2VHSA

Cathsilicatein, a chimera
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
217
structure length
215
Chain Sequence
APRSVDWREKGYVTPVKNQGQCGASYAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDVGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFSSDCSSSSLNHAMLVVGYGFISQKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHSILICATEIN
publication title Crystal Structure and Silica Condensing Activities of Silicatein Alpha-Cathepsin L Chimeras.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 66
structure length 215
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.15: Cathepsin L.
pdb deposition date 2007-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2vhsA00
1Q6KA 2B1MA 2DCAA 2F1GA 1SNKA 3CH3X 1AYVA 1IWDA 2FT2A 4I04A 2DZZA 2JQGR 1CVZA 2G6DA 2AYNA 4BS5A 1BQIA 3BOWA 2AS8A 1AYWA 2DC6A 1CB5A 2DCDA 2IPPB 3TNXA 4HWYA 5JA7A 3KWBX 1EWOA 4MZOA 1YVBA 1ATKA 3H8BA 3DF0A 2P7UA 4PADA 1DF0A 1GECE 1EF7A 4KLBA 4Q8HA 1ME4A 1CTEA 4YYRA 4X6IA 3USVA 4AXMA 3NHEA 3OVZA 4I07A 4QRGA 3BC3A 1PXVA 1U9XA 2WBFX 1PPOA 3N3KA 2NQDB 1ZCMA 1PIPA 3HHIA 5EGWA 1PADA 1ICFA 1U9VA 1PE6A 4WA6A 1F2AA 1TLOA 3GCBA 2ATOA 2BDLA 2FQ9A 2XU4A 3N4CA 1F2CA 3IOQA 5CVNB 3MHSA 3S3RA 1QMYA 4I05A 1FH0A 4FK5A 3RVVA 4QRXA 3PW3A 2PADA 1PPPA 3HD3A 1CV8A 4CDCB 3KWZA 3KFQA 3K9MA 1U5IA 1O0EA 1AU4A 3BCNA 1KHPA 3P5XA 2G8JA 3PDFA 3H6SA 1QOLA 3PNRA 1EWMA 3IUTA 2YJ8A 2XU1A 4OEMA 5A24A 3IHPA 1A6RA 1NQCA 1BP4A 4PI3A 1U9WA 1THEA 5CVOB 4BPVA 1M6DA 2YJ2A 2E01A 2AU1A 3MORA 2DC8A 3QT4A 4Q8GA 3S3QA 1YT7A 4YYSA 5FPWA 2H7JA 4YYQA 1KFUL 1MHWA 1F2BA 1GLOA 3K24A 1QDQA 3ERVA 2O6XA 2DCCA 4BSQA 5CHVA 2ACTA 2FTDA 2BDZA 2GHUA 2Y5BA 4X6JA 1PBHA 3WXFA 3MHHA 4AXLA 2OP3A 1XKGA 4N79A 1Y4HA 1MS6A 7PCKA 2FO5A 3KX1A 3PBHA 4W5CA 1X9YA 3CH2X 2YJCA 2VHSA 2R9MA 3CBKA 4K7CA 1F29A 1Y08A 1AIMA 2B1NA 2R9CA 1CJLA 3OVXA 3P5WA 4FJCA 2G8EA 2OULA 4YYWA 2R9NA 3H8CA 2G7YA 2P0RA 3I3TA 1VJVA 1QXPA 1YK8A 2AUXA 1EWPA 2CIOA 4P6GA 2AYOA 4CDEB 2Y6EA 2NQIA 4RY2A 1ITOA 2R9FA 3LXSA 3K8UA 2R9OA 4YYUA 1CSBB 1TL9A 2HHNA 5EF4A 3IV2A 1AU2A 2GFOA 5F02A 3N3GA 3RVWA 3BPFA 3E1ZB 4BQVA 3OF8A 2C0YA 1HUCB 3HWNA 3ZUAA 3BWKA 2DJGB 6PADA 2FRQA 1U9QX 1GMYA 1STFE 3M99A 5CHTA 2E02A 1BY8A 3OISA 3KSEA 1AYUA 1NB3A 3LFYA 3MTNA 3I06A 3F5VA 2DC9A 4W5BA 4CDDB 3RVXA 3O1GA 2FRAA 2JQFR 2XU3A 4DMYA 3IEJA 2HD5A 3HHAA 2AIMA 4XUIA 4QH6A 2VHFA 4N8WA 2DC7A 4MSXA 1K3BB 1S4VA 2P86A 4PP1A 5PADA 1MIRA 4OELA 2OZ2A 5J94A 1MEGA 4CDFB 1CQDA 2HXZA 1BGOA 3OF9A 4ZUXU 2DJFB 2FUDA 4QRVA 1KFXL 4X6HA 3C9EA 4N4ZA 2NQGA 5CVMA 1POPA 9PAPA 3AI8A 2PBHA 4QBBA 1MEMA 1KXRA 3P5VA 1TU6A 3QJ3A 5K16A 2E03A 4P6EA 3F75A 5JH3A 3B79A 3P5UA 1MDWA 2ARYA 4CZWA 2DCBA 2XU5A 3V6EA 3O0UA 1CPJA 3U8EA 1AECA 1NB5A 4BS6A 3KW9A 2AUZA 1NLJA 1GCBA 2AVWA 1PCIA 1EWLA 1YK7A 8PCHA 3CBJA 2YJ9A 1AU0A 1YALA 3H7DA 1ZIVA 2NQAA 3BPMA 4YVAA 1VSNA 1DEUA 3WXEA 1AU3A 4G54A 4W4UA 3WXGA 4YV8A 2R6NA 3IMAA 3QSDA 4MZSA 2PNSA 2HH5A 3KKUA 2PREA 4XR7A 3D6SA 4DMXA 3V6CA 1CS8A 2DZYA 2E00A 1PPNA 1SP4B 3H89A 1NL6A 2IBIA 1JQPA 1NPZA 2CB5A 2FYEA 4FIPA 4PP2E 1KHQA 4YYVA 2YJBA 2F7DA 1PPDA 1ME3A
chains in the Genus database with same CATH superfamily
1Q6KA 2B1MA 2DCAA 2F1GA 1SNKA 3CH3X 3IFUA 1AYVA 1IWDA 2FT2A 4I04A 4GUAA 2DZZA 4HXDB 4BOQA 2JQGR 4A5UA 1CVZA 2G6DA 5E6JA 2AYNA 4BS5A 1BQIA 3BOWA 2AS8A 1AYWA 2DC6A 1CB5A 2DCDA 2IPPB 3TNXA 4HWYA 2HWKA 2BTWA 5JA7A 3KWBX 1EWOA 1YZBA 3MP2A 4MZOA 1YVBA 1ATKA 3W31A 3H8BA 3DF0A 2P7UA 4PADA 1DF0A 1GECE 1EF7A 4KLBA 4Q8HA 1ME4A 1CTEA 4YYRA 4X6IA 2UZJA 3USVA 3MTVA 4AXMA 3NHEA 3OVZA 4MM3B 4I07A 4QRGA 3BC3A 1PXVA 1U9XA 4PT5A 2WBFX 1PPOA 3N3KA 3B21A 2NQDB 1ZCMA 1PIPA 1UKFA 3HHIA 5EGWA 4BOSA 1PADA 1ICFA 1U9VA 1PE6A 4WA6A 1F2AA 1TLOA 3GCBA 2ATOA 2BDLA 2FQ9A 3PT2A 3OQCA 2XU4A 3N4CA 1F2CA 3IOQA 5CVNB 3MHSA 3PRMA 3S3RA 2BTWB 1QMYA 4I05A 1FH0A 4FK5A 3RVVA 4QRXA 3PW3A 2PADA 1PPPA 3HD3A 1CV8A 4CDCB 3KWZA 3KFQA 3K9MA 1U5IA 1O0EA 1AU4A 3BCNA 1KHPA 3P5XA 2G8JA 3PDFA 3H6SA 1QOLA 3PNRA 3PHUA 1EWMA 3IUTA 2YJ8A 2XU1A 4OEMA 5A24A 3IHPA 1A6RA 1NQCA 5EZQA 1BP4A 4PI3A 1U9WA 2J7QC 1THEA 5CVOB 4BPVA 1M6DA 2YJ2A 2E01A 2AU1A 3MORA 2DC8A 3QT4A 4BOUA 4Q8GA 3S3QA 1YT7A 4YYSA 5FPWA 4OVZA 2H7JA 4YYQA 1KFUL 4REZA 1MHWA 1F2BA 1GLOA 3K24A 3TMPA 1QDQA 3ERVA 2O6XA 2DCCA 4BSQA 5CHVA 2BU3A 2ACTA 2FTDA 2BDZA 2GHUA 2Y5BA 4X6JA 1PBHA 3WXFA 3BBAA 3MHHA 4AXLA 2OP3A 1XKGA 4N79A 1Y4HA 1MS6A 4XZXA 7PCKA 2FO5A 3KX1A 3PBHA 4W5CA 1X9YA 3CH2X 2YJCA 2VHSA 2R9MA 4ZTBA 3PHWA 3CBKA 4K7CA 1F29A 3PHXA 2JRIA 4IP3A 1Y08A 1AIMA 2B1NA 2R9CA 1CJLA 3OVXA 3P5WA 4FJCA 2G8EA 2OULA 4YYWA 2R9NA 3TRKA 3H8CA 2G7YA 2P0RA 3I3TA 1VJVA 4M0WA 1QXPA 1YK8A 2AUXA 4MI7A 1EWPA 1DKIA 2CIOA 4RKXA 4P6GA 4OVZB 2Z84A 2AYOA 4CDEB 4BOPA 3O65A 2Y6EA 2NQIA 3PRPA 4RY2A 1ITOA 2R9FA 3LXSA 5JZEA 3K8UA 4RF0A 2R9OA 4YYUA 1CSBB 1TL9A 2HHNA 5EF4A 4R3DA 4IUMA 3IV2A 1AU2A 2GFOA 4OW0A 3PSEA 5F02A 3N3GA 2JTCA 3RVWA 3BPFA 3E1ZB 3BB7A 4BQVA 4P16A 3OF8A 2C0YA 4D8IA 1HUCB 3HWNA 3ZUAA 3BWKA 2DJGB 6PADA 2FRQA 3BY4A 1U9QX 1GMYA 1STFE 3M99A 5CHTA 2E02A 1BY8A 3OISA 3KSEA 1AYUA 2DOSA 1NB3A 3LFYA 3MTNA 3I06A 3F5VA 2DC9A 4RF1A 4W5BA 3RNVA 4CDDB 3RVXA 3O1GA 2FRAA 2JQFR 2XU3A 3MJ5A 4DMYA 3IEJA 2HD5A 3HHAA 2AIMA 4XUIA 4QH6A 2VHFA 4N8WA 2DC7A 2AGAA 4MSXA 1K3BB 1S4VA 2P86A 4PP1A 4D8BA 5PADA 1MIRA 4OELA 2OZ2A 5J94A 1MEGA 4WURA 4CDFB 1CQDA 2HXZA 3E9SA 1BGOA 3OF9A 4ZUXU 2DJFB 2FUDA 4QRVA 3ZNHA 1KFXL 4X6HA 3C9EA 4N4ZA 2NQGA 5CVMA 1POPA 9PAPA 3AI8A 2PBHA 4QBBA 5EZSA 1MEMA 3C0RA 1KXRA 3P5VA 1TU6A 3QJ3A 5K16A 2E03A 4P6EA 3F75A 5JH3A 3B79A 3P5UA 1MDWA 2ARYA 4CZWA 2DCBA 2FE8A 2XU5A 3V6EA 3O0UA 1CPJA 3U8EA 1AECA 1NB5A 4BS6A 3KW9A 5KO3A 2J7QA 4D8EA 2AUZA 1NLJA 1GCBA 2AVWA 1PCIA 1EWLA 1YK7A 8PCHA 3CBJA 4BOZA 2YJ9A 1AU0A 1YALA 3H7DA 3W30A 1ZIVA 2NQAA 3BPMA 4YVAA 1VSNA 1DEUA 3WXEA 1PVJA 1AU3A 4G54A 4W4UA 3WXGA 4YV8A 2R6NA 3IMAA 3QSDA 4MZSA 2PNSA 2HH5A 3KKUA 2PREA 4XR7A 3D6SA 4DMXA 3V6CA 1CS8A 2DZYA 2E00A 1PPNA 1SP4B 3H89A 1NL6A 2IBIA 1JQPA 1NPZA 2CB5A 4RNAA 2FYEA 4FIPA 4PP2E 1KHQA 4YYVA 2YJBA 2F7DA 1PPDA 1ME3A
chains in the Genus database with same CATH topology
1Q6KA 2B1MA 2DCAA 2F1GA 1SNKA 3CH3X 1AYVA 1W5RA 1IWDA 2FT2A 4I04A 2DZZA 2JQGR 1GX3A 1CVZA 4B55A 2G6DA 2AYNA 4BS5A 1BQIA 3BOWA 2AS8A 1AYWA 2DC6A 4BGFA 1CB5A 2DCDA 2IPPB 3TNXA 4HWYA 1E2TA 5JA7A 3KWBX 1EWOA 4GUZA 4MZOA 1YVBA 1ATKA 3H8BA 3DF0A 2P7UA 4PADA 1DF0A 1GECE 1EF7A 4KLBA 4Q8HA 1ME4A 1CTEA 4YYRA 4X6IA 3USVA 4AXMA 3NHEA 3OVZA 4I07A 4QRGA 3BC3A 1PXVA 1U9XA 2WBFX 1PPOA 3N3KA 2NQDB 1ZCMA 1PIPA 3D9WA 3HHIA 5EGWA 1PADA 1ICFA 1U9VA 1PE6A 4WA6A 1F2AA 1TLOA 3GCBA 2ATOA 2BDLA 2FQ9A 2XU4A 3N4CA 1F2CA 3IOQA 5CVNB 3MHSA 3S3RA 1QMYA 4I05A 1FH0A 4FK5A 3RVVA 4QRXA 3PW3A 2PADA 1PPPA 3HD3A 1CV8A 2BSZA 4CDCB 3KWZA 3KFQA 3K9MA 1U5IA 4NV8A 1O0EA 1AU4A 3BCNA 1KHPA 3P5XA 2G8JA 3PDFA 3H6SA 1QOLA 3PNRA 1EWMA 3IUTA 2YJ8A 2XU1A 4OEMA 5A24A 3IHPA 1A6RA 1NQCA 1BP4A 4PI3A 1U9WA 1THEA 5CVOB 4BPVA 1M6DA 2YJ2A 2E01A 2AU1A 3MORA 2DC8A 3QT4A 4Q8GA 3S3QA 1YT7A 4YYSA 5FPWA 2H7JA 4YYQA 1KFUL 1MHWA 1F2BA 1GLOA 3K24A 1QDQA 3ERVA 2O6XA 2DCCA 4BSQA 5CHVA 1W4TA 2ACTA 2FTDA 2BDZA 2GHUA 2Y5BA 4X6JA 1PBHA 3WXFA 3MHHA 4AXLA 2OP3A 1XKGA 4N79A 1Y4HA 1MS6A 7PCKA 2FO5A 3KX1A 3PBHA 4W5CA 1X9YA 3CH2X 2YJCA 2VHSA 2R9MA 3CBKA 4K7CA 1F29A 1Y08A 1AIMA 2B1NA 2R9CA 1CJLA 3OVXA 3P5WA 4FJCA 2G8EA 2OULA 4YYWA 2R9NA 3H8CA 2G7YA 2P0RA 3I3TA 1VJVA 1QXPA 1YK8A 2AUXA 1EWPA 2CIOA 4P6GA 2AYOA 4CDEB 2Y6EA 2NQIA 4RY2A 2VFBA 1ITOA 2R9FA 3LXSA 3K8UA 2R9OA 4YYUA 1CSBB 1TL9A 2HHNA 5EF4A 3IV2A 1AU2A 2GFOA 5F02A 3N3GA 3RVWA 3BPFA 3E1ZB 1W6FA 4BQVA 3OF8A 2C0YA 1HUCB 3HWNA 3ZUAA 3BWKA 2DJGB 6PADA 2FRQA 1U9QX 1GMYA 1STFE 3M99A 5CHTA 2E02A 1BY8A 3OISA 3KSEA 1AYUA 1NB3A 3LFYA 3MTNA 3I06A 3F5VA 2DC9A 4W5BA 4CDDB 3RVXA 3O1GA 2FRAA 2JQFR 2XU3A 4DMYA 3IEJA 2HD5A 3HHAA 2AIMA 4XUIA 4QH6A 2VFCA 2VHFA 4N8WA 2DC7A 4MSXA 1K3BB 1S4VA 2P86A 4PP1A 5PADA 1MIRA 4OELA 2OZ2A 5J94A 1MEGA 4CDFB 1CQDA 2HXZA 1BGOA 3OF9A 4ZUXU 2DJFB 2FUDA 4QRVA 1KFXL 4X6HA 3C9EA 4N4ZA 2NQGA 5CVMA 1POPA 9PAPA 3AI8A 2PBHA 4QBBA 1MEMA 1KXRA 3P5VA 1TU6A 3QJ3A 5K16A 2E03A 4P6EA 3F75A 4C5PA 5JH3A 3B79A 3P5UA 1MDWA 2ARYA 4CZWA 2DCBA 2XU5A 3V6EA 3O0UA 1CPJA 3U8EA 1AECA 3LTWA 1NB5A 4BS6A 3KW9A 2AUZA 1NLJA 1GCBA 2AVWA 1PCIA 1EWLA 1YK7A 8PCHA 3CBJA 2YJ9A 1AU0A 1YALA 4NV7A 3H7DA 1ZIVA 2NQAA 3BPMA 4YVAA 1VSNA 1DEUA 3WXEA 1AU3A 4G54A 4W4UA 3WXGA 4YV8A 2R6NA 3IMAA 3QSDA 4MZSA 2PNSA 2HH5A 3KKUA 2PREA 4XR7A 3D6SA 4DMXA 3V6CA 1CS8A 2DZYA 2E00A 1PPNA 1SP4B 3H89A 1NL6A 2IBIA 1JQPA 1NPZA 2CB5A 2FYEA 4FIPA 4PP2E 1KHQA 4YYVA 2YJBA 2F7DA 1PPDA 1ME3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q6K A;  2B1M A;  2DCA A;  2F1G A;  1SNK A;  3CH3 X;  1AYV A;  1IWD A;  2FT2 A;  4I04 A;  2DZZ A;  2JQG R;  1CVZ A;  2G6D A;  2AYN A;  4BS5 A;  1BQI A;  3BOW A;  2AS8 A;  1AYW A;  2DC6 A;  1CB5 A;  2DCD A;  2IPP B;  3TNX A;  4HWY A;  5JA7 A;  3KWB X;  1EWO A;  4MZO A;  1YVB A;  1ATK A;  3H8B A;  3DF0 A;  2P7U A;  4PAD A;  1DF0 A;  1GEC E;  1EF7 A;  4KLB A;  4Q8H A;  1ME4 A;  1CTE A;  4YYR A;  4X6I A;  3USV A;  4AXM A;  3NHE A;  3OVZ A;  4I07 A;  4QRG A;  3BC3 A;  1PXV A;  1U9X A;  2WBF X;  1PPO A;  3N3K A;  2NQD B;  1ZCM A;  1PIP A;  3HHI A;  5EGW A;  1PAD A;  1ICF A;  1U9V A;  1PE6 A;  4WA6 A;  1F2A A;  1TLO A;  3GCB A;  2ATO A;  2BDL A;  2FQ9 A;  2XU4 A;  3N4C A;  1F2C A;  3IOQ A;  5CVN B;  3MHS A;  3S3R A;  1QMY A;  4I05 A;  1FH0 A;  4FK5 A;  3RVV A;  4QRX A;  3PW3 A;  2PAD A;  1PPP A;  3HD3 A;  1CV8 A;  4CDC B;  3KWZ A;  3KFQ A;  3K9M A;  1U5I A;  1O0E A;  1AU4 A;  3BCN A;  1KHP A;  3P5X A;  2G8J A;  3PDF A;  3H6S A;  1QOL A;  3PNR A;  1EWM A;  3IUT A;  2YJ8 A;  2XU1 A;  4OEM A;  5A24 A;  3IHP A;  1A6R A;  1NQC A;  1BP4 A;  4PI3 A;  1U9W A;  1THE A;  5CVO B;  4BPV A;  1M6D A;  2YJ2 A;  2E01 A;  2AU1 A;  3MOR A;  2DC8 A;  3QT4 A;  4Q8G A;  3S3Q A;  1YT7 A;  4YYS A;  5FPW A;  2H7J A;  4YYQ A;  1KFU L;  1MHW A;  1F2B A;  1GLO A;  3K24 A;  1QDQ A;  3ERV A;  2O6X A;  2DCC A;  4BSQ A;  5CHV A;  2ACT A;  2FTD A;  2BDZ A;  2GHU A;  2Y5B A;  4X6J A;  1PBH A;  3WXF A;  3MHH A;  4AXL A;  2OP3 A;  1XKG A;  4N79 A;  1Y4H A;  1MS6 A;  7PCK A;  2FO5 A;  3KX1 A;  3PBH A;  4W5C A;  1X9Y A;  3CH2 X;  2YJC A;  2VHS A;  2R9M A;  3CBK A;  4K7C A;  1F29 A;  1Y08 A;  1AIM A;  2B1N A;  2R9C A;  1CJL A;  3OVX A;  3P5W A;  4FJC A;  2G8E A;  2OUL A;  4YYW A;  2R9N A;  3H8C A;  2G7Y A;  2P0R A;  3I3T A;  1VJV A;  1QXP A;  1YK8 A;  2AUX A;  1EWP A;  2CIO A;  4P6G A;  2AYO A;  4CDE B;  2Y6E A;  2NQI A;  4RY2 A;  1ITO A;  2R9F A;  3LXS A;  3K8U A;  2R9O A;  4YYU A;  1CSB B;  1TL9 A;  2HHN A;  5EF4 A;  3IV2 A;  1AU2 A;  2GFO A;  5F02 A;  3N3G A;  3RVW A;  3BPF A;  3E1Z B;  4BQV A;  3OF8 A;  2C0Y A;  1HUC B;  3HWN A;  3ZUA A;  3BWK A;  2DJG B;  6PAD A;  2FRQ A;  1U9Q X;  1GMY A;  1STF E;  3M99 A;  5CHT A;  2E02 A;  1BY8 A;  3OIS A;  3KSE A;  1AYU A;  1NB3 A;  3LFY A;  3MTN A;  3I06 A;  3F5V A;  2DC9 A;  4W5B A;  4CDD B;  3RVX A;  3O1G A;  2FRA A;  2JQF R;  2XU3 A;  4DMY A;  3IEJ A;  2HD5 A;  3HHA A;  2AIM A;  4XUI A;  4QH6 A;  2VHF A;  4N8W A;  2DC7 A;  4MSX A;  1K3B B;  1S4V A;  2P86 A;  4PP1 A;  5PAD A;  1MIR A;  4OEL A;  2OZ2 A;  5J94 A;  1MEG A;  4CDF B;  1CQD A;  2HXZ A;  1BGO A;  3OF9 A;  4ZUX U;  2DJF B;  2FUD A;  4QRV A;  1KFX L;  4X6H A;  3C9E A;  4N4Z A;  2NQG A;  5CVM A;  1POP A;  9PAP A;  3AI8 A;  2PBH A;  4QBB A;  1MEM A;  1KXR A;  3P5V A;  1TU6 A;  3QJ3 A;  5K16 A;  2E03 A;  4P6E A;  3F75 A;  5JH3 A;  3B79 A;  3P5U A;  1MDW A;  2ARY A;  4CZW A;  2DCB A;  2XU5 A;  3V6E A;  3O0U A;  1CPJ A;  3U8E A;  1AEC A;  1NB5 A;  4BS6 A;  3KW9 A;  2AUZ A;  1NLJ A;  1GCB A;  2AVW A;  1PCI A;  1EWL A;  1YK7 A;  8PCH A;  3CBJ A;  2YJ9 A;  1AU0 A;  1YAL A;  3H7D A;  1ZIV A;  2NQA A;  3BPM A;  4YVA A;  1VSN A;  1DEU A;  3WXE A;  1AU3 A;  4G54 A;  4W4U A;  3WXG A;  4YV8 A;  2R6N A;  3IMA A;  3QSD A;  4MZS A;  2PNS A;  2HH5 A;  3KKU A;  2PRE A;  4XR7 A;  3D6S A;  4DMX A;  3V6C A;  1CS8 A;  2DZY A;  2E00 A;  1PPN A;  1SP4 B;  3H89 A;  1NL6 A;  2IBI A;  1JQP A;  1NPZ A;  2CB5 A;  2FYE A;  4FIP A;  4PP2 E;  1KHQ A;  4YYV A;  2YJB A;  2F7D A;  1PPD A;  1ME3 A; 
#chains in the Genus database with same CATH topology
 1Q6K A;  2B1M A;  2DCA A;  2F1G A;  1SNK A;  3CH3 X;  3IFU A;  1AYV A;  1IWD A;  2FT2 A;  4I04 A;  4GUA A;  2DZZ A;  4HXD B;  4BOQ A;  2JQG R;  4A5U A;  1CVZ A;  2G6D A;  5E6J A;  2AYN A;  4BS5 A;  1BQI A;  3BOW A;  2AS8 A;  1AYW A;  2DC6 A;  1CB5 A;  2DCD A;  2IPP B;  3TNX A;  4HWY A;  2HWK A;  2BTW A;  5JA7 A;  3KWB X;  1EWO A;  1YZB A;  3MP2 A;  4MZO A;  1YVB A;  1ATK A;  3W31 A;  3H8B A;  3DF0 A;  2P7U A;  4PAD A;  1DF0 A;  1GEC E;  1EF7 A;  4KLB A;  4Q8H A;  1ME4 A;  1CTE A;  4YYR A;  4X6I A;  2UZJ A;  3USV A;  3MTV A;  4AXM A;  3NHE A;  3OVZ A;  4MM3 B;  4I07 A;  4QRG A;  3BC3 A;  1PXV A;  1U9X A;  4PT5 A;  2WBF X;  1PPO A;  3N3K A;  3B21 A;  2NQD B;  1ZCM A;  1PIP A;  1UKF A;  3HHI A;  5EGW A;  4BOS A;  1PAD A;  1ICF A;  1U9V A;  1PE6 A;  4WA6 A;  1F2A A;  1TLO A;  3GCB A;  2ATO A;  2BDL A;  2FQ9 A;  3PT2 A;  3OQC A;  2XU4 A;  3N4C A;  1F2C A;  3IOQ A;  5CVN B;  3MHS A;  3PRM A;  3S3R A;  2BTW B;  1QMY A;  4I05 A;  1FH0 A;  4FK5 A;  3RVV A;  4QRX A;  3PW3 A;  2PAD A;  1PPP A;  3HD3 A;  1CV8 A;  4CDC B;  3KWZ A;  3KFQ A;  3K9M A;  1U5I A;  1O0E A;  1AU4 A;  3BCN A;  1KHP A;  3P5X A;  2G8J A;  3PDF A;  3H6S A;  1QOL A;  3PNR A;  3PHU A;  1EWM A;  3IUT A;  2YJ8 A;  2XU1 A;  4OEM A;  5A24 A;  3IHP A;  1A6R A;  1NQC A;  5EZQ A;  1BP4 A;  4PI3 A;  1U9W A;  2J7Q C;  1THE A;  5CVO B;  4BPV A;  1M6D A;  2YJ2 A;  2E01 A;  2AU1 A;  3MOR A;  2DC8 A;  3QT4 A;  4BOU A;  4Q8G A;  3S3Q A;  1YT7 A;  4YYS A;  5FPW A;  4OVZ A;  2H7J A;  4YYQ A;  1KFU L;  4REZ A;  1MHW A;  1F2B A;  1GLO A;  3K24 A;  3TMP A;  1QDQ A;  3ERV A;  2O6X A;  2DCC A;  4BSQ A;  5CHV A;  2BU3 A;  2ACT A;  2FTD A;  2BDZ A;  2GHU A;  2Y5B A;  4X6J A;  1PBH A;  3WXF A;  3BBA A;  3MHH A;  4AXL A;  2OP3 A;  1XKG A;  4N79 A;  1Y4H A;  1MS6 A;  4XZX A;  7PCK A;  2FO5 A;  3KX1 A;  3PBH A;  4W5C A;  1X9Y A;  3CH2 X;  2YJC A;  2VHS A;  2R9M A;  4ZTB A;  3PHW A;  3CBK A;  4K7C A;  1F29 A;  3PHX A;  2JRI A;  4IP3 A;  1Y08 A;  1AIM A;  2B1N A;  2R9C A;  1CJL A;  3OVX A;  3P5W A;  4FJC A;  2G8E A;  2OUL A;  4YYW A;  2R9N A;  3TRK A;  3H8C A;  2G7Y A;  2P0R A;  3I3T A;  1VJV A;  4M0W A;  1QXP A;  1YK8 A;  2AUX A;  4MI7 A;  1EWP A;  1DKI A;  2CIO A;  4RKX A;  4P6G A;  4OVZ B;  2Z84 A;  2AYO A;  4CDE B;  4BOP A;  3O65 A;  2Y6E A;  2NQI A;  3PRP A;  4RY2 A;  1ITO A;  2R9F A;  3LXS A;  5JZE A;  3K8U A;  4RF0 A;  2R9O A;  4YYU A;  1CSB B;  1TL9 A;  2HHN A;  5EF4 A;  4R3D A;  4IUM A;  3IV2 A;  1AU2 A;  2GFO A;  4OW0 A;  3PSE A;  5F02 A;  3N3G A;  2JTC A;  3RVW A;  3BPF A;  3E1Z B;  3BB7 A;  4BQV A;  4P16 A;  3OF8 A;  2C0Y A;  4D8I A;  1HUC B;  3HWN A;  3ZUA A;  3BWK A;  2DJG B;  6PAD A;  2FRQ A;  3BY4 A;  1U9Q X;  1GMY A;  1STF E;  3M99 A;  5CHT A;  2E02 A;  1BY8 A;  3OIS A;  3KSE A;  1AYU A;  2DOS A;  1NB3 A;  3LFY A;  3MTN A;  3I06 A;  3F5V A;  2DC9 A;  4RF1 A;  4W5B A;  3RNV A;  4CDD B;  3RVX A;  3O1G A;  2FRA A;  2JQF R;  2XU3 A;  3MJ5 A;  4DMY A;  3IEJ A;  2HD5 A;  3HHA A;  2AIM A;  4XUI A;  4QH6 A;  2VHF A;  4N8W A;  2DC7 A;  2AGA A;  4MSX A;  1K3B B;  1S4V A;  2P86 A;  4PP1 A;  4D8B A;  5PAD A;  1MIR A;  4OEL A;  2OZ2 A;  5J94 A;  1MEG A;  4WUR A;  4CDF B;  1CQD A;  2HXZ A;  3E9S A;  1BGO A;  3OF9 A;  4ZUX U;  2DJF B;  2FUD A;  4QRV A;  3ZNH A;  1KFX L;  4X6H A;  3C9E A;  4N4Z A;  2NQG A;  5CVM A;  1POP A;  9PAP A;  3AI8 A;  2PBH A;  4QBB A;  5EZS A;  1MEM A;  3C0R A;  1KXR A;  3P5V A;  1TU6 A;  3QJ3 A;  5K16 A;  2E03 A;  4P6E A;  3F75 A;  5JH3 A;  3B79 A;  3P5U A;  1MDW A;  2ARY A;  4CZW A;  2DCB A;  2FE8 A;  2XU5 A;  3V6E A;  3O0U A;  1CPJ A;  3U8E A;  1AEC A;  1NB5 A;  4BS6 A;  3KW9 A;  5KO3 A;  2J7Q A;  4D8E A;  2AUZ A;  1NLJ A;  1GCB A;  2AVW A;  1PCI A;  1EWL A;  1YK7 A;  8PCH A;  3CBJ A;  4BOZ A;  2YJ9 A;  1AU0 A;  1YAL A;  3H7D A;  3W30 A;  1ZIV A;  2NQA A;  3BPM A;  4YVA A;  1VSN A;  1DEU A;  3WXE A;  1PVJ A;  1AU3 A;  4G54 A;  4W4U A;  3WXG A;  4YV8 A;  2R6N A;  3IMA A;  3QSD A;  4MZS A;  2PNS A;  2HH5 A;  3KKU A;  2PRE A;  4XR7 A;  3D6S A;  4DMX A;  3V6C A;  1CS8 A;  2DZY A;  2E00 A;  1PPN A;  1SP4 B;  3H89 A;  1NL6 A;  2IBI A;  1JQP A;  1NPZ A;  2CB5 A;  4RNA A;  2FYE A;  4FIP A;  4PP2 E;  1KHQ A;  4YYV A;  2YJB A;  2F7D A;  1PPD A;  1ME3 A; 
#chains in the Genus database with same CATH homology
 1Q6K A;  2B1M A;  2DCA A;  2F1G A;  1SNK A;  3CH3 X;  1AYV A;  1W5R A;  1IWD A;  2FT2 A;  4I04 A;  2DZZ A;  2JQG R;  1GX3 A;  1CVZ A;  4B55 A;  2G6D A;  2AYN A;  4BS5 A;  1BQI A;  3BOW A;  2AS8 A;  1AYW A;  2DC6 A;  4BGF A;  1CB5 A;  2DCD A;  2IPP B;  3TNX A;  4HWY A;  1E2T A;  5JA7 A;  3KWB X;  1EWO A;  4GUZ A;  4MZO A;  1YVB A;  1ATK A;  3H8B A;  3DF0 A;  2P7U A;  4PAD A;  1DF0 A;  1GEC E;  1EF7 A;  4KLB A;  4Q8H A;  1ME4 A;  1CTE A;  4YYR A;  4X6I A;  3USV A;  4AXM A;  3NHE A;  3OVZ A;  4I07 A;  4QRG A;  3BC3 A;  1PXV A;  1U9X A;  2WBF X;  1PPO A;  3N3K A;  2NQD B;  1ZCM A;  1PIP A;  3D9W A;  3HHI A;  5EGW A;  1PAD A;  1ICF A;  1U9V A;  1PE6 A;  4WA6 A;  1F2A A;  1TLO A;  3GCB A;  2ATO A;  2BDL A;  2FQ9 A;  2XU4 A;  3N4C A;  1F2C A;  3IOQ A;  5CVN B;  3MHS A;  3S3R A;  1QMY A;  4I05 A;  1FH0 A;  4FK5 A;  3RVV A;  4QRX A;  3PW3 A;  2PAD A;  1PPP A;  3HD3 A;  1CV8 A;  2BSZ A;  4CDC B;  3KWZ A;  3KFQ A;  3K9M A;  1U5I A;  4NV8 A;  1O0E A;  1AU4 A;  3BCN A;  1KHP A;  3P5X A;  2G8J A;  3PDF A;  3H6S A;  1QOL A;  3PNR A;  1EWM A;  3IUT A;  2YJ8 A;  2XU1 A;  4OEM A;  5A24 A;  3IHP A;  1A6R A;  1NQC A;  1BP4 A;  4PI3 A;  1U9W A;  1THE A;  5CVO B;  4BPV A;  1M6D A;  2YJ2 A;  2E01 A;  2AU1 A;  3MOR A;  2DC8 A;  3QT4 A;  4Q8G A;  3S3Q A;  1YT7 A;  4YYS A;  5FPW A;  2H7J A;  4YYQ A;  1KFU L;  1MHW A;  1F2B A;  1GLO A;  3K24 A;  1QDQ A;  3ERV A;  2O6X A;  2DCC A;  4BSQ A;  5CHV A;  1W4T A;  2ACT A;  2FTD A;  2BDZ A;  2GHU A;  2Y5B A;  4X6J A;  1PBH A;  3WXF A;  3MHH A;  4AXL A;  2OP3 A;  1XKG A;  4N79 A;  1Y4H A;  1MS6 A;  7PCK A;  2FO5 A;  3KX1 A;  3PBH A;  4W5C A;  1X9Y A;  3CH2 X;  2YJC A;  2VHS A;  2R9M A;  3CBK A;  4K7C A;  1F29 A;  1Y08 A;  1AIM A;  2B1N A;  2R9C A;  1CJL A;  3OVX A;  3P5W A;  4FJC A;  2G8E A;  2OUL A;  4YYW A;  2R9N A;  3H8C A;  2G7Y A;  2P0R A;  3I3T A;  1VJV A;  1QXP A;  1YK8 A;  2AUX A;  1EWP A;  2CIO A;  4P6G A;  2AYO A;  4CDE B;  2Y6E A;  2NQI A;  4RY2 A;  2VFB A;  1ITO A;  2R9F A;  3LXS A;  3K8U A;  2R9O A;  4YYU A;  1CSB B;  1TL9 A;  2HHN A;  5EF4 A;  3IV2 A;  1AU2 A;  2GFO A;  5F02 A;  3N3G A;  3RVW A;  3BPF A;  3E1Z B;  1W6F A;  4BQV A;  3OF8 A;  2C0Y A;  1HUC B;  3HWN A;  3ZUA A;  3BWK A;  2DJG B;  6PAD A;  2FRQ A;  1U9Q X;  1GMY A;  1STF E;  3M99 A;  5CHT A;  2E02 A;  1BY8 A;  3OIS A;  3KSE A;  1AYU A;  1NB3 A;  3LFY A;  3MTN A;  3I06 A;  3F5V A;  2DC9 A;  4W5B A;  4CDD B;  3RVX A;  3O1G A;  2FRA A;  2JQF R;  2XU3 A;  4DMY A;  3IEJ A;  2HD5 A;  3HHA A;  2AIM A;  4XUI A;  4QH6 A;  2VFC A;  2VHF A;  4N8W A;  2DC7 A;  4MSX A;  1K3B B;  1S4V A;  2P86 A;  4PP1 A;  5PAD A;  1MIR A;  4OEL A;  2OZ2 A;  5J94 A;  1MEG A;  4CDF B;  1CQD A;  2HXZ A;  1BGO A;  3OF9 A;  4ZUX U;  2DJF B;  2FUD A;  4QRV A;  1KFX L;  4X6H A;  3C9E A;  4N4Z A;  2NQG A;  5CVM A;  1POP A;  9PAP A;  3AI8 A;  2PBH A;  4QBB A;  1MEM A;  1KXR A;  3P5V A;  1TU6 A;  3QJ3 A;  5K16 A;  2E03 A;  4P6E A;  3F75 A;  4C5P A;  5JH3 A;  3B79 A;  3P5U A;  1MDW A;  2ARY A;  4CZW A;  2DCB A;  2XU5 A;  3V6E A;  3O0U A;  1CPJ A;  3U8E A;  1AEC A;  3LTW A;  1NB5 A;  4BS6 A;  3KW9 A;  2AUZ A;  1NLJ A;  1GCB A;  2AVW A;  1PCI A;  1EWL A;  1YK7 A;  8PCH A;  3CBJ A;  2YJ9 A;  1AU0 A;  1YAL A;  4NV7 A;  3H7D A;  1ZIV A;  2NQA A;  3BPM A;  4YVA A;  1VSN A;  1DEU A;  3WXE A;  1AU3 A;  4G54 A;  4W4U A;  3WXG A;  4YV8 A;  2R6N A;  3IMA A;  3QSD A;  4MZS A;  2PNS A;  2HH5 A;  3KKU A;  2PRE A;  4XR7 A;  3D6S A;  4DMX A;  3V6C A;  1CS8 A;  2DZY A;  2E00 A;  1PPN A;  1SP4 B;  3H89 A;  1NL6 A;  2IBI A;  1JQP A;  1NPZ A;  2CB5 A;  2FYE A;  4FIP A;  4PP2 E;  1KHQ A;  4YYV A;  2YJB A;  2F7D A;  1PPD A;  1ME3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...