2C0YA

The crystal structure of a cys25ala mutant of human procathepsin s
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
314
structure length
308
Chain Sequence
LHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYILPDSVDWREKGCVTEVKYQGSCGAAWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of a Cys25 -> Ala Mutant of Human Procathepsin S Elucidates Enzyme-Prosequence Interactions.
pubmed doi rcsb
molecule keywords PROCATHEPSIN S
molecule tags Hydrolase
source organism Homo sapiens
total genus 104
structure length 308
sequence length 314
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2005-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08246 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2c0yA00
2DCDA 4QRVA 4CDCB 3IMAA 4CDEB 1QMYA 2E00A 2XU5A 2B1MA 4P6EA 3OF8A 1ZIVA 1PPDA 4AXMA 2DC8A 1VJVA 2R9MA 1KFXL 1POPA 4BS5A 3ERVA 2HXZA 3O1GA 2PNSA 2C0YA 4OEMA 2R9CA 2WBFX 1PBHA 4XUIA 2Y6EA 1CVZA 5EGWA 5JH3A 3HWNA 3H7DA 3H6SA 3KW9A 3RVWA 3MORA 1MDWA 4FJCA 3PDFA 2YJBA 3IEJA 3DF0A 3D6SA 1U9XA 3OISA 7PCKA 3WXFA 2DC9A 3PBHA 2PADA 3B79A 1TU6A 4DMYA 3K24A 1AECA 1S4VA 1SNKA 2AVWA 4YYRA 2DJFB 4CDFB 3LFYA 2NQDB 1PIPA 3IOQA 2YJCA 4W5BA 1ITOA 2OZ2A 1F2CA 4N79A 1ZCMA 4CZWA 5JA7A 2P86A 2XU3A 3C9EA 4K7CA 1F29A 5J94A 2JQFR 4BPVA 3N3KA 5CVOB 2YJ2A 4I04A 4N4ZA 1Y4HA 4PP2E 1CQDA 3V6CA 3KKUA 4W4UA 4QBBA 1U5IA 1EWLA 3CH3X 2FO5A 1AU3A 3BCNA 2ARYA 2DCAA 3WXEA 1CTEA 2DJGB 1BY8A 1HUCB 2PREA 3S3RA 1X9YA 4N8WA 1F2AA 2O6XA 2BDLA 4G54A 2YJ8A 4PADA 1IWDA 1PADA 4AXLA 2BDZA 1KHPA 4BQVA 3BWKA 4BS6A 3GCBA 6PADA 3M99A 3OVZA 3V6EA 4YV8A 1YALA 1CS8A 4Q8HA 2Y5BA 2P7UA 1YVBA 4KLBA 4WA6A 4I07A 3PNRA 3I3TA 1SP4B 4X6HA 3CBJA 1AYWA 1CJLA 1BGOA 2P0RA 1CV8A 4Q8GA 3HHAA 3WXGA 1MEGA 4YYVA 5F02A 1NB5A 1KHQA 3IHPA 2G6DA 3K9MA 3F75A 1MHWA 2VHSA 2OP3A 4X6IA 3RVXA 1FH0A 2HHNA 3PW3A 2F1GA 2AYNA 2HD5A 4W5CA 4ZUXU 4YYSA 2FTDA 1Q6KA 4I05A 2H7JA 9PAPA 1PE6A 2NQGA 2ACTA 2DC6A 1AYVA 3K8UA 2G8JA 2XU1A 3BC3A 1YK8A 3QSDA 2FRQA 1BQIA 3LXSA 1ME4A 3IV2A 4PI3A 5CHTA 5CVMA 4YYUA 1K3BB 3RVVA 3O0UA 2CIOA 2AS8A 3BPMA 1U9WA 1TL9A 5CVNB 2DC7A 2CB5A 1EWMA 2JQGR 3I06A 3MHSA 2NQAA 1DEUA 2F7DA 1AIMA 4OELA 2YJ9A 4PP1A 1GECE 2G7YA 3KWZA 1PXVA 3N4CA 1JQPA 4BSQA 2AIMA 1PPOA 1TLOA 2AYOA 3ZUAA 3U8EA 2R9NA 2FRAA 1AU2A 3QT4A 2FYEA 3MHHA 1GCBA 4QH6A 3S3QA 3P5VA 3H89A 3OF9A 2R6NA 1BP4A 5PADA 3TNXA 2IPPB 1QDQA 2GHUA 1QOLA 3IUTA 1M6DA 4XR7A 1EWPA 3HD3A 1O0EA 4DMXA 5FPWA 2E02A 1KXRA 2AU1A 1NLJA 2GFOA 3USVA 3NHEA 2OULA 1PPPA 1DF0A 1ICFA 2FT2A 1Y08A 4FIPA 2DCBA 2VHFA 1U9VA 1EF7A 1U9QX 2B1NA 4MZOA 8PCHA 2E01A 4YYWA 1ATKA 3H8CA 4HWYA 1NL6A 1NPZA 2HH5A 3KSEA 4RY2A 1GMYA 1PCIA 2DZZA 1MS6A 5CHVA 1STFE 2E03A 1ME3A 1VSNA 3BOWA 1A6RA 1YK7A 1THEA 4YYQA 3E1ZB 4P6GA 2XU4A 3BPFA 4MSXA 2FQ9A 4X6JA 2DCCA 1GLOA 3QJ3A 3N3GA 3CH2X 5EF4A 5A24A 3KX1A 1MIRA 4CDDB 3P5UA 1CPJA 1F2BA 4YVAA 3HHIA 3KWBX 2R9FA 2DZYA 1QXPA 2R9OA 1EWOA 3H8BA 2AUXA 1NB3A 5K16A 2G8EA 2IBIA 1YT7A 1XKGA 1NQCA 3P5XA 4MZSA 1AU0A 1CB5A 1CSBB 2ATOA 4QRXA 1AU4A 2AUZA 2PBHA 3AI8A 3CBKA 3MTNA 2FUDA 3KFQA 1PPNA 3OVXA 3F5VA 1AYUA 4QRGA 1KFUL 4FK5A 3P5WA 1MEMA 2NQIA
chains in the Genus database with same CATH superfamily
2DCDA 3OQCA 4QRVA 4CDCB 3IMAA 4CDEB 1QMYA 2E00A 2XU5A 2B1MA 4P6EA 3OF8A 1ZIVA 1PPDA 4AXMA 2DC8A 1VJVA 2R9MA 2FE8A 1KFXL 1POPA 4BS5A 3ERVA 2JTCA 2HXZA 3PT2A 3O1GA 2PNSA 2C0YA 4OEMA 4M0WA 2R9CA 2WBFX 3BBAA 1PBHA 4XUIA 2Y6EA 1CVZA 5EGWA 5JH3A 3HWNA 3H7DA 2BU3A 3H6SA 3KW9A 3RVWA 3MORA 1MDWA 4FJCA 3PDFA 2YJBA 3IEJA 3DF0A 3D6SA 1U9XA 4REZA 3OISA 7PCKA 3MJ5A 3WXFA 2DC9A 3PBHA 4BOQA 2PADA 3B79A 1TU6A 3W31A 3BY4A 4DMYA 5EZSA 3K24A 1AECA 1S4VA 1SNKA 4D8EA 2AVWA 3RNVA 4YYRA 2DJFB 4CDFB 3LFYA 2NQDB 1PIPA 3IOQA 2YJCA 4W5BA 1ITOA 4BOUA 2OZ2A 1F2CA 4N79A 1ZCMA 4CZWA 5JA7A 2P86A 2XU3A 3C9EA 4K7CA 4A5UA 1F29A 5J94A 2JQFR 4BPVA 3N3KA 5CVOB 2YJ2A 4I04A 4GUAA 3BB7A 4N4ZA 1Y4HA 4PP2E 1CQDA 4RKXA 3V6CA 3KKUA 5JZEA 4W4UA 4QBBA 1U5IA 1EWLA 3CH3X 2FO5A 1AU3A 3BCNA 2ARYA 2DCAA 3WXEA 1CTEA 2DJGB 1BY8A 1HUCB 2PREA 3S3RA 4RNAA 1X9YA 4HXDB 4N8WA 2AGAA 1F2AA 2O6XA 2BDLA 3ZNHA 4BOZA 4G54A 2YJ8A 4PADA 1IWDA 1PADA 4AXLA 4RF0A 2BDZA 1KHPA 4BQVA 3BWKA 4BS6A 1YZBA 1PVJA 3GCBA 4BOPA 6PADA 3M99A 3OVZA 3TRKA 3V6EA 4YV8A 4OVZB 1YALA 1CS8A 4Q8HA 4PT5A 2Y5BA 2P7UA 1YVBA 4KLBA 4WA6A 4I07A 3PNRA 3I3TA 1SP4B 4X6HA 3CBJA 1AYWA 1CJLA 1BGOA 2P0RA 1CV8A 4Q8GA 3O65A 3HHAA 3WXGA 1MEGA 4YYVA 4D8BA 5F02A 4XZXA 4D8IA 1NB5A 1KHQA 2UZJA 3IHPA 3PHUA 4RF1A 2G6DA 3K9MA 3E9SA 3F75A 1MHWA 2J7QC 2VHSA 2OP3A 4X6IA 3RVXA 1FH0A 4WURA 2HHNA 3PW3A 2F1GA 2AYNA 2HD5A 4W5CA 4ZUXU 4YYSA 2FTDA 1Q6KA 4I05A 2H7JA 9PAPA 4ZTBA 1PE6A 2NQGA 2ACTA 2DC6A 1AYVA 3K8UA 3W30A 2G8JA 2XU1A 3BC3A 1YK8A 3QSDA 3B21A 2FRQA 1BQIA 3LXSA 1ME4A 3IV2A 4PI3A 5CHTA 5CVMA 4YYUA 1K3BB 3RVVA 3O0UA 2CIOA 2AS8A 3BPMA 1U9WA 3PSEA 1TL9A 5CVNB 2DC7A 3IFUA 2CB5A 1EWMA 2JQGR 3I06A 3MHSA 2NQAA 1DEUA 2F7DA 1AIMA 4OELA 4OVZA 2YJ9A 4PP1A 1GECE 2G7YA 3KWZA 1PXVA 3N4CA 1JQPA 4BSQA 3C0RA 1DKIA 2AIMA 1PPOA 1TLOA 2AYOA 3ZUAA 3U8EA 2R9NA 2FRAA 1AU2A 3QT4A 2FYEA 3PHXA 3MHHA 1GCBA 4QH6A 3S3QA 4BOSA 3P5VA 3H89A 3OF9A 2R6NA 1BP4A 5PADA 3TNXA 2IPPB 1QDQA 2GHUA 1QOLA 3IUTA 1M6DA 4MI7A 4XR7A 1EWPA 3HD3A 1O0EA 4DMXA 5FPWA 2E02A 1KXRA 2AU1A 3TMPA 4IP3A 5KO3A 1NLJA 2GFOA 3USVA 3NHEA 2OULA 1PPPA 1DF0A 1ICFA 2FT2A 1Y08A 4FIPA 4OW0A 2DCBA 2BTWB 2VHFA 1U9VA 1EF7A 1U9QX 2B1NA 4MZOA 4MM3B 8PCHA 2E01A 4YYWA 1ATKA 3PRPA 3MTVA 3H8CA 4HWYA 1NL6A 1NPZA 2HH5A 3MP2A 3KSEA 4RY2A 1GMYA 1PCIA 2DZZA 1MS6A 5CHVA 1STFE 2E03A 1ME3A 1VSNA 3BOWA 1A6RA 3PHWA 1YK7A 1THEA 4YYQA 4R3DA 3E1ZB 4P6GA 2XU4A 3BPFA 2HWKA 4MSXA 2FQ9A 4X6JA 2DCCA 1GLOA 3QJ3A 4IUMA 2JRIA 3N3GA 2J7QA 3CH2X 5EF4A 5A24A 3KX1A 1MIRA 2Z84A 4CDDB 3P5UA 1CPJA 1F2BA 4YVAA 3HHIA 3KWBX 2R9FA 4P16A 5E6JA 2DZYA 1QXPA 2R9OA 1EWOA 3H8BA 2AUXA 1NB3A 5K16A 2G8EA 2IBIA 1YT7A 1XKGA 2DOSA 1NQCA 3P5XA 4MZSA 1AU0A 1CB5A 3PRMA 1CSBB 2ATOA 2PBHA 1AU4A 2AUZA 3AI8A 4QRXA 3CBKA 3MTNA 2FUDA 3KFQA 1PPNA 3OVXA 1UKFA 3F5VA 1AYUA 4QRGA 1KFUL 5EZQA 2BTWA 4FK5A 3P5WA 1MEMA 2NQIA
chains in the Genus database with same CATH topology
2DCDA 4QRVA 4CDCB 3IMAA 4CDEB 1QMYA 2E00A 2XU5A 2B1MA 4P6EA 3OF8A 1ZIVA 1PPDA 4AXMA 1W5RA 2DC8A 1VJVA 2R9MA 1KFXL 1POPA 4BS5A 3ERVA 2HXZA 3O1GA 2PNSA 2C0YA 4OEMA 2R9CA 1E2TA 2WBFX 1PBHA 4XUIA 2Y6EA 1CVZA 5EGWA 5JH3A 3HWNA 3H7DA 3H6SA 3KW9A 3RVWA 3MORA 1MDWA 4FJCA 3PDFA 2YJBA 3IEJA 3DF0A 4NV8A 3D6SA 1U9XA 3OISA 7PCKA 3WXFA 2DC9A 3PBHA 2PADA 3B79A 1TU6A 4B55A 4DMYA 3K24A 1AECA 1S4VA 1SNKA 2AVWA 4YYRA 2DJFB 4CDFB 3LFYA 2NQDB 1PIPA 3IOQA 2YJCA 4W5BA 1ITOA 2OZ2A 1F2CA 4N79A 1ZCMA 4CZWA 5JA7A 2P86A 2XU3A 3C9EA 4K7CA 1F29A 5J94A 2JQFR 4BPVA 3N3KA 5CVOB 2YJ2A 4I04A 4N4ZA 1Y4HA 4PP2E 1CQDA 3V6CA 3KKUA 4W4UA 4QBBA 1U5IA 1EWLA 3LTWA 3CH3X 2FO5A 1AU3A 3BCNA 2ARYA 2DCAA 3WXEA 1CTEA 2DJGB 1BY8A 1HUCB 2PREA 3S3RA 1X9YA 4N8WA 2VFBA 4GUZA 1F2AA 2O6XA 2BDLA 4G54A 2YJ8A 4PADA 1IWDA 1PADA 4AXLA 2BDZA 1KHPA 4BQVA 3BWKA 4BS6A 3GCBA 6PADA 3M99A 3OVZA 3V6EA 1W4TA 4YV8A 1YALA 1CS8A 4Q8HA 2Y5BA 2P7UA 1YVBA 4KLBA 4WA6A 4I07A 3PNRA 3I3TA 1SP4B 4X6HA 3CBJA 1AYWA 1CJLA 1BGOA 2P0RA 1CV8A 4Q8GA 3HHAA 3WXGA 1MEGA 4YYVA 1GX3A 5F02A 1NB5A 1KHQA 3IHPA 2G6DA 3K9MA 3F75A 1MHWA 2VHSA 2OP3A 4X6IA 3RVXA 1FH0A 2HHNA 3PW3A 2F1GA 2AYNA 2HD5A 4W5CA 4ZUXU 4YYSA 2FTDA 1Q6KA 4I05A 2H7JA 9PAPA 1PE6A 2NQGA 2ACTA 2DC6A 1AYVA 3K8UA 2G8JA 2XU1A 3BC3A 1YK8A 3QSDA 2FRQA 1BQIA 3LXSA 1ME4A 3IV2A 4PI3A 5CHTA 5CVMA 4YYUA 1K3BB 3RVVA 3O0UA 4NV7A 2CIOA 2AS8A 3BPMA 1U9WA 1TL9A 5CVNB 2DC7A 2CB5A 1EWMA 2JQGR 3I06A 3MHSA 2NQAA 1DEUA 2F7DA 1AIMA 4OELA 2YJ9A 4PP1A 1GECE 2G7YA 3KWZA 1PXVA 3N4CA 1JQPA 4BSQA 2AIMA 1PPOA 1TLOA 2AYOA 3ZUAA 3U8EA 2R9NA 2FRAA 1AU2A 3QT4A 2FYEA 3MHHA 1GCBA 4QH6A 3S3QA 3P5VA 3H89A 3OF9A 2R6NA 1BP4A 5PADA 3TNXA 2IPPB 1QDQA 2GHUA 1QOLA 3IUTA 1M6DA 4XR7A 1EWPA 3HD3A 1O0EA 4DMXA 2VFCA 5FPWA 2E02A 1KXRA 2AU1A 1NLJA 2GFOA 3USVA 3NHEA 2OULA 1PPPA 1DF0A 1ICFA 2FT2A 1Y08A 4FIPA 2DCBA 2VHFA 1W6FA 1U9VA 1EF7A 1U9QX 2B1NA 4MZOA 8PCHA 2E01A 4YYWA 1ATKA 3H8CA 4HWYA 4BGFA 1NL6A 1NPZA 2HH5A 3KSEA 4RY2A 1GMYA 1PCIA 2DZZA 1MS6A 5CHVA 1STFE 2E03A 1ME3A 1VSNA 3BOWA 1A6RA 1YK7A 1THEA 4YYQA 3E1ZB 4P6GA 2XU4A 3BPFA 4MSXA 2FQ9A 4X6JA 2DCCA 1GLOA 3QJ3A 2BSZA 3N3GA 3CH2X 5EF4A 5A24A 3KX1A 1MIRA 4CDDB 3P5UA 1CPJA 1F2BA 4YVAA 3HHIA 3KWBX 2R9FA 2DZYA 1QXPA 2R9OA 1EWOA 3H8BA 2AUXA 1NB3A 5K16A 2G8EA 2IBIA 1YT7A 4C5PA 1XKGA 1NQCA 3P5XA 4MZSA 1AU0A 1CB5A 3D9WA 1CSBB 2ATOA 2PBHA 1AU4A 2AUZA 3AI8A 4QRXA 3CBKA 3MTNA 2FUDA 3KFQA 1PPNA 3OVXA 3F5VA 1AYUA 4QRGA 1KFUL 4FK5A 3P5WA 1MEMA 2NQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DCD A;  4QRV A;  4CDC B;  3IMA A;  4CDE B;  1QMY A;  2E00 A;  2XU5 A;  2B1M A;  4P6E A;  3OF8 A;  1ZIV A;  1PPD A;  4AXM A;  2DC8 A;  1VJV A;  2R9M A;  1KFX L;  1POP A;  4BS5 A;  3ERV A;  2HXZ A;  3O1G A;  2PNS A;  2C0Y A;  4OEM A;  2R9C A;  2WBF X;  1PBH A;  4XUI A;  2Y6E A;  1CVZ A;  5EGW A;  5JH3 A;  3HWN A;  3H7D A;  3H6S A;  3KW9 A;  3RVW A;  3MOR A;  1MDW A;  4FJC A;  3PDF A;  2YJB A;  3IEJ A;  3DF0 A;  3D6S A;  1U9X A;  3OIS A;  7PCK A;  3WXF A;  2DC9 A;  3PBH A;  2PAD A;  3B79 A;  1TU6 A;  4DMY A;  3K24 A;  1AEC A;  1S4V A;  1SNK A;  2AVW A;  4YYR A;  2DJF B;  4CDF B;  3LFY A;  2NQD B;  1PIP A;  3IOQ A;  2YJC A;  4W5B A;  1ITO A;  2OZ2 A;  1F2C A;  4N79 A;  1ZCM A;  4CZW A;  5JA7 A;  2P86 A;  2XU3 A;  3C9E A;  4K7C A;  1F29 A;  5J94 A;  2JQF R;  4BPV A;  3N3K A;  5CVO B;  2YJ2 A;  4I04 A;  4N4Z A;  1Y4H A;  4PP2 E;  1CQD A;  3V6C A;  3KKU A;  4W4U A;  4QBB A;  1U5I A;  1EWL A;  3CH3 X;  2FO5 A;  1AU3 A;  3BCN A;  2ARY A;  2DCA A;  3WXE A;  1CTE A;  2DJG B;  1BY8 A;  1HUC B;  2PRE A;  3S3R A;  1X9Y A;  4N8W A;  1F2A A;  2O6X A;  2BDL A;  4G54 A;  2YJ8 A;  4PAD A;  1IWD A;  1PAD A;  4AXL A;  2BDZ A;  1KHP A;  4BQV A;  3BWK A;  4BS6 A;  3GCB A;  6PAD A;  3M99 A;  3OVZ A;  3V6E A;  4YV8 A;  1YAL A;  1CS8 A;  4Q8H A;  2Y5B A;  2P7U A;  1YVB A;  4KLB A;  4WA6 A;  4I07 A;  3PNR A;  3I3T A;  1SP4 B;  4X6H A;  3CBJ A;  1AYW A;  1CJL A;  1BGO A;  2P0R A;  1CV8 A;  4Q8G A;  3HHA A;  3WXG A;  1MEG A;  4YYV A;  5F02 A;  1NB5 A;  1KHQ A;  3IHP A;  2G6D A;  3K9M A;  3F75 A;  1MHW A;  2VHS A;  2OP3 A;  4X6I A;  3RVX A;  1FH0 A;  2HHN A;  3PW3 A;  2F1G A;  2AYN A;  2HD5 A;  4W5C A;  4ZUX U;  4YYS A;  2FTD A;  1Q6K A;  4I05 A;  2H7J A;  9PAP A;  1PE6 A;  2NQG A;  2ACT A;  2DC6 A;  1AYV A;  3K8U A;  2G8J A;  2XU1 A;  3BC3 A;  1YK8 A;  3QSD A;  2FRQ A;  1BQI A;  3LXS A;  1ME4 A;  3IV2 A;  4PI3 A;  5CHT A;  5CVM A;  4YYU A;  1K3B B;  3RVV A;  3O0U A;  2CIO A;  2AS8 A;  3BPM A;  1U9W A;  1TL9 A;  5CVN B;  2DC7 A;  2CB5 A;  1EWM A;  2JQG R;  3I06 A;  3MHS A;  2NQA A;  1DEU A;  2F7D A;  1AIM A;  4OEL A;  2YJ9 A;  4PP1 A;  1GEC E;  2G7Y A;  3KWZ A;  1PXV A;  3N4C A;  1JQP A;  4BSQ A;  2AIM A;  1PPO A;  1TLO A;  2AYO A;  3ZUA A;  3U8E A;  2R9N A;  2FRA A;  1AU2 A;  3QT4 A;  2FYE A;  3MHH A;  1GCB A;  4QH6 A;  3S3Q A;  3P5V A;  3H89 A;  3OF9 A;  2R6N A;  1BP4 A;  5PAD A;  3TNX A;  2IPP B;  1QDQ A;  2GHU A;  1QOL A;  3IUT A;  1M6D A;  4XR7 A;  1EWP A;  3HD3 A;  1O0E A;  4DMX A;  5FPW A;  2E02 A;  1KXR A;  2AU1 A;  1NLJ A;  2GFO A;  3USV A;  3NHE A;  2OUL A;  1PPP A;  1DF0 A;  1ICF A;  2FT2 A;  1Y08 A;  4FIP A;  2DCB A;  2VHF A;  1U9V A;  1EF7 A;  1U9Q X;  2B1N A;  4MZO A;  8PCH A;  2E01 A;  4YYW A;  1ATK A;  3H8C A;  4HWY A;  1NL6 A;  1NPZ A;  2HH5 A;  3KSE A;  4RY2 A;  1GMY A;  1PCI A;  2DZZ A;  1MS6 A;  5CHV A;  1STF E;  2E03 A;  1ME3 A;  1VSN A;  3BOW A;  1A6R A;  1YK7 A;  1THE A;  4YYQ A;  3E1Z B;  4P6G A;  2XU4 A;  3BPF A;  4MSX A;  2FQ9 A;  4X6J A;  2DCC A;  1GLO A;  3QJ3 A;  3N3G A;  3CH2 X;  5EF4 A;  5A24 A;  3KX1 A;  1MIR A;  4CDD B;  3P5U A;  1CPJ A;  1F2B A;  4YVA A;  3HHI A;  3KWB X;  2R9F A;  2DZY A;  1QXP A;  2R9O A;  1EWO A;  3H8B A;  2AUX A;  1NB3 A;  5K16 A;  2G8E A;  2IBI A;  1YT7 A;  1XKG A;  1NQC A;  3P5X A;  4MZS A;  1AU0 A;  1CB5 A;  1CSB B;  2ATO A;  4QRX A;  1AU4 A;  2AUZ A;  2PBH A;  3AI8 A;  3CBK A;  3MTN A;  2FUD A;  3KFQ A;  1PPN A;  3OVX A;  3F5V A;  1AYU A;  4QRG A;  1KFU L;  4FK5 A;  3P5W A;  1MEM A;  2NQI A; 
#chains in the Genus database with same CATH topology
 2DCD A;  3OQC A;  4QRV A;  4CDC B;  3IMA A;  4CDE B;  1QMY A;  2E00 A;  2XU5 A;  2B1M A;  4P6E A;  3OF8 A;  1ZIV A;  1PPD A;  4AXM A;  2DC8 A;  1VJV A;  2R9M A;  2FE8 A;  1KFX L;  1POP A;  4BS5 A;  3ERV A;  2JTC A;  2HXZ A;  3PT2 A;  3O1G A;  2PNS A;  2C0Y A;  4OEM A;  4M0W A;  2R9C A;  2WBF X;  3BBA A;  1PBH A;  4XUI A;  2Y6E A;  1CVZ A;  5EGW A;  5JH3 A;  3HWN A;  3H7D A;  2BU3 A;  3H6S A;  3KW9 A;  3RVW A;  3MOR A;  1MDW A;  4FJC A;  3PDF A;  2YJB A;  3IEJ A;  3DF0 A;  3D6S A;  1U9X A;  4REZ A;  3OIS A;  7PCK A;  3MJ5 A;  3WXF A;  2DC9 A;  3PBH A;  4BOQ A;  2PAD A;  3B79 A;  1TU6 A;  3W31 A;  3BY4 A;  4DMY A;  5EZS A;  3K24 A;  1AEC A;  1S4V A;  1SNK A;  4D8E A;  2AVW A;  3RNV A;  4YYR A;  2DJF B;  4CDF B;  3LFY A;  2NQD B;  1PIP A;  3IOQ A;  2YJC A;  4W5B A;  1ITO A;  4BOU A;  2OZ2 A;  1F2C A;  4N79 A;  1ZCM A;  4CZW A;  5JA7 A;  2P86 A;  2XU3 A;  3C9E A;  4K7C A;  4A5U A;  1F29 A;  5J94 A;  2JQF R;  4BPV A;  3N3K A;  5CVO B;  2YJ2 A;  4I04 A;  4GUA A;  3BB7 A;  4N4Z A;  1Y4H A;  4PP2 E;  1CQD A;  4RKX A;  3V6C A;  3KKU A;  5JZE A;  4W4U A;  4QBB A;  1U5I A;  1EWL A;  3CH3 X;  2FO5 A;  1AU3 A;  3BCN A;  2ARY A;  2DCA A;  3WXE A;  1CTE A;  2DJG B;  1BY8 A;  1HUC B;  2PRE A;  3S3R A;  4RNA A;  1X9Y A;  4HXD B;  4N8W A;  2AGA A;  1F2A A;  2O6X A;  2BDL A;  3ZNH A;  4BOZ A;  4G54 A;  2YJ8 A;  4PAD A;  1IWD A;  1PAD A;  4AXL A;  4RF0 A;  2BDZ A;  1KHP A;  4BQV A;  3BWK A;  4BS6 A;  1YZB A;  1PVJ A;  3GCB A;  4BOP A;  6PAD A;  3M99 A;  3OVZ A;  3TRK A;  3V6E A;  4YV8 A;  4OVZ B;  1YAL A;  1CS8 A;  4Q8H A;  4PT5 A;  2Y5B A;  2P7U A;  1YVB A;  4KLB A;  4WA6 A;  4I07 A;  3PNR A;  3I3T A;  1SP4 B;  4X6H A;  3CBJ A;  1AYW A;  1CJL A;  1BGO A;  2P0R A;  1CV8 A;  4Q8G A;  3O65 A;  3HHA A;  3WXG A;  1MEG A;  4YYV A;  4D8B A;  5F02 A;  4XZX A;  4D8I A;  1NB5 A;  1KHQ A;  2UZJ A;  3IHP A;  3PHU A;  4RF1 A;  2G6D A;  3K9M A;  3E9S A;  3F75 A;  1MHW A;  2J7Q C;  2VHS A;  2OP3 A;  4X6I A;  3RVX A;  1FH0 A;  4WUR A;  2HHN A;  3PW3 A;  2F1G A;  2AYN A;  2HD5 A;  4W5C A;  4ZUX U;  4YYS A;  2FTD A;  1Q6K A;  4I05 A;  2H7J A;  9PAP A;  4ZTB A;  1PE6 A;  2NQG A;  2ACT A;  2DC6 A;  1AYV A;  3K8U A;  3W30 A;  2G8J A;  2XU1 A;  3BC3 A;  1YK8 A;  3QSD A;  3B21 A;  2FRQ A;  1BQI A;  3LXS A;  1ME4 A;  3IV2 A;  4PI3 A;  5CHT A;  5CVM A;  4YYU A;  1K3B B;  3RVV A;  3O0U A;  2CIO A;  2AS8 A;  3BPM A;  1U9W A;  3PSE A;  1TL9 A;  5CVN B;  2DC7 A;  3IFU A;  2CB5 A;  1EWM A;  2JQG R;  3I06 A;  3MHS A;  2NQA A;  1DEU A;  2F7D A;  1AIM A;  4OEL A;  4OVZ A;  2YJ9 A;  4PP1 A;  1GEC E;  2G7Y A;  3KWZ A;  1PXV A;  3N4C A;  1JQP A;  4BSQ A;  3C0R A;  1DKI A;  2AIM A;  1PPO A;  1TLO A;  2AYO A;  3ZUA A;  3U8E A;  2R9N A;  2FRA A;  1AU2 A;  3QT4 A;  2FYE A;  3PHX A;  3MHH A;  1GCB A;  4QH6 A;  3S3Q A;  4BOS A;  3P5V A;  3H89 A;  3OF9 A;  2R6N A;  1BP4 A;  5PAD A;  3TNX A;  2IPP B;  1QDQ A;  2GHU A;  1QOL A;  3IUT A;  1M6D A;  4MI7 A;  4XR7 A;  1EWP A;  3HD3 A;  1O0E A;  4DMX A;  5FPW A;  2E02 A;  1KXR A;  2AU1 A;  3TMP A;  4IP3 A;  5KO3 A;  1NLJ A;  2GFO A;  3USV A;  3NHE A;  2OUL A;  1PPP A;  1DF0 A;  1ICF A;  2FT2 A;  1Y08 A;  4FIP A;  4OW0 A;  2DCB A;  2BTW B;  2VHF A;  1U9V A;  1EF7 A;  1U9Q X;  2B1N A;  4MZO A;  4MM3 B;  8PCH A;  2E01 A;  4YYW A;  1ATK A;  3PRP A;  3MTV A;  3H8C A;  4HWY A;  1NL6 A;  1NPZ A;  2HH5 A;  3MP2 A;  3KSE A;  4RY2 A;  1GMY A;  1PCI A;  2DZZ A;  1MS6 A;  5CHV A;  1STF E;  2E03 A;  1ME3 A;  1VSN A;  3BOW A;  1A6R A;  3PHW A;  1YK7 A;  1THE A;  4YYQ A;  4R3D A;  3E1Z B;  4P6G A;  2XU4 A;  3BPF A;  2HWK A;  4MSX A;  2FQ9 A;  4X6J A;  2DCC A;  1GLO A;  3QJ3 A;  4IUM A;  2JRI A;  3N3G A;  2J7Q A;  3CH2 X;  5EF4 A;  5A24 A;  3KX1 A;  1MIR A;  2Z84 A;  4CDD B;  3P5U A;  1CPJ A;  1F2B A;  4YVA A;  3HHI A;  3KWB X;  2R9F A;  4P16 A;  5E6J A;  2DZY A;  1QXP A;  2R9O A;  1EWO A;  3H8B A;  2AUX A;  1NB3 A;  5K16 A;  2G8E A;  2IBI A;  1YT7 A;  1XKG A;  2DOS A;  1NQC A;  3P5X A;  4MZS A;  1AU0 A;  1CB5 A;  3PRM A;  1CSB B;  2ATO A;  2PBH A;  1AU4 A;  2AUZ A;  3AI8 A;  4QRX A;  3CBK A;  3MTN A;  2FUD A;  3KFQ A;  1PPN A;  3OVX A;  1UKF A;  3F5V A;  1AYU A;  4QRG A;  1KFU L;  5EZQ A;  2BTW A;  4FK5 A;  3P5W A;  1MEM A;  2NQI A; 
#chains in the Genus database with same CATH homology
 2DCD A;  4QRV A;  4CDC B;  3IMA A;  4CDE B;  1QMY A;  2E00 A;  2XU5 A;  2B1M A;  4P6E A;  3OF8 A;  1ZIV A;  1PPD A;  4AXM A;  1W5R A;  2DC8 A;  1VJV A;  2R9M A;  1KFX L;  1POP A;  4BS5 A;  3ERV A;  2HXZ A;  3O1G A;  2PNS A;  2C0Y A;  4OEM A;  2R9C A;  1E2T A;  2WBF X;  1PBH A;  4XUI A;  2Y6E A;  1CVZ A;  5EGW A;  5JH3 A;  3HWN A;  3H7D A;  3H6S A;  3KW9 A;  3RVW A;  3MOR A;  1MDW A;  4FJC A;  3PDF A;  2YJB A;  3IEJ A;  3DF0 A;  4NV8 A;  3D6S A;  1U9X A;  3OIS A;  7PCK A;  3WXF A;  2DC9 A;  3PBH A;  2PAD A;  3B79 A;  1TU6 A;  4B55 A;  4DMY A;  3K24 A;  1AEC A;  1S4V A;  1SNK A;  2AVW A;  4YYR A;  2DJF B;  4CDF B;  3LFY A;  2NQD B;  1PIP A;  3IOQ A;  2YJC A;  4W5B A;  1ITO A;  2OZ2 A;  1F2C A;  4N79 A;  1ZCM A;  4CZW A;  5JA7 A;  2P86 A;  2XU3 A;  3C9E A;  4K7C A;  1F29 A;  5J94 A;  2JQF R;  4BPV A;  3N3K A;  5CVO B;  2YJ2 A;  4I04 A;  4N4Z A;  1Y4H A;  4PP2 E;  1CQD A;  3V6C A;  3KKU A;  4W4U A;  4QBB A;  1U5I A;  1EWL A;  3LTW A;  3CH3 X;  2FO5 A;  1AU3 A;  3BCN A;  2ARY A;  2DCA A;  3WXE A;  1CTE A;  2DJG B;  1BY8 A;  1HUC B;  2PRE A;  3S3R A;  1X9Y A;  4N8W A;  2VFB A;  4GUZ A;  1F2A A;  2O6X A;  2BDL A;  4G54 A;  2YJ8 A;  4PAD A;  1IWD A;  1PAD A;  4AXL A;  2BDZ A;  1KHP A;  4BQV A;  3BWK A;  4BS6 A;  3GCB A;  6PAD A;  3M99 A;  3OVZ A;  3V6E A;  1W4T A;  4YV8 A;  1YAL A;  1CS8 A;  4Q8H A;  2Y5B A;  2P7U A;  1YVB A;  4KLB A;  4WA6 A;  4I07 A;  3PNR A;  3I3T A;  1SP4 B;  4X6H A;  3CBJ A;  1AYW A;  1CJL A;  1BGO A;  2P0R A;  1CV8 A;  4Q8G A;  3HHA A;  3WXG A;  1MEG A;  4YYV A;  1GX3 A;  5F02 A;  1NB5 A;  1KHQ A;  3IHP A;  2G6D A;  3K9M A;  3F75 A;  1MHW A;  2VHS A;  2OP3 A;  4X6I A;  3RVX A;  1FH0 A;  2HHN A;  3PW3 A;  2F1G A;  2AYN A;  2HD5 A;  4W5C A;  4ZUX U;  4YYS A;  2FTD A;  1Q6K A;  4I05 A;  2H7J A;  9PAP A;  1PE6 A;  2NQG A;  2ACT A;  2DC6 A;  1AYV A;  3K8U A;  2G8J A;  2XU1 A;  3BC3 A;  1YK8 A;  3QSD A;  2FRQ A;  1BQI A;  3LXS A;  1ME4 A;  3IV2 A;  4PI3 A;  5CHT A;  5CVM A;  4YYU A;  1K3B B;  3RVV A;  3O0U A;  4NV7 A;  2CIO A;  2AS8 A;  3BPM A;  1U9W A;  1TL9 A;  5CVN B;  2DC7 A;  2CB5 A;  1EWM A;  2JQG R;  3I06 A;  3MHS A;  2NQA A;  1DEU A;  2F7D A;  1AIM A;  4OEL A;  2YJ9 A;  4PP1 A;  1GEC E;  2G7Y A;  3KWZ A;  1PXV A;  3N4C A;  1JQP A;  4BSQ A;  2AIM A;  1PPO A;  1TLO A;  2AYO A;  3ZUA A;  3U8E A;  2R9N A;  2FRA A;  1AU2 A;  3QT4 A;  2FYE A;  3MHH A;  1GCB A;  4QH6 A;  3S3Q A;  3P5V A;  3H89 A;  3OF9 A;  2R6N A;  1BP4 A;  5PAD A;  3TNX A;  2IPP B;  1QDQ A;  2GHU A;  1QOL A;  3IUT A;  1M6D A;  4XR7 A;  1EWP A;  3HD3 A;  1O0E A;  4DMX A;  2VFC A;  5FPW A;  2E02 A;  1KXR A;  2AU1 A;  1NLJ A;  2GFO A;  3USV A;  3NHE A;  2OUL A;  1PPP A;  1DF0 A;  1ICF A;  2FT2 A;  1Y08 A;  4FIP A;  2DCB A;  2VHF A;  1W6F A;  1U9V A;  1EF7 A;  1U9Q X;  2B1N A;  4MZO A;  8PCH A;  2E01 A;  4YYW A;  1ATK A;  3H8C A;  4HWY A;  4BGF A;  1NL6 A;  1NPZ A;  2HH5 A;  3KSE A;  4RY2 A;  1GMY A;  1PCI A;  2DZZ A;  1MS6 A;  5CHV A;  1STF E;  2E03 A;  1ME3 A;  1VSN A;  3BOW A;  1A6R A;  1YK7 A;  1THE A;  4YYQ A;  3E1Z B;  4P6G A;  2XU4 A;  3BPF A;  4MSX A;  2FQ9 A;  4X6J A;  2DCC A;  1GLO A;  3QJ3 A;  2BSZ A;  3N3G A;  3CH2 X;  5EF4 A;  5A24 A;  3KX1 A;  1MIR A;  4CDD B;  3P5U A;  1CPJ A;  1F2B A;  4YVA A;  3HHI A;  3KWB X;  2R9F A;  2DZY A;  1QXP A;  2R9O A;  1EWO A;  3H8B A;  2AUX A;  1NB3 A;  5K16 A;  2G8E A;  2IBI A;  1YT7 A;  4C5P A;  1XKG A;  1NQC A;  3P5X A;  4MZS A;  1AU0 A;  1CB5 A;  3D9W A;  1CSB B;  2ATO A;  2PBH A;  1AU4 A;  2AUZ A;  3AI8 A;  4QRX A;  3CBK A;  3MTN A;  2FUD A;  3KFQ A;  1PPN A;  3OVX A;  3F5V A;  1AYU A;  4QRG A;  1KFU L;  4FK5 A;  3P5W A;  1MEM A;  2NQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...