A;  1Y4H A;  3KKU A;  1AYU A;  4YYQ A;  3HHI A;  1PAD A;  1MDW A;  2Y6E A;  3P5W A;  3D6S A;  2FRQ A;  3MHS A;  4I04 A;  3IMA A;  4I07 A;  1GMY A;  3B79 A;  5JH3 A;  2BDL A;  1VSN A;  1STF E;  2XU3 A;  3KX1 A;  3U8E A;  4MZO A;  8PCH A;  4N4Z A;  1VJV A;  3E1Z B;  2PNS A;  3KWB X;  1EF7 A;  1PPO A;  4X6J A;  2OUL A;  1DEU A;  3I06 A;  1CJL A;  1U9X A;  4WA6 A;  2FYE A;  1PPD A;  2H7J A;  3N4C A;  4YYR A;  1TL9 A;  1XKG A;  4OEM A;  1EWM A;  2JQG R;  4XUI A;  4CDF B;  1BQI A;  4BQV A;  3BOW A;  3QJ3 A;  2HH5 A;  2DCD A;  3CH3 X;  1NL6 A;  4BS5 A;  2XU4 A;  1FH0 A;  1PPP A;  9PAP A;  3OIS A;  4KLB A;  2R9O A;  3OF9 A;  2R9C A;  4BS6 A;  1JQP A;  1YK8 A;  2OZ2 A;  2DCB A;  5A24 A;  2AU1 A;  3QSD A;  1MIR A;  1CTE A;  2CB5 A;  1U5I A;  1DF0 A;  1MEG A;  5EGW A;  2YJ2 A;  1AU4 A;  2FUD A;  3K24 A;  5CVO B;  1AU0 A;  3TNX A;  2NQD B;  1QDQ A;  3CH2 X;  2DC7 A;  1TLO A;  1NB3 A;  1K3B B;  3OVX A;  4YYV A;  4Q8G A;  2G6D A;  4CDE B;  1PCI A;  1A6R A;  3V6C A;  3CBJ A;  4BPV A;  2O6X A;  5JA7 A;  4P6E A;  3BPM A;  1KFX L;  4PP1 A;  1MHW A;  4PI3 A;  4W5B A;  2IBI A;  1F2B A;  2E01 A;  2NQG A;  2VHS A;  1NPZ A;  3S3R A;  1O0E A;  2R9F A;  3F5V A;  1ME4 A;  2XU1 A;  1Q6K A;  1KHP A;  4XR7 A;  1CVZ A;  1EWP A;  1GCB A;  2YJ8 A;  1GLO A;  5F02 A;  1PPN A; 
#chains in the Genus database with same CATH topology
 3KSE A;  2AS8 A;  3N3G A;  2B1M A;  3IV2 A;  1F2A A;  3HHA A;  1PBH A;  4QRX A;  4RF0 A;  1AIM A;  1BGO A;  4D8B A;  1AYW A;  3C0R A;  4P6G A;  2B1N A;  2G8E A;  3RVW A;  2FRA A;  3KFQ A;  3BBA A;  5KO3 A;  3H6S A;  4CZW A;  3H89 A;  4BOU A;  2FT2 A;  1THE A;  4D8I A;  6PAD A;  5CHV A;  5CVM A;  3WXG A;  1CPJ A;  1PIP A;  5J94 A;  4N8W A;  2HD5 A;  2ATO A;  3NHE A;  5CHT A;  3PHU A;  1AU2 A;  2FE8 A;  2P7U A;  1F29 A;  3DF0 A;  1YT7 A;  4REZ A;  4DMY A;  3IOQ A;  1PXV A;  4QH6 A;  1DKI A;  3PHW A;  3HWN A;  5E6J A;  1U9W A;  2F7D A;  3BC3 A;  4YYW A;  4OEL A;  1YAL A;  3WXF A;  1IWD A;  3LXS A;  4IP3 A;  2UZJ A;  1ATK A;  4PAD A;  3ERV A;  4WUR A;  2CIO A;  3MHH A;  4AXM A;  4FJC A;  3PRP A;  3BPF A;  3ZUA A;  4CDD B;  4YV8 A;  1TU6 A;  3IHP A;  4FIP A;  4X6I A;  1POP A;  2PBH A;  2BTW B;  1AYV A;  1CV8 A;  2AUZ A;  1QMY A;  1QXP A;  2YJB A;  1HUC B;  2JQF R;  3BB7 A;  4BOS A;  1NLJ A;  3O1G A;  4YYS A;  1ZIV A;  3KWZ A;  4PP2 E;  1ZCM A;  4M0W A;  3RVV A;  4MI7 A;  2ACT A;  4YVA A;  1AEC A;  4R3D A;  1AU3 A;  2IPP B;  2DCA A;  1ME3 A;  2FO5 A;  2Z84 A;  3CBK A;  2AYN A;  3I3T A;  5PAD A;  3P5V A;  1U9V A;  2E00 A;  4BSQ A;  4BOP A;  3BWK A;  4QRG A;  4W4U A;  3O0U A;  1S4V A;  4N79 A;  2R6N A;  4GUA A;  5K16 A;  4HXD B;  1EWO A;  2E02 A;  2AVW A;  1UKF A;  4K7C A;  2BDZ A;  3GCB A;  1MEM A;  3PRM A;  2BTW A;  3N3K A;  4A5U A;  1CQD A;  2YJC A;  3H8B A;  2DCC A;  2AUX A;  2HHN A;  3M99 A;  3AI8 A;  1EWL A;  3WXE A;  2F1G A;  4MSX A;  2J7Q C;  3PHX A;  4DMX A;  2P0R A;  4W5C A;  2DJG B;  1BY8 A;  3HD3 A;  4FK5 A;  1GEC E;  1YVB A;  3H8C A;  3S3Q A;  3PSE A;  2HWK A;  4PT5 A;  4ZTB A;  2P86 A;  4BOZ A;  1F2C A;  2R9N A;  2OP3 A;  1M6D A;  3LFY A;  4Q8H A;  1CS8 A;  2XU5 A;  2Y5B A;  4BOQ A;  1YK7 A;  3H7D A;  3K8U A;  2ARY A;  4QBB A;  7PCK A;  1Y08 A;  2FTD A;  1QOL A;  2FQ9 A;  2NQA A;  3MTV A;  4RNA A;  2E03 A;  3PT2 A;  3MTN A;  1SNK A;  2VHF A;  2GFO A;  3P5X A;  4G54 A;  3KW9 A;  2DJF B;  3V6E A;  3BCN A;  2GHU A;  3PW3 A;  3C9E A;  4RY2 A;  3OF8 A;  3IEJ A;  4CDC B;  4ZUX U;  1KHQ A;  2R9M A;  4I05 A;  3MOR A;  4YYU A;  2AYO A;  5CVN B;  4QRV A;  1KXR A;  3RNV A;  3PNR A;  5FPW A;  2PRE A;  1ICF A;  1NQC A;  3PBH A;  4MM3 B;  4OVZ B;  3OVZ A;  2DC9 A;  1PE6 A;  3QT4 A;  4X6H A;  2C0Y A;  1MS6 A;  2WBF X;  2DC8 A;  3K9M A;  2DZZ A;  3O65 A;  4AXL A;  3PDF A;  3USV A;  2DZY A;  2HXZ A;  2BU3 A;  2PAD A;  2G7Y A;  2DC6 A;  5EZQ A;  1U9Q X;  1SP4 B;  1BP4 A;  1CSB B;  1CB5 A;  3W31 A;  1NB5 A;  1KFU L;  3F75 A;  4HWY A;  1ITO A;  2YJ9 A;  3P5U A;  3IUT A;  1X9Y A;  3RVX A;  2AGA A;  2AIM A;  4IUM A;  3B21 A;  5EF4 A;  4MZS A;  4OVZ A;  2G8J A;  2NQI A;  1Y4H A;  3KKU A;  1AYU A;  4YYQ A;  3HHI A;  2JRI A;  1PAD A;  1MDW A;  2Y6E A;  3P5W A;  3D6S A;  2FRQ A;  3MHS A;  4I04 A;  3IMA A;  4I07 A;  1GMY A;  3B79 A;  5JH3 A;  2BDL A;  1VSN A;  1STF E;  2J7Q A;  2XU3 A;  3KX1 A;  3U8E A;  4MZO A;  8PCH A;  4N4Z A;  1VJV A;  3E1Z B;  2PNS A;  3KWB X;  1EF7 A;  1PPO A;  4X6J A;  5JZE A;  2OUL A;  1DEU A;  3I06 A;  1PVJ A;  1CJL A;  1U9X A;  4WA6 A;  2FYE A;  1PPD A;  2H7J A;  3N4C A;  4YYR A;  1TL9 A;  1XKG A;  4OEM A;  1EWM A;  2JQG R;  4XUI A;  4CDF B;  4D8E A;  1BQI A;  4BQV A;  3BOW A;  3QJ3 A;  2HH5 A;  2DCD A;  3CH3 X;  1NL6 A;  4BS5 A;  2XU4 A;  1FH0 A;  1PPP A;  9PAP A;  3OIS A;  4KLB A;  2R9O A;  1YZB A;  3OF9 A;  2R9C A;  4BS6 A;  1JQP A;  1YK8 A;  2OZ2 A;  4RKX A;  2DCB A;  5A24 A;  2AU1 A;  3QSD A;  2DOS A;  1MIR A;  1CTE A;  3E9S A;  2CB5 A;  1U5I A;  1DF0 A;  1MEG A;  5EGW A;  3MP2 A;  2YJ2 A;  1AU4 A;  2FUD A;  3K24 A;  5CVO B;  3TMP A;  4XZX A;  1AU0 A;  3TNX A;  2NQD B;  3TRK A;  2JTC A;  1QDQ A;  3CH2 X;  3W30 A;  2DC7 A;  1TLO A;  5EZS A;  1NB3 A;  1K3B B;  3OVX A;  4YYV A;  4Q8G A;  2G6D A;  4CDE B;  3BY4 A;  1PCI A;  4RF1 A;  1A6R A;  3V6C A;  3CBJ A;  4BPV A;  2O6X A;  5JA7 A;  4P6E A;  3BPM A;  1KFX L;  4PP1 A;  3ZNH A;  1MHW A;  4PI3 A;  4W5B A;  3IFU A;  2IBI A;  1F2B A;  2E01 A;  2NQG A;  2VHS A;  1NPZ A;  4OW0 A;  3S3R A;  1O0E A;  2R9F A;  3F5V A;  1ME4 A;  2XU1 A;  3MJ5 A;  4P16 A;  3OQC A;  1Q6K A;  1KHP A;  4XR7 A;  1CVZ A;  1EWP A;  1GCB A;  2YJ8 A;  1GLO A;  5F02 A;  1PPN A; 
#chains in the Genus database with same CATH homology
 3KSE A;  2AS8 A;  3N3G A;  2B1M A;  3IV2 A;  1F2A A;  3HHA A;  4GUZ A;  1PBH A;  4QRX A;  1AIM A;  1BGO A;  1AYW A;  4P6G A;  2B1N A;  2G8E A;  3RVW A;  2FRA A;  3KFQ A;  3H6S A;  4CZW A;  4BGF A;  3H89 A;  2FT2 A;  1THE A;  6PAD A;  5CHV A;  5CVM A;  3WXG A;  1CPJ A;  1PIP A;  5J94 A;  4N8W A;  2HD5 A;  2ATO A;  3NHE A;  5CHT A;  1AU2 A;  2P7U A;  1F29 A;  4NV8 A;  3DF0 A;  1YT7 A;  4DMY A;  3IOQ A;  1PXV A;  4QH6 A;  3HWN A;  1U9W A;  2F7D A;  3BC3 A;  4YYW A;  4OEL A;  1YAL A;  3WXF A;  1IWD A;  3LXS A;  4PAD A;  1ATK A;  3ERV A;  2CIO A;  3MHH A;  4AXM A;  4FJC A;  3BPF A;  3ZUA A;  4CDD B;  4YV8 A;  1TU6 A;  3IHP A;  4FIP A;  4X6I A;  1POP A;  2PBH A;  1AYV A;  1CV8 A;  2AUZ A;  1QMY A;  1QXP A;  2YJB A;  1HUC B;  2JQF R;  1NLJ A;  3O1G A;  4YYS A;  1ZIV A;  3KWZ A;  4PP2 E;  1ZCM A;  3RVV A;  2ACT A;  4YVA A;  1AEC A;  1AU3 A;  2IPP B;  2DCA A;  1ME3 A;  2FO5 A;  3CBK A;  2AYN A;  3I3T A;  5PAD A;  3P5V A;  1W6F A;  1U9V A;  2E00 A;  4BSQ A;  3BWK A;  4QRG A;  4W4U A;  3O0U A;  1S4V A;  4N79 A;  2R6N A;  5K16 A;  1EWO A;  2E02 A;  2AVW A;  4K7C A;  2BDZ A;  3GCB A;  1MEM A;  3N3K A;  1CQD A;  2YJC A;  3H8B A;  2DCC A;  2AUX A;  2HHN A;  3M99 A;  3AI8 A;  1EWL A;  3WXE A;  2F1G A;  4MSX A;  4DMX A;  2P0R A;  4W5C A;  2DJG B;  1BY8 A;  3HD3 A;  3LTW A;  4FK5 A;  1GEC E;  1YVB A;  3H8C A;  3S3Q A;  2P86 A;  1F2C A;  2R9N A;  2OP3 A;  1M6D A;  3LFY A;  1W4T A;  1CS8 A;  4Q8H A;  2XU5 A;  2Y5B A;  1YK7 A;  3H7D A;  3K8U A;  2ARY A;  4QBB A;  7PCK A;  1Y08 A;  2FTD A;  1QOL A;  2FQ9 A;  2NQA A;  2E03 A;  3MTN A;  1SNK A;  2VHF A;  2GFO A;  3P5X A;  4G54 A;  3KW9 A;  2DJF B;  3V6E A;  3BCN A;  2GHU A;  3PW3 A;  3C9E A;  4RY2 A;  3OF8 A;  3IEJ A;  4CDC B;  4ZUX U;  1KHQ A;  2R9M A;  4I05 A;  3MOR A;  4YYU A;  2AYO A;  5CVN B;  4QRV A;  1KXR A;  3PNR A;  5FPW A;  2PRE A;  1ICF A;  1NQC A;  3PBH A;  4B55 A;  3OVZ A;  2DC9 A;  3QT4 A;  1PE6 A;  4X6H A;  2C0Y A;  1MS6 A;  2WBF X;  2DC8 A;  3K9M A;  2DZZ A;  4AXL A;  3PDF A;  3USV A;  2DZY A;  4NV7 A;  2HXZ A;  2PAD A;  2G7Y A;  2DC6 A;  1U9Q X;  1SP4 B;  1BP4 A;  1CSB B;  1CB5 A;  1NB5 A;  1E2T A;  1KFU L;  3F75 A;  4HWY A;  1ITO A;  2YJ9 A;  3P5U A;  3IUT A;  1X9Y A;  3RVX A;  2AIM A;  5EF4 A;  4MZS A;  3D9W A;  2G8J A;  2NQI A;  1Y4H A;  3KKU A;  1AYU A;  4YYQ A;  3HHI A;  1PAD A;  1MDW A;  2Y6E A;  3P5W A;  3D6S A;  2FRQ A;  3MHS A;  4I04 A;  3IMA A;  4I07 A;  1GMY A;  3B79 A;  1GX3 A;  5JH3 A;  2BDL A;  1VSN A;  1STF E;  2XU3 A;  3KX1 A;  3U8E A;  4MZO A;  8PCH A;  4N4Z A;  1VJV A;  3E1Z B;  2PNS A;  3KWB X;  1EF7 A;  1PPO A;  4X6J A;  2OUL A;  1DEU A;  3I06 A;  1CJL A;  1U9X A;  4WA6 A;  2FYE A;  1PPD A;  2H7J A;  3N4C A;  4YYR A;  1TL9 A;  1XKG A;  4OEM A;  1EWM A;  2JQG R;  4XUI A;  4CDF B;  1BQI A;  4BQV A;  3BOW A;  3QJ3 A;  2HH5 A;  2DCD A;  3CH3 X;  1NL6 A;  4BS5 A;  2XU4 A;  1FH0 A;  1PPP A;  9PAP A;  3OIS A;  4KLB A;  2R9O A;  3OF9 A;  2R9C A;  4BS6 A;  1JQP A;  1YK8 A;  2OZ2 A;  2DCB A;  5A24 A;  2AU1 A;  3QSD A;  1MIR A;  1CTE A;  2CB5 A;  1U5I A;  1DF0 A;  1MEG A;  5EGW A;  2YJ2 A;  1AU4 A;  2FUD A;  3K24 A;  5CVO B;  1AU0 A;  3TNX A;  4C5P A;  2NQD B;  1QDQ A;  3CH2 X;  2DC7 A;  1TLO A;  1NB3 A;  1K3B B;  3OVX A;  4YYV A;  4Q8G A;  2G6D A;  4CDE B;  1PCI A;  2VFB A;  1A6R A;  3V6C A;  2BSZ A;  3CBJ A;  4BPV A;  2O6X A;  5JA7 A;  4P6E A;  3BPM A;  1KFX L;  4PP1 A;  1MHW A;  4PI3 A;  4W5B A;  1W5R A;  2IBI A;  1F2B A;  2E01 A;  2NQG A;  2VHS A;  1NPZ A;  2VFC A;  3S3R A;  1O0E A;  2R9F A;  3F5V A;  1ME4 A;  2XU1 A;  1Q6K A;  1KHP A;  4XR7 A;  1CVZ A;  1EWP A;  1GCB A;  2YJ8 A;  1GLO A;  5F02 A;  1PPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...