2VHSA

Cathsilicatein, a chimera
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
217
structure length
215
Chain Sequence
b'APRSVDWREKGYVTPVKNQGQCGASYAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDVGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFSSDCSSSSLNHAMLVVGYGFISQKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHSILICATEIN
molecule tags Hydrolase
source organism Homo sapiens
publication title Crystal Structure and Silica Condensing Activities of Silicatein Alpha-Cathepsin L Chimeras.
pubmed doi rcsb
total genus 66
structure length 215
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.15: Cathepsin L.
pdb deposition date 2007-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2vhsA00
1PPDA 1CJLA 2R9OA 4G54A 1PPOA 4CDDB 2AIMA 1ITOA 1NLJA 1AYUA 2ATOA 1CB5A 1MHWA 4FK5A 4W4UA 2G8EA 6PADA 4XR7A 4OEMA 2CB5A 2XU4A 1VSNA 1QOLA 1POPA 1MDWA 2F1GA 3H8BA 2P86A 3DF0A 1THEA 3O0UA 2BDLA 3RVXA 4YYWA 3OISA 2PBHA 3IEJA 4FIPA 2HXZA 2G7YA 1AU4A 3N3KA 3BPMA 3S3RA 4XUIA 1EF7A 3H7DA 1EWPA 1QXPA 4YYSA 3USVA 1TLOA 3PBHA 1KHQA 1F29A 2R9NA 3KX1A 4P6EA 1PADA 1MS6A 2NQIA 4PP2E 4W5CA 3CBJA 4BS5A 3KKUA 1U9WA 2YJ2A 3BCNA 4QRVA 1FH0A 1F2CA 3MTNA 2IPPB 3C9EA 4PI3A 3N3GA 1F2AA 2XU3A 2NQDB 3I06A 3K24A 3KFQA 4X6HA 3MHSA 1U9QX 2G8JA 4OELA 1NQCA 2CIOA 1DF0A 1U9XA 4WA6A 5CVOB 1ATKA 2FT2A 1PBHA 3LXSA 3K8UA 2YJ9A 3CH3X 3IOQA 1AU3A 3PW3A 3IMAA 2HH5A 2DZZA 1SNKA 3KSEA 2DCDA 3P5XA 1PE6A 1EWLA 4QH6A 2DCCA 2WBFX 1CSBB 2NQAA 1X9YA 1GLOA 2ARYA 2NQGA 3LFYA 3OVZA 1ME3A 3RVVA 2O6XA 1BY8A 1CTEA 2R9CA 1A6RA 2F7DA 1AECA 2AUXA 2P0RA 4QRXA 3HD3A 3QSDA 1JQPA 3S3QA 3OVXA 1ZIVA 3IV2A 3BOWA 2FQ9A 3F75A 5EF4A 1Q6KA 3PDFA 2H7JA 1PCIA 2FRAA 3HWNA 2AS8A 1M6DA 2IBIA 3BPFA 3WXFA 4BPVA 2DJFB 2C0YA 3F5VA 1GECE 4KLBA 1NB3A 1YVBA 2AVWA 1ICFA 2JQGR 2FUDA 2YJ8A 4MZOA 2PNSA 4MSXA 4DMXA 1KHPA 2ACTA 2FYEA 1CVZA 3P5UA 5CVMA 3NHEA 4YV8A 5PADA 3QJ3A 4YYQA 2OZ2A 2PADA 4ZUXU 1EWMA 1KFUL 1CV8A 3H6SA 2B1NA 3B79A 3H8CA 4Q8HA 1NB5A 1TU6A 5EGWA 4X6IA 2DC6A 4QBBA 3OF8A 3IHPA 3E1ZB 3KWZA 1BGOA 1YT7A 2PREA 1S4VA 2XU5A 1CPJA 1PIPA 1YK7A 5FPWA 2E00A 1STFE 4YYRA 1EWOA 4X6JA 2AU1A 3O1GA 2OP3A 1YALA 1KXRA 1AU0A 1IWDA 4N4ZA 3GCBA 1MIRA 4CZWA 3H89A 4PP1A 3BC3A 3AI8A 2JQFR 4RY2A 2DCBA 1ZCMA 3ZUAA 3CH2X 3N4CA 3P5VA 5JH3A 1GCBA 4Q8GA 1O0EA 2Y6EA 2E03A 1AIMA 2DC9A 2E01A 4CDCB 1PXVA 2VHSA 3PNRA 2R9FA 4DMYA 4AXLA 3TNXA 2AYOA 2GFOA 5K16A 1VJVA 4CDFB 4W5BA 4BSQA 1F2BA 4I04A 3MORA 3D6SA 1ME4A 1U5IA 4I07A 2Y5BA 4BS6A 3K9MA 9PAPA 4N79A 1TL9A 5J94A 4AXMA 3V6CA 4MZSA 5CHTA 5F02A 1AU2A 3OF9A 1U9VA 1K3BB 1AYWA 3CBKA 2HD5A 4YVAA 1NPZA 1MEGA 2E02A 3ERVA 3BWKA 1CQDA 3P5WA 1DEUA 2OULA 4HWYA 1Y08A 2VHFA 4I05A 2DJGB 4YYVA 2R6NA 3KW9A 1AYVA 2DCAA 2B1MA 2BDZA 2HHNA 1KFXL 3M99A 1NL6A 4FJCA 1BQIA 4K7CA 1QDQA 4QRGA 4N8WA 2FRQA 3V6EA 2AYNA 2P7UA 3KWBX 2GHUA 1SP4B 2YJBA 1QMYA 5CVNB 3I3TA 3HHAA 4BQVA 3MHHA 5A24A 3RVWA 3IUTA 5JA7A 5CHVA 4YYUA 1PPNA 2YJCA 1MEMA 2DC8A 2XU1A 4P6GA 1XKGA 2DC7A 1HUCB 2DZYA 3WXEA 3U8EA 2FO5A 8PCHA 1GMYA 1Y4HA 1YK8A 7PCKA 1BP4A 1CS8A 2AUZA 2FTDA 2R9MA 2G6DA 4CDEB 3QT4A 3WXGA 3HHIA 1PPPA 4PADA
chains in the Genus database with same CATH superfamily
1PPDA 1CJLA 2R9OA 4G54A 2UZJA 1PPOA 4CDDB 2AIMA 3PT2A 1ITOA 1NLJA 1AYUA 2AGAA 2ATOA 1CB5A 1MHWA 4FK5A 4RF0A 4W4UA 2G8EA 6PADA 4XR7A 4OEMA 2FE8A 2CB5A 2XU4A 1VSNA 1QOLA 1POPA 1MDWA 2F1GA 2JTCA 3H8BA 2P86A 3DF0A 1THEA 3O0UA 2BDLA 1PVJA 3RVXA 3PRMA 3OISA 2PBHA 4YYWA 3IEJA 4FIPA 2HXZA 2G7YA 5KO3A 1AU4A 3N3KA 3BPMA 3PHUA 3S3RA 4XUIA 1EF7A 3H7DA 1EWPA 1QXPA 4YYSA 3C0RA 3USVA 1TLOA 3PBHA 1KHQA 1F29A 2R9NA 3KX1A 4P6EA 1PADA 1MS6A 2NQIA 3BY4A 4PP2E 4W5CA 4A5UA 4BOPA 4IUMA 3CBJA 2DOSA 4BS5A 3KKUA 1U9WA 2YJ2A 3BCNA 4QRVA 1FH0A 1F2CA 3MTNA 2IPPB 3C9EA 4PI3A 3N3GA 1F2AA 2XU3A 2NQDB 3I06A 3K24A 3KFQA 4X6HA 3MHSA 1U9QX 2G8JA 4OELA 1NQCA 3ZNHA 2CIOA 1DF0A 1U9XA 4WA6A 5CVOB 1ATKA 2FT2A 5EZSA 1PBHA 3LXSA 3K8UA 2YJ9A 3CH3X 3IFUA 3IOQA 1AU3A 3PW3A 1UKFA 3IMAA 2HH5A 2DZZA 1SNKA 3KSEA 2DCDA 3P5XA 1PE6A 1EWLA 4QH6A 2DCCA 2WBFX 1CSBB 2NQAA 1X9YA 1GLOA 2J7QC 2ARYA 2NQGA 3LFYA 3OVZA 3TRKA 1ME3A 3PHWA 3RVVA 2O6XA 1BY8A 1CTEA 2R9CA 1A6RA 2F7DA 1AECA 2AUXA 2P0RA 4QRXA 3HD3A 3QSDA 1JQPA 3S3QA 3PSEA 3OVXA 1ZIVA 3IV2A 3BOWA 2FQ9A 3F75A 5EF4A 3MJ5A 1Q6KA 4WURA 3PDFA 2H7JA 1PCIA 2FRAA 3TMPA 3HWNA 2AS8A 1M6DA 4M0WA 2IBIA 3BPFA 4OVZA 3WXFA 4BPVA 2DJFB 2C0YA 3F5VA 3O65A 4KLBA 1GECE 1NB3A 1YVBA 2AVWA 1ICFA 2JQGR 2FUDA 2YJ8A 4MZOA 2PNSA 4MSXA 4DMXA 1KHPA 2ACTA 2FYEA 3PHXA 1CVZA 4RF1A 3P5UA 5CVMA 3NHEA 3MP2A 4YV8A 5PADA 3QJ3A 4YYQA 3OQCA 2OZ2A 2PADA 4ZUXU 1EWMA 4BOQA 1KFUL 1CV8A 3H6SA 4OVZB 3W31A 2B1NA 3B79A 3H8CA 4Q8HA 1NB5A 1TU6A 5EGWA 4X6IA 1YZBA 2DC6A 3BB7A 3OF8A 3PRPA 4QBBA 3IHPA 3E1ZB 3KWZA 1BGOA 1YT7A 2PREA 5EZQA 1S4VA 2XU5A 4D8BA 1CPJA 1PIPA 1YK7A 5FPWA 2E00A 1STFE 4YYRA 1EWOA 4X6JA 2AU1A 3O1GA 2OP3A 1YALA 1KXRA 1AU0A 1IWDA 4N4ZA 3GCBA 2BTWA 3B21A 1MIRA 4CZWA 3H89A 4PP1A 5JZEA 3BC3A 3AI8A 2JQFR 4RY2A 2DCBA 5E6JA 2Z84A 1ZCMA 3ZUAA 3CH2X 3N4CA 3P5VA 5JH3A 1GCBA 4IP3A 4Q8GA 1O0EA 2Y6EA 2E03A 1AIMA 1DKIA 2DC9A 2E01A 4CDCB 1PXVA 2VHSA 3PNRA 4BOUA 2R9FA 4BOSA 4DMYA 4MI7A 4AXLA 3TNXA 2AYOA 2GFOA 5K16A 1VJVA 4CDFB 4W5BA 4BSQA 4OW0A 1F2BA 4I04A 3MORA 3D6SA 1ME4A 1U5IA 4I07A 2Y5BA 3BBAA 4BS6A 2BU3A 3K9MA 9PAPA 4N79A 1TL9A 5J94A 4AXMA 3E9SA 3V6CA 4MZSA 5CHTA 5F02A 4GUAA 1AU2A 3OF9A 1U9VA 1K3BB 1AYWA 4PT5A 3CBKA 2HD5A 4YVAA 4RNAA 1NPZA 1MEGA 2E02A 4D8IA 3ERVA 3BWKA 1CQDA 2BTWB 3P5WA 1DEUA 2OULA 4HWYA 1Y08A 4XZXA 2VHFA 4HXDB 4I05A 2DJGB 4YYVA 2R6NA 3KW9A 1AYVA 4RKXA 4D8EA 2DCAA 2B1MA 2BDZA 2HHNA 1KFXL 3M99A 1NL6A 4FJCA 1BQIA 4K7CA 1QDQA 4QRGA 4N8WA 2FRQA 2JRIA 3V6EA 2AYNA 2HWKA 3RNVA 2P7UA 3KWBX 2GHUA 1SP4B 2YJBA 1QMYA 5CVNB 4ZTBA 3I3TA 2J7QA 3HHAA 4BQVA 3MHHA 5A24A 4R3DA 4REZA 3RVWA 3IUTA 5JA7A 5CHVA 4YYUA 1PPNA 2YJCA 1MEMA 2DC8A 3MTVA 2XU1A 4P6GA 1XKGA 2DC7A 4P16A 1HUCB 2DZYA 3WXEA 3U8EA 3W30A 2FO5A 8PCHA 4MM3B 1GMYA 1Y4HA 1YK8A 7PCKA 1BP4A 4BOZA 1CS8A 2AUZA 2FTDA 2R9MA 2G6DA 4CDEB 3QT4A 3WXGA 3HHIA 1PPPA 4PADA
chains in the Genus database with same CATH topology
1PPDA 1CJLA 2R9OA 4G54A 1PPOA 4CDDB 2AIMA 1ITOA 1NLJA 1AYUA 2ATOA 1CB5A 1MHWA 4FK5A 4W4UA 2G8EA 6PADA 4XR7A 4OEMA 2CB5A 2XU4A 1VSNA 1QOLA 1POPA 1MDWA 2F1GA 3H8BA 2P86A 3DF0A 1THEA 3O0UA 2BDLA 3RVXA 4YYWA 3OISA 2PBHA 3IEJA 4FIPA 2HXZA 2G7YA 1AU4A 3N3KA 3BPMA 3S3RA 4XUIA 1EF7A 3H7DA 1EWPA 1QXPA 4YYSA 3USVA 1TLOA 3PBHA 1KHQA 1F29A 2R9NA 3KX1A 4P6EA 1PADA 1MS6A 2NQIA 4PP2E 4W5CA 3CBJA 4BS5A 3KKUA 1U9WA 2YJ2A 3BCNA 4QRVA 1FH0A 1F2CA 3MTNA 2IPPB 3C9EA 4PI3A 3N3GA 1F2AA 2XU3A 2NQDB 3I06A 3K24A 3KFQA 4X6HA 3MHSA 1U9QX 2G8JA 4OELA 1NQCA 2CIOA 1DF0A 1U9XA 4WA6A 5CVOB 1ATKA 2FT2A 1PBHA 3LXSA 3K8UA 2YJ9A 3CH3X 3IOQA 1AU3A 3PW3A 3IMAA 2HH5A 2DZZA 1SNKA 3KSEA 2DCDA 3P5XA 1PE6A 1EWLA 4QH6A 2DCCA 2WBFX 1CSBB 2NQAA 1X9YA 1GLOA 2ARYA 2NQGA 3LFYA 3OVZA 1ME3A 3RVVA 2O6XA 1BY8A 1CTEA 2R9CA 1A6RA 2F7DA 1AECA 2AUXA 2P0RA 4QRXA 3HD3A 4BGFA 3QSDA 1JQPA 3S3QA 3OVXA 1ZIVA 3IV2A 3BOWA 2FQ9A 3F75A 5EF4A 1Q6KA 3PDFA 2H7JA 1PCIA 2FRAA 3HWNA 2AS8A 1M6DA 2IBIA 3BPFA 1W6FA 3WXFA 4BPVA 2DJFB 2C0YA 3F5VA 1GECE 4KLBA 1NB3A 1YVBA 2AVWA 1ICFA 2JQGR 2FUDA 2YJ8A 4MZOA 2PNSA 4MSXA 4DMXA 4NV8A 1KHPA 2ACTA 2FYEA 1CVZA 3P5UA 5CVMA 3NHEA 4NV7A 4YV8A 5PADA 3QJ3A 4YYQA 2OZ2A 2PADA 4ZUXU 1EWMA 1KFUL 1W4TA 1CV8A 3H6SA 2B1NA 3B79A 3H8CA 4Q8HA 1NB5A 1TU6A 5EGWA 4X6IA 2DC6A 4QBBA 3OF8A 3IHPA 3E1ZB 3KWZA 1BGOA 1YT7A 2PREA 2VFBA 1S4VA 2XU5A 1CPJA 1PIPA 1YK7A 5FPWA 2E00A 1STFE 4YYRA 1EWOA 4X6JA 2AU1A 3O1GA 2OP3A 4GUZA 1YALA 1KXRA 1AU0A 1IWDA 4N4ZA 3GCBA 1MIRA 4CZWA 3H89A 4PP1A 3BC3A 3AI8A 2JQFR 4RY2A 4C5PA 1GX3A 2DCBA 1ZCMA 3ZUAA 3CH2X 3N4CA 3P5VA 5JH3A 1GCBA 4Q8GA 1O0EA 2Y6EA 2E03A 1AIMA 2DC9A 2E01A 4CDCB 1PXVA 2VHSA 3PNRA 2R9FA 4DMYA 4AXLA 3TNXA 2AYOA 2GFOA 5K16A 1VJVA 4CDFB 4W5BA 4BSQA 1F2BA 2BSZA 4I04A 3MORA 1W5RA 1ME4A 3D6SA 1U5IA 4I07A 2Y5BA 4BS6A 3K9MA 9PAPA 4N79A 1TL9A 5J94A 4AXMA 3V6CA 4MZSA 5CHTA 2VFCA 5F02A 1AU2A 3OF9A 1U9VA 1K3BB 1AYWA 3CBKA 1E2TA 2HD5A 4YVAA 1NPZA 1MEGA 2E02A 3ERVA 3BWKA 1CQDA 3P5WA 1DEUA 2OULA 4HWYA 1Y08A 2VHFA 3LTWA 4I05A 2DJGB 4YYVA 2R6NA 3KW9A 1AYVA 2DCAA 2B1MA 2BDZA 2HHNA 1KFXL 3M99A 4B55A 1NL6A 4FJCA 1BQIA 4K7CA 1QDQA 4QRGA 4N8WA 2FRQA 3V6EA 2AYNA 2P7UA 3KWBX 2GHUA 1SP4B 2YJBA 1QMYA 5CVNB 3I3TA 3HHAA 4BQVA 3MHHA 5A24A 3RVWA 3IUTA 5JA7A 5CHVA 4YYUA 1PPNA 2YJCA 1MEMA 2DC8A 2XU1A 4P6GA 1XKGA 2DC7A 1HUCB 2DZYA 3WXEA 3U8EA 2FO5A 8PCHA 1GMYA 1Y4HA 1YK8A 3D9WA 7PCKA 1BP4A 1CS8A 2AUZA 2FTDA 2R9MA 2G6DA 4CDEB 3QT4A 3WXGA 3HHIA 1PPPA 4PADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PPD A;  1CJL A;  2R9O A;  4G54 A;  1PPO A;  4CDD B;  2AIM A;  1ITO A;  1NLJ A;  1AYU A;  2ATO A;  1CB5 A;  1MHW A;  4FK5 A;  4W4U A;  2G8E A;  6PAD A;  4XR7 A;  4OEM A;  2CB5 A;  2XU4 A;  1VSN A;  1QOL A;  1POP A;  1MDW A;  2F1G A;  3H8B A;  2P86 A;  3DF0 A;  1THE A;  3O0U A;  2BDL A;  3RVX A;  4YYW A;  3OIS A;  2PBH A;  3IEJ A;  4FIP A;  2HXZ A;  2G7Y A;  1AU4 A;  3N3K A;  3BPM A;  3S3R A;  4XUI A;  1EF7 A;  3H7D A;  1EWP A;  1QXP A;  4YYS A;  3USV A;  1TLO A;  3PBH A;  1KHQ A;  1F29 A;  2R9N A;  3KX1 A;  4P6E A;  1PAD A;  1MS6 A;  2NQI A;  4PP2 E;  4W5C A;  3CBJ A;  4BS5 A;  3KKU A;  1U9W A;  2YJ2 A;  3BCN A;  4QRV A;  1FH0 A;  1F2C A;  3MTN A;  2IPP B;  3C9E A;  4PI3 A;  3N3G A;  1F2A A;  2XU3 A;  2NQD B;  3I06 A;  3K24 A;  3KFQ A;  4X6H A;  3MHS A;  1U9Q X;  2G8J A;  4OEL A;  1NQC A;  2CIO A;  1DF0 A;  1U9X A;  4WA6 A;  5CVO B;  1ATK A;  2FT2 A;  1PBH A;  3LXS A;  3K8U A;  2YJ9 A;  3CH3 X;  3IOQ A;  1AU3 A;  3PW3 A;  3IMA A;  2HH5 A;  2DZZ A;  1SNK A;  3KSE A;  2DCD A;  3P5X A;  1PE6 A;  1EWL A;  4QH6 A;  2DCC A;  2WBF X;  1CSB B;  2NQA A;  1X9Y A;  1GLO A;  2ARY A;  2NQG A;  3LFY A;  3OVZ A;  1ME3 A;  3RVV A;  2O6X A;  1BY8 A;  1CTE A;  2R9C A;  1A6R A;  2F7D A;  1AEC A;  2AUX A;  2P0R A;  4QRX A;  3HD3 A;  3QSD A;  1JQP A;  3S3Q A;  3OVX A;  1ZIV A;  3IV2 A;  3BOW A;  2FQ9 A;  3F75 A;  5EF4 A;  1Q6K A;  3PDF A;  2H7J A;  1PCI A;  2FRA A;  3HWN A;  2AS8 A;  1M6D A;  2IBI A;  3BPF A;  3WXF A;  4BPV A;  2DJF B;  2C0Y A;  3F5V A;  1GEC E;  4KLB A;  1NB3 A;  1YVB A;  2AVW A;  1ICF A;  2JQG R;  2FUD A;  2YJ8 A;  4MZO A;  2PNS A;  4MSX A;  4DMX A;  1KHP A;  2ACT A;  2FYE A;  1CVZ A;  3P5U A;  5CVM A;  3NHE A;  4YV8 A;  5PAD A;  3QJ3 A;  4YYQ A;  2OZ2 A;  2PAD A;  4ZUX U;  1EWM A;  1KFU L;  1CV8 A;  3H6S A;  2B1N A;  3B79 A;  3H8C A;  4Q8H A;  1NB5 A;  1TU6 A;  5EGW A;  4X6I A;  2DC6 A;  4QBB A;  3OF8 A;  3IHP A;  3E1Z B;  3KWZ A;  1BGO A;  1YT7 A;  2PRE A;  1S4V A;  2XU5 A;  1CPJ A;  1PIP A;  1YK7 A;  5FPW A;  2E00 A;  1STF E;  4YYR A;  1EWO A;  4X6J A;  2AU1 A;  3O1G A;  2OP3 A;  1YAL A;  1KXR A;  1AU0 A;  1IWD A;  4N4Z A;  3GCB A;  1MIR A;  4CZW A;  3H89 A;  4PP1 A;  3BC3 A;  3AI8 A;  2JQF R;  4RY2 A;  2DCB A;  1ZCM A;  3ZUA A;  3CH2 X;  3N4C A;  3P5V A;  5JH3 A;  1GCB A;  4Q8G A;  1O0E A;  2Y6E A;  2E03 A;  1AIM A;  2DC9 A;  2E01 A;  4CDC B;  1PXV A;  2VHS A;  3PNR A;  2R9F A;  4DMY A;  4AXL A;  3TNX A;  2AYO A;  2GFO A;  5K16 A;  1VJV A;  4CDF B;  4W5B A;  4BSQ A;  1F2B A;  4I04 A;  3MOR A;  3D6S A;  1ME4 A;  1U5I A;  4I07 A;  2Y5B A;  4BS6 A;  3K9M A;  9PAP A;  4N79 A;  1TL9 A;  5J94 A;  4AXM A;  3V6C A;  4MZS A;  5CHT A;  5F02 A;  1AU2 A;  3OF9 A;  1U9V A;  1K3B B;  1AYW A;  3CBK A;  2HD5 A;  4YVA A;  1NPZ A;  1MEG A;  2E02 A;  3ERV A;  3BWK A;  1CQD A;  3P5W A;  1DEU A;  2OUL A;  4HWY A;  1Y08 A;  2VHF A;  4I05 A;  2DJG B;  4YYV A;  2R6N A;  3KW9 A;  1AYV A;  2DCA A;  2B1M A;  2BDZ A;  2HHN A;  1KFX L;  3M99 A;  1NL6 A;  4FJC A;  1BQI A;  4K7C A;  1QDQ A;  4QRG A;  4N8W A;  2FRQ A;  3V6E A;  2AYN A;  2P7U A;  3KWB X;  2GHU A;  1SP4 B;  2YJB A;  1QMY A;  5CVN B;  3I3T A;  3HHA A;  4BQV A;  3MHH A;  5A24 A;  3RVW A;  3IUT A;  5JA7 A;  5CHV A;  4YYU A;  1PPN A;  2YJC A;  1MEM A;  2DC8 A;  2XU1 A;  4P6G A;  1XKG A;  2DC7 A;  1HUC B;  2DZY A;  3WXE A;  3U8E A;  2FO5 A;  8PCH A;  1GMY A;  1Y4H A;  1YK8 A;  7PCK A;  1BP4 A;  1CS8 A;  2AUZ A;  2FTD A;  2R9M A;  2G6D A;  4CDE B;  3QT4 A;  3WXG A;  3HHI A;  1PPP A;  4PAD A; 
#chains in the Genus database with same CATH topology
 1PPD A;  1CJL A;  2R9O A;  4G54 A;  2UZJ A;  1PPO A;  4CDD B;  2AIM A;  3PT2 A;  1ITO A;  1NLJ A;  1AYU A;  2AGA A;  2ATO A;  1CB5 A;  1MHW A;  4FK5 A;  4RF0 A;  4W4U A;  2G8E A;  6PAD A;  4XR7 A;  4OEM A;  2FE8 A;  2CB5 A;  2XU4 A;  1VSN A;  1QOL A;  1POP A;  1MDW A;  2F1G A;  2JTC A;  3H8B A;  2P86 A;  3DF0 A;  1THE A;  3O0U A;  2BDL A;  1PVJ A;  3RVX A;  3PRM A;  3OIS A;  2PBH A;  4YYW A;  3IEJ A;  4FIP A;  2HXZ A;  2G7Y A;  5KO3 A;  1AU4 A;  3N3K A;  3BPM A;  3PHU A;  3S3R A;  4XUI A;  1EF7 A;  3H7D A;  1EWP A;  1QXP A;  4YYS A;  3C0R A;  3USV A;  1TLO A;  3PBH A;  1KHQ A;  1F29 A;  2R9N A;  3KX1 A;  4P6E A;  1PAD A;  1MS6 A;  2NQI A;  3BY4 A;  4PP2 E;  4W5C A;  4A5U A;  4BOP A;  4IUM A;  3CBJ A;  2DOS A;  4BS5 A;  3KKU A;  1U9W A;  2YJ2 A;  3BCN A;  4QRV A;  1FH0 A;  1F2C A;  3MTN A;  2IPP B;  3C9E A;  4PI3 A;  3N3G A;  1F2A A;  2XU3 A;  2NQD B;  3I06 A;  3K24 A;  3KFQ A;  4X6H A;  3MHS A;  1U9Q X;  2G8J A;  4OEL A;  1NQC A;  3ZNH A;  2CIO A;  1DF0 A;  1U9X A;  4WA6 A;  5CVO B;  1ATK A;  2FT2 A;  5EZS A;  1PBH A;  3LXS A;  3K8U A;  2YJ9 A;  3CH3 X;  3IFU A;  3IOQ A;  1AU3 A;  3PW3 A;  1UKF A;  3IMA A;  2HH5 A;  2DZZ A;  1SNK A;  3KSE A;  2DCD A;  3P5X A;  1PE6 A;  1EWL A;  4QH6 A;  2DCC A;  2WBF X;  1CSB B;  2NQA A;  1X9Y A;  1GLO A;  2J7Q C;  2ARY A;  2NQG A;  3LFY A;  3OVZ A;  3TRK A;  1ME3 A;  3PHW A;  3RVV A;  2O6X A;  1BY8 A;  1CTE A;  2R9C A;  1A6R A;  2F7D A;  1AEC A;  2AUX A;  2P0R A;  4QRX A;  3HD3 A;  3QSD A;  1JQP A;  3S3Q A;  3PSE A;  3OVX A;  1ZIV A;  3IV2 A;  3BOW A;  2FQ9 A;  3F75 A;  5EF4 A;  3MJ5 A;  1Q6K A;  4WUR A;  3PDF A;  2H7J A;  1PCI A;  2FRA A;  3TMP A;  3HWN A;  2AS8 A;  1M6D A;  4M0W A;  2IBI A;  3BPF A;  4OVZ A;  3WXF A;  4BPV A;  2DJF B;  2C0Y A;  3F5V A;  3O65 A;  4KLB A;  1GEC E;  1NB3 A;  1YVB A;  2AVW A;  1ICF A;  2JQG R;  2FUD A;  2YJ8 A;  4MZO A;  2PNS A;  4MSX A;  4DMX A;  1KHP A;  2ACT A;  2FYE A;  3PHX A;  1CVZ A;  4RF1 A;  3P5U A;  5CVM A;  3NHE A;  3MP2 A;  4YV8 A;  5PAD A;  3QJ3 A;  4YYQ A;  3OQC A;  2OZ2 A;  2PAD A;  4ZUX U;  1EWM A;  4BOQ A;  1KFU L;  1CV8 A;  3H6S A;  4OVZ B;  3W31 A;  2B1N A;  3B79 A;  3H8C A;  4Q8H A;  1NB5 A;  1TU6 A;  5EGW A;  4X6I A;  1YZB A;  2DC6 A;  3BB7 A;  3OF8 A;  3PRP A;  4QBB A;  3IHP A;  3E1Z B;  3KWZ A;  1BGO A;  1YT7 A;  2PRE A;  5EZQ A;  1S4V A;  2XU5 A;  4D8B A;  1CPJ A;  1PIP A;  1YK7 A;  5FPW A;  2E00 A;  1STF E;  4YYR A;  1EWO A;  4X6J A;  2AU1 A;  3O1G A;  2OP3 A;  1YAL A;  1KXR A;  1AU0 A;  1IWD A;  4N4Z A;  3GCB A;  2BTW A;  3B21 A;  1MIR A;  4CZW A;  3H89 A;  4PP1 A;  5JZE A;  3BC3 A;  3AI8 A;  2JQF R;  4RY2 A;  2DCB A;  5E6J A;  2Z84 A;  1ZCM A;  3ZUA A;  3CH2 X;  3N4C A;  3P5V A;  5JH3 A;  1GCB A;  4IP3 A;  4Q8G A;  1O0E A;  2Y6E A;  2E03 A;  1AIM A;  1DKI A;  2DC9 A;  2E01 A;  4CDC B;  1PXV A;  2VHS A;  3PNR A;  4BOU A;  2R9F A;  4BOS A;  4DMY A;  4MI7 A;  4AXL A;  3TNX A;  2AYO A;  2GFO A;  5K16 A;  1VJV A;  4CDF B;  4W5B A;  4BSQ A;  4OW0 A;  1F2B A;  4I04 A;  3MOR A;  3D6S A;  1ME4 A;  1U5I A;  4I07 A;  2Y5B A;  3BBA A;  4BS6 A;  2BU3 A;  3K9M A;  9PAP A;  4N79 A;  1TL9 A;  5J94 A;  4AXM A;  3E9S A;  3V6C A;  4MZS A;  5CHT A;  5F02 A;  4GUA A;  1AU2 A;  3OF9 A;  1U9V A;  1K3B B;  1AYW A;  4PT5 A;  3CBK A;  2HD5 A;  4YVA A;  4RNA A;  1NPZ A;  1MEG A;  2E02 A;  4D8I A;  3ERV A;  3BWK A;  1CQD A;  2BTW B;  3P5W A;  1DEU A;  2OUL A;  4HWY A;  1Y08 A;  4XZX A;  2VHF A;  4HXD B;  4I05 A;  2DJG B;  4YYV A;  2R6N A;  3KW9 A;  1AYV A;  4RKX A;  4D8E A;  2DCA A;  2B1M A;  2BDZ A;  2HHN A;  1KFX L;  3M99 A;  1NL6 A;  4FJC A;  1BQI A;  4K7C A;  1QDQ A;  4QRG A;  4N8W A;  2FRQ A;  2JRI A;  3V6E A;  2AYN A;  2HWK A;  3RNV A;  2P7U A;  3KWB X;  2GHU A;  1SP4 B;  2YJB A;  1QMY A;  5CVN B;  4ZTB A;  3I3T A;  2J7Q A;  3HHA A;  4BQV A;  3MHH A;  5A24 A;  4R3D A;  4REZ A;  3RVW A;  3IUT A;  5JA7 A;  5CHV A;  4YYU A;  1PPN A;  2YJC A;  1MEM A;  2DC8 A;  3MTV A;  2XU1 A;  4P6G A;  1XKG A;  2DC7 A;  4P16 A;  1HUC B;  2DZY A;  3WXE A;  3U8E A;  3W30 A;  2FO5 A;  8PCH A;  4MM3 B;  1GMY A;  1Y4H A;  1YK8 A;  7PCK A;  1BP4 A;  4BOZ A;  1CS8 A;  2AUZ A;  2FTD A;  2R9M A;  2G6D A;  4CDE B;  3QT4 A;  3WXG A;  3HHI A;  1PPP A;  4PAD A; 
#chains in the Genus database with same CATH homology
 1PPD A;  1CJL A;  2R9O A;  4G54 A;  1PPO A;  4CDD B;  2AIM A;  1ITO A;  1NLJ A;  1AYU A;  2ATO A;  1CB5 A;  1MHW A;  4FK5 A;  4W4U A;  2G8E A;  6PAD A;  4XR7 A;  4OEM A;  2CB5 A;  2XU4 A;  1VSN A;  1QOL A;  1POP A;  1MDW A;  2F1G A;  3H8B A;  2P86 A;  3DF0 A;  1THE A;  3O0U A;  2BDL A;  3RVX A;  4YYW A;  3OIS A;  2PBH A;  3IEJ A;  4FIP A;  2HXZ A;  2G7Y A;  1AU4 A;  3N3K A;  3BPM A;  3S3R A;  4XUI A;  1EF7 A;  3H7D A;  1EWP A;  1QXP A;  4YYS A;  3USV A;  1TLO A;  3PBH A;  1KHQ A;  1F29 A;  2R9N A;  3KX1 A;  4P6E A;  1PAD A;  1MS6 A;  2NQI A;  4PP2 E;  4W5C A;  3CBJ A;  4BS5 A;  3KKU A;  1U9W A;  2YJ2 A;  3BCN A;  4QRV A;  1FH0 A;  1F2C A;  3MTN A;  2IPP B;  3C9E A;  4PI3 A;  3N3G A;  1F2A A;  2XU3 A;  2NQD B;  3I06 A;  3K24 A;  3KFQ A;  4X6H A;  3MHS A;  1U9Q X;  2G8J A;  4OEL A;  1NQC A;  2CIO A;  1DF0 A;  1U9X A;  4WA6 A;  5CVO B;  1ATK A;  2FT2 A;  1PBH A;  3LXS A;  3K8U A;  2YJ9 A;  3CH3 X;  3IOQ A;  1AU3 A;  3PW3 A;  3IMA A;  2HH5 A;  2DZZ A;  1SNK A;  3KSE A;  2DCD A;  3P5X A;  1PE6 A;  1EWL A;  4QH6 A;  2DCC A;  2WBF X;  1CSB B;  2NQA A;  1X9Y A;  1GLO A;  2ARY A;  2NQG A;  3LFY A;  3OVZ A;  1ME3 A;  3RVV A;  2O6X A;  1BY8 A;  1CTE A;  2R9C A;  1A6R A;  2F7D A;  1AEC A;  2AUX A;  2P0R A;  4QRX A;  3HD3 A;  4BGF A;  3QSD A;  1JQP A;  3S3Q A;  3OVX A;  1ZIV A;  3IV2 A;  3BOW A;  2FQ9 A;  3F75 A;  5EF4 A;  1Q6K A;  3PDF A;  2H7J A;  1PCI A;  2FRA A;  3HWN A;  2AS8 A;  1M6D A;  2IBI A;  3BPF A;  1W6F A;  3WXF A;  4BPV A;  2DJF B;  2C0Y A;  3F5V A;  1GEC E;  4KLB A;  1NB3 A;  1YVB A;  2AVW A;  1ICF A;  2JQG R;  2FUD A;  2YJ8 A;  4MZO A;  2PNS A;  4MSX A;  4DMX A;  4NV8 A;  1KHP A;  2ACT A;  2FYE A;  1CVZ A;  3P5U A;  5CVM A;  3NHE A;  4NV7 A;  4YV8 A;  5PAD A;  3QJ3 A;  4YYQ A;  2OZ2 A;  2PAD A;  4ZUX U;  1EWM A;  1KFU L;  1W4T A;  1CV8 A;  3H6S A;  2B1N A;  3B79 A;  3H8C A;  4Q8H A;  1NB5 A;  1TU6 A;  5EGW A;  4X6I A;  2DC6 A;  4QBB A;  3OF8 A;  3IHP A;  3E1Z B;  3KWZ A;  1BGO A;  1YT7 A;  2PRE A;  2VFB A;  1S4V A;  2XU5 A;  1CPJ A;  1PIP A;  1YK7 A;  5FPW A;  2E00 A;  1STF E;  4YYR A;  1EWO A;  4X6J A;  2AU1 A;  3O1G A;  2OP3 A;  4GUZ A;  1YAL A;  1KXR A;  1AU0 A;  1IWD A;  4N4Z A;  3GCB A;  1MIR A;  4CZW A;  3H89 A;  4PP1 A;  3BC3 A;  3AI8 A;  2JQF R;  4RY2 A;  4C5P A;  1GX3 A;  2DCB A;  1ZCM A;  3ZUA A;  3CH2 X;  3N4C A;  3P5V A;  5JH3 A;  1GCB A;  4Q8G A;  1O0E A;  2Y6E A;  2E03 A;  1AIM A;  2DC9 A;  2E01 A;  4CDC B;  1PXV A;  2VHS A;  3PNR A;  2R9F A;  4DMY A;  4AXL A;  3TNX A;  2AYO A;  2GFO A;  5K16 A;  1VJV A;  4CDF B;  4W5B A;  4BSQ A;  1F2B A;  2BSZ A;  4I04 A;  3MOR A;  1W5R A;  1ME4 A;  3D6S A;  1U5I A;  4I07 A;  2Y5B A;  4BS6 A;  3K9M A;  9PAP A;  4N79 A;  1TL9 A;  5J94 A;  4AXM A;  3V6C A;  4MZS A;  5CHT A;  2VFC A;  5F02 A;  1AU2 A;  3OF9 A;  1U9V A;  1K3B B;  1AYW A;  3CBK A;  1E2T A;  2HD5 A;  4YVA A;  1NPZ A;  1MEG A;  2E02 A;  3ERV A;  3BWK A;  1CQD A;  3P5W A;  1DEU A;  2OUL A;  4HWY A;  1Y08 A;  2VHF A;  3LTW A;  4I05 A;  2DJG B;  4YYV A;  2R6N A;  3KW9 A;  1AYV A;  2DCA A;  2B1M A;  2BDZ A;  2HHN A;  1KFX L;  3M99 A;  4B55 A;  1NL6 A;  4FJC A;  1BQI A;  4K7C A;  1QDQ A;  4QRG A;  4N8W A;  2FRQ A;  3V6E A;  2AYN A;  2P7U A;  3KWB X;  2GHU A;  1SP4 B;  2YJB A;  1QMY A;  5CVN B;  3I3T A;  3HHA A;  4BQV A;  3MHH A;  5A24 A;  3RVW A;  3IUT A;  5JA7 A;  5CHV A;  4YYU A;  1PPN A;  2YJC A;  1MEM A;  2DC8 A;  2XU1 A;  4P6G A;  1XKG A;  2DC7 A;  1HUC B;  2DZY A;  3WXE A;  3U8E A;  2FO5 A;  8PCH A;  1GMY A;  1Y4H A;  1YK8 A;  3D9W A;  7PCK A;  1BP4 A;  1CS8 A;  2AUZ A;  2FTD A;  2R9M A;  2G6D A;  4CDE B;  3QT4 A;  3WXG A;  3HHI A;  1PPP A;  4PAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...