2Y6EA

Structure of the d1d2 domain of usp4, the conserved catalytic domain
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
357
structure length
336
Chain Sequence
IQPGLCGLGNLGNTFMNSALQCLSNTAPLTDYFLKDEYEAEINRDNPLGMKGEIAEAYAELIKQMWSGRDAHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLELKDANGRPDAVVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLPLPLTVALRDCIELFTTMETLGEDPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWRDKLDTVVEFPIRGLNMSEFVCNLSARPYVYDLIAVSNHYGAMGVGHYTAYAKNKLNGKWYYFDDSNVSLASEDQIVTKAAYVLFYQRRDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 4
publication title The Dusp-Ubl Domain of Usp4 Enhances its Catalytic Efficiency by Promoting Ubiquitin Exchange.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 104
structure length 336
sequence length 357
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2y6eA00
3LFYA 3WXEA 1QMYA 3OVZA 2WBFX 1AYWA 1O0EA 4P6GA 3HD3A 2R9OA 2P7UA 1GCBA 1U9WA 1AU0A 1TU6A 3F5VA 2FTDA 2OP3A 3S3QA 1IWDA 4P6EA 4CDCB 2DC6A 1DEUA 5CHTA 4I05A 4CDFB 2DCDA 1VJVA 2E01A 4AXMA 2AU1A 4QRVA 4BPVA 4RY2A 3PNRA 1QXPA 2DCAA 1PPNA 1U9QX 4QBBA 2YJBA 2B1NA 5F02A 1F2CA 2JQFR 5FPWA 3D6SA 1CSBB 1AU3A 4YVAA 1ZIVA 1MEMA 2BDLA 3H8CA 1KFXL 1Y08A 2AIMA 3WXGA 2YJ2A 2DCCA 1PADA 1TL9A 1CJLA 1MEGA 4YYSA 1PPOA 2YJ8A 2XU5A 1EWOA 3USVA 4YYRA 4BS5A 1SP4B 4W4UA 3IMAA 3TNXA 4DMXA 2YJ9A 1EWLA 3PBHA 1GECE 1AECA 4QRGA 3O0UA 4YYVA 1BP4A 4MZOA 3BWKA 4XUIA 2DC9A 4PP1A 3QT4A 1ME3A 4FJCA 3NHEA 1BY8A 3K9MA 3K24A 1GLOA 1TLOA 2AUZA 3C9EA 1PPPA 2FO5A 3P5XA 2AVWA 3N3KA 3K8UA 4YYUA 1EF7A 3CH2X 2FRAA 3H8BA 4Q8HA 2NQGA 8PCHA 3ZUAA 2HHNA 4QRXA 1K3BB 3CBKA 2F7DA 3GCBA 4Q8GA 2E00A 4PP2E 2NQAA 3DF0A 2DZYA 5EF4A 2P86A 1NB5A 6PADA 5CVMA 4FK5A 1U9VA 2FUDA 1THEA 2XU1A 3MTNA 1CPJA 1CTEA 3IOQA 4I07A 4G54A 2DJGB 1F2AA 2XU3A 3N4CA 4BQVA 5CHVA 2R9NA 2C0YA 3IHPA 1AIMA 4X6JA 2Y6EA 1STFE 1JQPA 1U5IA 2NQDB 3N3GA 2FYEA 2GHUA 3RVVA 2PADA 2G7YA 4YV8A 4N79A 2R9CA 1YVBA 1ICFA 2G8EA 5PADA 1EWMA 3HWNA 3CBJA 4X6HA 5JA7A 3I3TA 1PBHA 3QJ3A 1F2BA 1KXRA 3KKUA 1NPZA 1HUCB 1CB5A 1POPA 1YT7A 2OZ2A 3OVXA 4CDEB 3BPMA 1X9YA 9PAPA 4XR7A 4W5CA 3PW3A 2IPPB 1GMYA 1BGOA 4ZUXU 1CVZA 1MS6A 2H7JA 2B1MA 2CB5A 5A24A 2P0RA 2AS8A 1KHQA 1AU2A 4OELA 1AYVA 5CVOB 1NLJA 4MSXA 3PDFA 1S4VA 3H89A 1U9XA 4N8WA 1XKGA 3KWBX 1YK7A 1YALA 3BOWA 3KFQA 5CVNB 2FRQA 1ATKA 4AXLA 2VHSA 2GFOA 1NB3A 2AYNA 1MIRA 3BCNA 2R6NA 2R9FA 3AI8A 5JH3A 1ME4A 1PXVA 1YK8A 3MORA 2Y5BA 1NQCA 4FIPA 2HXZA 1ITOA 4OEMA 3ERVA 3MHHA 3KX1A 2HD5A 2JQGR 5K16A 4BSQA 1M6DA 2E02A 3MHSA 3BPFA 2XU4A 2FT2A 3KWZA 3RVXA 3BC3A 3OISA 2FQ9A 3E1ZB 4X6IA 2F1GA 3P5WA 3B79A 3IV2A 3IEJA 2G8JA 4PI3A 2E03A 1BQIA 3V6CA 2OULA 2G6DA 2PREA 4BS6A 3IUTA 1KHPA 1EWPA 1QOLA 1MDWA 4YYQA 1CS8A 2YJCA 4W5BA 5J94A 1SNKA 1MHWA 3S3RA 3V6EA 3QSDA 1F29A 3U8EA 5EGWA 1FH0A 2DC7A 2DJFB 3WXFA 3F75A 2NQIA 1Y4HA 3HHAA 4CDDB 4DMYA 2DC8A 1DF0A 3HHIA 2VHFA 1KFUL 1A6RA 2ARYA 1Q6KA 3KW9A 4KLBA 2PNSA 1CV8A 2IBIA 3O1GA 2BDZA 3KSEA 3RVWA 4N4ZA 1ZCMA 4WA6A 3CH3X 7PCKA 3P5UA 1PE6A 1NL6A 1CQDA 4CZWA 4QH6A 4YYWA 3H7DA 4PADA 2O6XA 2ATOA 2R9MA 2HH5A 3H6SA 4I04A 2CIOA 1QDQA 3M99A 1AYUA 2PBHA 4MZSA 3OF8A 3P5VA 2AYOA 2AUXA 3LXSA 2ACTA 1PIPA 1PPDA 1PCIA 2DZZA 3OF9A 4HWYA 3I06A 4K7CA 1VSNA 1AU4A 2DCBA
chains in the Genus database with same CATH superfamily
3LFYA 3WXEA 1QMYA 3OVZA 2WBFX 4IP3A 3PSEA 1AYWA 1O0EA 4P6GA 3HD3A 2R9OA 4P16A 2P7UA 1GCBA 1U9WA 1AU0A 1TU6A 3F5VA 2FTDA 2UZJA 2OP3A 3S3QA 1IWDA 1PVJA 4BOPA 4P6EA 4CDCB 2DC6A 4PT5A 1DEUA 5CHTA 4I05A 4CDFB 4GUAA 2DCDA 1VJVA 2E01A 4AXMA 2AU1A 4QRVA 4BPVA 4RY2A 3PNRA 1QXPA 2DCAA 1PPNA 5EZSA 1U9QX 4QBBA 3ZNHA 2YJBA 2B1NA 5F02A 1F2CA 2JQFR 5FPWA 2BTWB 3D6SA 1CSBB 1AU3A 4YVAA 1ZIVA 4RKXA 1MEMA 2BDLA 3H8CA 1KFXL 3OQCA 1Y08A 2AIMA 3WXGA 4IUMA 2YJ2A 2DCCA 1PADA 1TL9A 1CJLA 1MEGA 4YYSA 1PPOA 2YJ8A 4OVZA 2XU5A 1EWOA 3USVA 4YYRA 4BS5A 1SP4B 4W4UA 3IMAA 3TNXA 4DMXA 2YJ9A 1EWLA 3PBHA 1GECE 1AECA 4QRGA 3O0UA 4YYVA 1BP4A 4MZOA 3BWKA 4XUIA 2DC9A 4PP1A 3PHXA 3QT4A 1ME3A 3B21A 4FJCA 3NHEA 3K9MA 1BY8A 3K24A 1GLOA 2JTCA 1TLOA 2AUZA 3C9EA 1PPPA 2FO5A 3P5XA 2AVWA 3N3KA 3K8UA 4YYUA 1EF7A 3BY4A 5E6JA 3CH2X 2FRAA 3H8BA 4Q8HA 2NQGA 3BB7A 8PCHA 3ZUAA 2HHNA 4QRXA 1K3BB 3CBKA 2F7DA 3GCBA 4Q8GA 4WURA 1DKIA 2E00A 4M0WA 4PP2E 2NQAA 3DF0A 2DZYA 2FE8A 4R3DA 5EF4A 2P86A 1NB5A 3E9SA 6PADA 1UKFA 3O65A 5CVMA 4FK5A 1U9VA 2FUDA 1THEA 2AGAA 2XU1A 3MTNA 1CPJA 1CTEA 3IOQA 4I07A 4G54A 2DJGB 1F2AA 2XU3A 3N4CA 4BQVA 5CHVA 2R9NA 2C0YA 3IHPA 1AIMA 4X6JA 4MM3B 2Y6EA 1STFE 1JQPA 1U5IA 2NQDB 3N3GA 2FYEA 2GHUA 3RVVA 4D8BA 3MTVA 4RF0A 2PADA 2G7YA 4YV8A 4N79A 2R9CA 1YVBA 1ICFA 2G8EA 5PADA 1EWMA 2HWKA 3HWNA 3CBJA 4RF1A 4ZTBA 4X6HA 5JA7A 3I3TA 4OW0A 1YZBA 1PBHA 3QJ3A 1F2BA 1KXRA 4A5UA 3KKUA 4BOUA 1NPZA 1HUCB 1CB5A 1POPA 1YT7A 3TRKA 2OZ2A 3OVXA 4CDEB 3BPMA 1X9YA 9PAPA 4XR7A 4W5CA 2JRIA 3PW3A 2IPPB 1GMYA 1BGOA 3W31A 4ZUXU 1CVZA 1MS6A 2H7JA 2B1MA 2CB5A 5A24A 2P0RA 2AS8A 1KHQA 1AU2A 2DOSA 4OELA 1AYVA 5CVOB 1NLJA 4XZXA 4MSXA 3PDFA 3BBAA 2Z84A 1S4VA 3H89A 1U9XA 4N8WA 1XKGA 4BOSA 3KWBX 1YK7A 4BOZA 1YALA 3BOWA 3KFQA 5CVNB 2FRQA 1ATKA 4RNAA 4OVZB 4AXLA 2J7QA 2VHSA 2GFOA 3PHUA 1NB3A 2AYNA 1MIRA 3BCNA 2R6NA 2R9FA 4D8IA 3AI8A 5JH3A 1ME4A 3PRMA 1PXVA 1YK8A 3MORA 2Y5BA 1NQCA 4FIPA 2HXZA 1ITOA 3TMPA 4OEMA 3ERVA 3MHHA 3KX1A 2HD5A 2JQGR 3PRPA 5K16A 4BSQA 1M6DA 2J7QC 2E02A 3MHSA 3BPFA 2XU4A 2FT2A 3KWZA 3RVXA 3BC3A 3OISA 2FQ9A 3E1ZB 4X6IA 2F1GA 3P5WA 3IFUA 3B79A 3MJ5A 3IV2A 3IEJA 2G8JA 4PI3A 2E03A 1BQIA 3V6CA 2OULA 5EZQA 2G6DA 2PREA 4BS6A 3IUTA 1KHPA 1EWPA 1QOLA 1MDWA 4MI7A 1CS8A 4YYQA 2YJCA 4W5BA 5J94A 1SNKA 1MHWA 3S3RA 3V6EA 3QSDA 1F29A 3U8EA 5EGWA 1FH0A 2DC7A 2DJFB 3WXFA 3F75A 2NQIA 1Y4HA 3HHAA 3PT2A 4CDDB 4DMYA 2DC8A 1DF0A 3HHIA 2VHFA 4BOQA 1KFUL 1A6RA 2ARYA 4HXDB 1Q6KA 3PHWA 3RNVA 3KW9A 4KLBA 2PNSA 1CV8A 2IBIA 3O1GA 2BDZA 3KSEA 3RVWA 4N4ZA 1ZCMA 4WA6A 3CH3X 7PCKA 3P5UA 1PE6A 4REZA 1NL6A 1CQDA 4CZWA 3C0RA 4QH6A 3W30A 4YYWA 3H7DA 4PADA 2O6XA 2ATOA 2R9MA 2HH5A 3H6SA 4I04A 2CIOA 1QDQA 3M99A 1AYUA 2PBHA 4MZSA 4D8EA 3OF8A 3P5VA 2BTWA 2AYOA 2AUXA 3LXSA 2ACTA 5JZEA 2BU3A 1PIPA 1PPDA 1PCIA 2DZZA 3OF9A 4HWYA 3I06A 4K7CA 1VSNA 1AU4A 3MP2A 2DCBA 5KO3A
chains in the Genus database with same CATH topology
3LFYA 3WXEA 1QMYA 3OVZA 2WBFX 1AYWA 1O0EA 4P6GA 3HD3A 2R9OA 2P7UA 1GCBA 1U9WA 1AU0A 1TU6A 3F5VA 2FTDA 2OP3A 3S3QA 1IWDA 4P6EA 4CDCB 2DC6A 1DEUA 5CHTA 4I05A 4CDFB 2DCDA 1VJVA 2E01A 4AXMA 2AU1A 4QRVA 4BPVA 1E2TA 4RY2A 3PNRA 1QXPA 2DCAA 1PPNA 1U9QX 4QBBA 2YJBA 2B1NA 5F02A 1F2CA 2JQFR 5FPWA 3D6SA 4BGFA 1CSBB 1AU3A 4YVAA 1ZIVA 1MEMA 2BDLA 3H8CA 1KFXL 1Y08A 2AIMA 3WXGA 2YJ2A 2DCCA 1PADA 1TL9A 1CJLA 1MEGA 4YYSA 1PPOA 2YJ8A 2XU5A 1EWOA 3USVA 4YYRA 4BS5A 1SP4B 4W4UA 3IMAA 3TNXA 4DMXA 2YJ9A 1EWLA 3PBHA 1GECE 1AECA 4QRGA 3O0UA 4YYVA 1BP4A 4MZOA 3BWKA 4XUIA 2DC9A 4PP1A 4C5PA 3QT4A 1ME3A 4FJCA 3NHEA 1BY8A 3K9MA 3K24A 1GLOA 1TLOA 2AUZA 3C9EA 1PPPA 2FO5A 3P5XA 2AVWA 3N3KA 3K8UA 4YYUA 1EF7A 3CH2X 4NV7A 2FRAA 3H8BA 4Q8HA 2NQGA 8PCHA 3D9WA 3ZUAA 2HHNA 4QRXA 1K3BB 3CBKA 2F7DA 3GCBA 4Q8GA 2E00A 4PP2E 2NQAA 3DF0A 2DZYA 5EF4A 2P86A 1NB5A 6PADA 5CVMA 4FK5A 1U9VA 2FUDA 2VFCA 1THEA 2XU1A 3MTNA 1CPJA 1CTEA 3IOQA 4I07A 4G54A 2DJGB 1F2AA 2XU3A 3N4CA 4BQVA 5CHVA 2R9NA 1W6FA 2C0YA 3IHPA 1AIMA 4X6JA 2Y6EA 3LTWA 1STFE 1JQPA 1U5IA 2NQDB 3N3GA 2FYEA 2GHUA 1W4TA 3RVVA 2PADA 2G7YA 4YV8A 4N79A 2R9CA 1YVBA 1ICFA 2G8EA 2VFBA 5PADA 4B55A 1EWMA 3HWNA 3CBJA 4X6HA 5JA7A 3I3TA 1PBHA 3QJ3A 1F2BA 4GUZA 1KXRA 3KKUA 1NPZA 1HUCB 1CB5A 1POPA 1YT7A 2OZ2A 3OVXA 4CDEB 3BPMA 1X9YA 9PAPA 4XR7A 4W5CA 3PW3A 2IPPB 1GMYA 1BGOA 4ZUXU 1CVZA 1MS6A 2H7JA 2B1MA 2CB5A 5A24A 2P0RA 2AS8A 1KHQA 1AU2A 4OELA 1AYVA 5CVOB 1NLJA 4MSXA 3PDFA 1S4VA 4NV8A 3H89A 1U9XA 4N8WA 1XKGA 3KWBX 1YK7A 1YALA 3BOWA 3KFQA 5CVNB 2FRQA 1ATKA 4AXLA 2VHSA 2GFOA 1NB3A 2AYNA 1MIRA 3BCNA 2R6NA 2R9FA 3AI8A 5JH3A 1ME4A 1PXVA 1YK8A 3MORA 2Y5BA 1NQCA 4FIPA 2HXZA 1ITOA 4OEMA 3ERVA 3MHHA 3KX1A 2HD5A 2JQGR 5K16A 4BSQA 1M6DA 2E02A 3MHSA 3BPFA 2XU4A 2FT2A 3KWZA 3RVXA 3BC3A 3OISA 2FQ9A 3E1ZB 4X6IA 2F1GA 3P5WA 3B79A 3IV2A 3IEJA 2G8JA 4PI3A 2E03A 1BQIA 3V6CA 2OULA 2G6DA 2PREA 4BS6A 3IUTA 1KHPA 1EWPA 1QOLA 1MDWA 4YYQA 1CS8A 2YJCA 4W5BA 5J94A 1SNKA 1MHWA 3S3RA 3V6EA 3QSDA 1F29A 3U8EA 5EGWA 1FH0A 2DC7A 2DJFB 3WXFA 3F75A 2BSZA 2NQIA 1Y4HA 3HHAA 4CDDB 4DMYA 2DC8A 1DF0A 3HHIA 2VHFA 1KFUL 1A6RA 2ARYA 1Q6KA 1W5RA 3KW9A 4KLBA 2PNSA 1CV8A 2IBIA 3O1GA 2BDZA 3KSEA 3RVWA 4N4ZA 1ZCMA 4WA6A 3CH3X 7PCKA 3P5UA 1PE6A 1NL6A 1CQDA 4CZWA 4QH6A 4YYWA 3H7DA 4PADA 2O6XA 2ATOA 2R9MA 2HH5A 3H6SA 4I04A 2CIOA 1QDQA 3M99A 1AYUA 2PBHA 4MZSA 3OF8A 3P5VA 1GX3A 2AYOA 2AUXA 3LXSA 2ACTA 1PIPA 1PPDA 1PCIA 2DZZA 3OF9A 4HWYA 3I06A 4K7CA 1VSNA 1AU4A 2DCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LFY A;  3WXE A;  1QMY A;  3OVZ A;  2WBF X;  1AYW A;  1O0E A;  4P6G A;  3HD3 A;  2R9O A;  2P7U A;  1GCB A;  1U9W A;  1AU0 A;  1TU6 A;  3F5V A;  2FTD A;  2OP3 A;  3S3Q A;  1IWD A;  4P6E A;  4CDC B;  2DC6 A;  1DEU A;  5CHT A;  4I05 A;  4CDF B;  2DCD A;  1VJV A;  2E01 A;  4AXM A;  2AU1 A;  4QRV A;  4BPV A;  4RY2 A;  3PNR A;  1QXP A;  2DCA A;  1PPN A;  1U9Q X;  4QBB A;  2YJB A;  2B1N A;  5F02 A;  1F2C A;  2JQF R;  5FPW A;  3D6S A;  1CSB B;  1AU3 A;  4YVA A;  1ZIV A;  1MEM A;  2BDL A;  3H8C A;  1KFX L;  1Y08 A;  2AIM A;  3WXG A;  2YJ2 A;  2DCC A;  1PAD A;  1TL9 A;  1CJL A;  1MEG A;  4YYS A;  1PPO A;  2YJ8 A;  2XU5 A;  1EWO A;  3USV A;  4YYR A;  4BS5 A;  1SP4 B;  4W4U A;  3IMA A;  3TNX A;  4DMX A;  2YJ9 A;  1EWL A;  3PBH A;  1GEC E;  1AEC A;  4QRG A;  3O0U A;  4YYV A;  1BP4 A;  4MZO A;  3BWK A;  4XUI A;  2DC9 A;  4PP1 A;  3QT4 A;  1ME3 A;  4FJC A;  3NHE A;  1BY8 A;  3K9M A;  3K24 A;  1GLO A;  1TLO A;  2AUZ A;  3C9E A;  1PPP A;  2FO5 A;  3P5X A;  2AVW A;  3N3K A;  3K8U A;  4YYU A;  1EF7 A;  3CH2 X;  2FRA A;  3H8B A;  4Q8H A;  2NQG A;  8PCH A;  3ZUA A;  2HHN A;  4QRX A;  1K3B B;  3CBK A;  2F7D A;  3GCB A;  4Q8G A;  2E00 A;  4PP2 E;  2NQA A;  3DF0 A;  2DZY A;  5EF4 A;  2P86 A;  1NB5 A;  6PAD A;  5CVM A;  4FK5 A;  1U9V A;  2FUD A;  1THE A;  2XU1 A;  3MTN A;  1CPJ A;  1CTE A;  3IOQ A;  4I07 A;  4G54 A;  2DJG B;  1F2A A;  2XU3 A;  3N4C A;  4BQV A;  5CHV A;  2R9N A;  2C0Y A;  3IHP A;  1AIM A;  4X6J A;  2Y6E A;  1STF E;  1JQP A;  1U5I A;  2NQD B;  3N3G A;  2FYE A;  2GHU A;  3RVV A;  2PAD A;  2G7Y A;  4YV8 A;  4N79 A;  2R9C A;  1YVB A;  1ICF A;  2G8E A;  5PAD A;  1EWM A;  3HWN A;  3CBJ A;  4X6H A;  5JA7 A;  3I3T A;  1PBH A;  3QJ3 A;  1F2B A;  1KXR A;  3KKU A;  1NPZ A;  1HUC B;  1CB5 A;  1POP A;  1YT7 A;  2OZ2 A;  3OVX A;  4CDE B;  3BPM A;  1X9Y A;  9PAP A;  4XR7 A;  4W5C A;  3PW3 A;  2IPP B;  1GMY A;  1BGO A;  4ZUX U;  1CVZ A;  1MS6 A;  2H7J A;  2B1M A;  2CB5 A;  5A24 A;  2P0R A;  2AS8 A;  1KHQ A;  1AU2 A;  4OEL A;  1AYV A;  5CVO B;  1NLJ A;  4MSX A;  3PDF A;  1S4V A;  3H89 A;  1U9X A;  4N8W A;  1XKG A;  3KWB X;  1YK7 A;  1YAL A;  3BOW A;  3KFQ A;  5CVN B;  2FRQ A;  1ATK A;  4AXL A;  2VHS A;  2GFO A;  1NB3 A;  2AYN A;  1MIR A;  3BCN A;  2R6N A;  2R9F A;  3AI8 A;  5JH3 A;  1ME4 A;  1PXV A;  1YK8 A;  3MOR A;  2Y5B A;  1NQC A;  4FIP A;  2HXZ A;  1ITO A;  4OEM A;  3ERV A;  3MHH A;  3KX1 A;  2HD5 A;  2JQG R;  5K16 A;  4BSQ A;  1M6D A;  2E02 A;  3MHS A;  3BPF A;  2XU4 A;  2FT2 A;  3KWZ A;  3RVX A;  3BC3 A;  3OIS A;  2FQ9 A;  3E1Z B;  4X6I A;  2F1G A;  3P5W A;  3B79 A;  3IV2 A;  3IEJ A;  2G8J A;  4PI3 A;  2E03 A;  1BQI A;  3V6C A;  2OUL A;  2G6D A;  2PRE A;  4BS6 A;  3IUT A;  1KHP A;  1EWP A;  1QOL A;  1MDW A;  4YYQ A;  1CS8 A;  2YJC A;  4W5B A;  5J94 A;  1SNK A;  1MHW A;  3S3R A;  3V6E A;  3QSD A;  1F29 A;  3U8E A;  5EGW A;  1FH0 A;  2DC7 A;  2DJF B;  3WXF A;  3F75 A;  2NQI A;  1Y4H A;  3HHA A;  4CDD B;  4DMY A;  2DC8 A;  1DF0 A;  3HHI A;  2VHF A;  1KFU L;  1A6R A;  2ARY A;  1Q6K A;  3KW9 A;  4KLB A;  2PNS A;  1CV8 A;  2IBI A;  3O1G A;  2BDZ A;  3KSE A;  3RVW A;  4N4Z A;  1ZCM A;  4WA6 A;  3CH3 X;  7PCK A;  3P5U A;  1PE6 A;  1NL6 A;  1CQD A;  4CZW A;  4QH6 A;  4YYW A;  3H7D A;  4PAD A;  2O6X A;  2ATO A;  2R9M A;  2HH5 A;  3H6S A;  4I04 A;  2CIO A;  1QDQ A;  3M99 A;  1AYU A;  2PBH A;  4MZS A;  3OF8 A;  3P5V A;  2AYO A;  2AUX A;  3LXS A;  2ACT A;  1PIP A;  1PPD A;  1PCI A;  2DZZ A;  3OF9 A;  4HWY A;  3I06 A;  4K7C A;  1VSN A;  1AU4 A;  2DCB A; 
#chains in the Genus database with same CATH topology
 3LFY A;  3WXE A;  1QMY A;  3OVZ A;  2WBF X;  4IP3 A;  3PSE A;  1AYW A;  1O0E A;  4P6G A;  3HD3 A;  2R9O A;  4P16 A;  2P7U A;  1GCB A;  1U9W A;  1AU0 A;  1TU6 A;  3F5V A;  2FTD A;  2UZJ A;  2OP3 A;  3S3Q A;  1IWD A;  1PVJ A;  4BOP A;  4P6E A;  4CDC B;  2DC6 A;  4PT5 A;  1DEU A;  5CHT A;  4I05 A;  4CDF B;  4GUA A;  2DCD A;  1VJV A;  2E01 A;  4AXM A;  2AU1 A;  4QRV A;  4BPV A;  4RY2 A;  3PNR A;  1QXP A;  2DCA A;  1PPN A;  5EZS A;  1U9Q X;  4QBB A;  3ZNH A;  2YJB A;  2B1N A;  5F02 A;  1F2C A;  2JQF R;  5FPW A;  2BTW B;  3D6S A;  1CSB B;  1AU3 A;  4YVA A;  1ZIV A;  4RKX A;  1MEM A;  2BDL A;  3H8C A;  1KFX L;  3OQC A;  1Y08 A;  2AIM A;  3WXG A;  4IUM A;  2YJ2 A;  2DCC A;  1PAD A;  1TL9 A;  1CJL A;  1MEG A;  4YYS A;  1PPO A;  2YJ8 A;  4OVZ A;  2XU5 A;  1EWO A;  3USV A;  4YYR A;  4BS5 A;  1SP4 B;  4W4U A;  3IMA A;  3TNX A;  4DMX A;  2YJ9 A;  1EWL A;  3PBH A;  1GEC E;  1AEC A;  4QRG A;  3O0U A;  4YYV A;  1BP4 A;  4MZO A;  3BWK A;  4XUI A;  2DC9 A;  4PP1 A;  3PHX A;  3QT4 A;  1ME3 A;  3B21 A;  4FJC A;  3NHE A;  3K9M A;  1BY8 A;  3K24 A;  1GLO A;  2JTC A;  1TLO A;  2AUZ A;  3C9E A;  1PPP A;  2FO5 A;  3P5X A;  2AVW A;  3N3K A;  3K8U A;  4YYU A;  1EF7 A;  3BY4 A;  5E6J A;  3CH2 X;  2FRA A;  3H8B A;  4Q8H A;  2NQG A;  3BB7 A;  8PCH A;  3ZUA A;  2HHN A;  4QRX A;  1K3B B;  3CBK A;  2F7D A;  3GCB A;  4Q8G A;  4WUR A;  1DKI A;  2E00 A;  4M0W A;  4PP2 E;  2NQA A;  3DF0 A;  2DZY A;  2FE8 A;  4R3D A;  5EF4 A;  2P86 A;  1NB5 A;  3E9S A;  6PAD A;  1UKF A;  3O65 A;  5CVM A;  4FK5 A;  1U9V A;  2FUD A;  1THE A;  2AGA A;  2XU1 A;  3MTN A;  1CPJ A;  1CTE A;  3IOQ A;  4I07 A;  4G54 A;  2DJG B;  1F2A A;  2XU3 A;  3N4C A;  4BQV A;  5CHV A;  2R9N A;  2C0Y A;  3IHP A;  1AIM A;  4X6J A;  4MM3 B;  2Y6E A;  1STF E;  1JQP A;  1U5I A;  2NQD B;  3N3G A;  2FYE A;  2GHU A;  3RVV A;  4D8B A;  3MTV A;  4RF0 A;  2PAD A;  2G7Y A;  4YV8 A;  4N79 A;  2R9C A;  1YVB A;  1ICF A;  2G8E A;  5PAD A;  1EWM A;  2HWK A;  3HWN A;  3CBJ A;  4RF1 A;  4ZTB A;  4X6H A;  5JA7 A;  3I3T A;  4OW0 A;  1YZB A;  1PBH A;  3QJ3 A;  1F2B A;  1KXR A;  4A5U A;  3KKU A;  4BOU A;  1NPZ A;  1HUC B;  1CB5 A;  1POP A;  1YT7 A;  3TRK A;  2OZ2 A;  3OVX A;  4CDE B;  3BPM A;  1X9Y A;  9PAP A;  4XR7 A;  4W5C A;  2JRI A;  3PW3 A;  2IPP B;  1GMY A;  1BGO A;  3W31 A;  4ZUX U;  1CVZ A;  1MS6 A;  2H7J A;  2B1M A;  2CB5 A;  5A24 A;  2P0R A;  2AS8 A;  1KHQ A;  1AU2 A;  2DOS A;  4OEL A;  1AYV A;  5CVO B;  1NLJ A;  4XZX A;  4MSX A;  3PDF A;  3BBA A;  2Z84 A;  1S4V A;  3H89 A;  1U9X A;  4N8W A;  1XKG A;  4BOS A;  3KWB X;  1YK7 A;  4BOZ A;  1YAL A;  3BOW A;  3KFQ A;  5CVN B;  2FRQ A;  1ATK A;  4RNA A;  4OVZ B;  4AXL A;  2J7Q A;  2VHS A;  2GFO A;  3PHU A;  1NB3 A;  2AYN A;  1MIR A;  3BCN A;  2R6N A;  2R9F A;  4D8I A;  3AI8 A;  5JH3 A;  1ME4 A;  3PRM A;  1PXV A;  1YK8 A;  3MOR A;  2Y5B A;  1NQC A;  4FIP A;  2HXZ A;  1ITO A;  3TMP A;  4OEM A;  3ERV A;  3MHH A;  3KX1 A;  2HD5 A;  2JQG R;  3PRP A;  5K16 A;  4BSQ A;  1M6D A;  2J7Q C;  2E02 A;  3MHS A;  3BPF A;  2XU4 A;  2FT2 A;  3KWZ A;  3RVX A;  3BC3 A;  3OIS A;  2FQ9 A;  3E1Z B;  4X6I A;  2F1G A;  3P5W A;  3IFU A;  3B79 A;  3MJ5 A;  3IV2 A;  3IEJ A;  2G8J A;  4PI3 A;  2E03 A;  1BQI A;  3V6C A;  2OUL A;  5EZQ A;  2G6D A;  2PRE A;  4BS6 A;  3IUT A;  1KHP A;  1EWP A;  1QOL A;  1MDW A;  4MI7 A;  1CS8 A;  4YYQ A;  2YJC A;  4W5B A;  5J94 A;  1SNK A;  1MHW A;  3S3R A;  3V6E A;  3QSD A;  1F29 A;  3U8E A;  5EGW A;  1FH0 A;  2DC7 A;  2DJF B;  3WXF A;  3F75 A;  2NQI A;  1Y4H A;  3HHA A;  3PT2 A;  4CDD B;  4DMY A;  2DC8 A;  1DF0 A;  3HHI A;  2VHF A;  4BOQ A;  1KFU L;  1A6R A;  2ARY A;  4HXD B;  1Q6K A;  3PHW A;  3RNV A;  3KW9 A;  4KLB A;  2PNS A;  1CV8 A;  2IBI A;  3O1G A;  2BDZ A;  3KSE A;  3RVW A;  4N4Z A;  1ZCM A;  4WA6 A;  3CH3 X;  7PCK A;  3P5U A;  1PE6 A;  4REZ A;  1NL6 A;  1CQD A;  4CZW A;  3C0R A;  4QH6 A;  3W30 A;  4YYW A;  3H7D A;  4PAD A;  2O6X A;  2ATO A;  2R9M A;  2HH5 A;  3H6S A;  4I04 A;  2CIO A;  1QDQ A;  3M99 A;  1AYU A;  2PBH A;  4MZS A;  4D8E A;  3OF8 A;  3P5V A;  2BTW A;  2AYO A;  2AUX A;  3LXS A;  2ACT A;  5JZE A;  2BU3 A;  1PIP A;  1PPD A;  1PCI A;  2DZZ A;  3OF9 A;  4HWY A;  3I06 A;  4K7C A;  1VSN A;  1AU4 A;  3MP2 A;  2DCB A;  5KO3 A; 
#chains in the Genus database with same CATH homology
 3LFY A;  3WXE A;  1QMY A;  3OVZ A;  2WBF X;  1AYW A;  1O0E A;  4P6G A;  3HD3 A;  2R9O A;  2P7U A;  1GCB A;  1U9W A;  1AU0 A;  1TU6 A;  3F5V A;  2FTD A;  2OP3 A;  3S3Q A;  1IWD A;  4P6E A;  4CDC B;  2DC6 A;  1DEU A;  5CHT A;  4I05 A;  4CDF B;  2DCD A;  1VJV A;  2E01 A;  4AXM A;  2AU1 A;  4QRV A;  4BPV A;  1E2T A;  4RY2 A;  3PNR A;  1QXP A;  2DCA A;  1PPN A;  1U9Q X;  4QBB A;  2YJB A;  2B1N A;  5F02 A;  1F2C A;  2JQF R;  5FPW A;  3D6S A;  4BGF A;  1CSB B;  1AU3 A;  4YVA A;  1ZIV A;  1MEM A;  2BDL A;  3H8C A;  1KFX L;  1Y08 A;  2AIM A;  3WXG A;  2YJ2 A;  2DCC A;  1PAD A;  1TL9 A;  1CJL A;  1MEG A;  4YYS A;  1PPO A;  2YJ8 A;  2XU5 A;  1EWO A;  3USV A;  4YYR A;  4BS5 A;  1SP4 B;  4W4U A;  3IMA A;  3TNX A;  4DMX A;  2YJ9 A;  1EWL A;  3PBH A;  1GEC E;  1AEC A;  4QRG A;  3O0U A;  4YYV A;  1BP4 A;  4MZO A;  3BWK A;  4XUI A;  2DC9 A;  4PP1 A;  4C5P A;  3QT4 A;  1ME3 A;  4FJC A;  3NHE A;  1BY8 A;  3K9M A;  3K24 A;  1GLO A;  1TLO A;  2AUZ A;  3C9E A;  1PPP A;  2FO5 A;  3P5X A;  2AVW A;  3N3K A;  3K8U A;  4YYU A;  1EF7 A;  3CH2 X;  4NV7 A;  2FRA A;  3H8B A;  4Q8H A;  2NQG A;  8PCH A;  3D9W A;  3ZUA A;  2HHN A;  4QRX A;  1K3B B;  3CBK A;  2F7D A;  3GCB A;  4Q8G A;  2E00 A;  4PP2 E;  2NQA A;  3DF0 A;  2DZY A;  5EF4 A;  2P86 A;  1NB5 A;  6PAD A;  5CVM A;  4FK5 A;  1U9V A;  2FUD A;  2VFC A;  1THE A;  2XU1 A;  3MTN A;  1CPJ A;  1CTE A;  3IOQ A;  4I07 A;  4G54 A;  2DJG B;  1F2A A;  2XU3 A;  3N4C A;  4BQV A;  5CHV A;  2R9N A;  1W6F A;  2C0Y A;  3IHP A;  1AIM A;  4X6J A;  2Y6E A;  3LTW A;  1STF E;  1JQP A;  1U5I A;  2NQD B;  3N3G A;  2FYE A;  2GHU A;  1W4T A;  3RVV A;  2PAD A;  2G7Y A;  4YV8 A;  4N79 A;  2R9C A;  1YVB A;  1ICF A;  2G8E A;  2VFB A;  5PAD A;  4B55 A;  1EWM A;  3HWN A;  3CBJ A;  4X6H A;  5JA7 A;  3I3T A;  1PBH A;  3QJ3 A;  1F2B A;  4GUZ A;  1KXR A;  3KKU A;  1NPZ A;  1HUC B;  1CB5 A;  1POP A;  1YT7 A;  2OZ2 A;  3OVX A;  4CDE B;  3BPM A;  1X9Y A;  9PAP A;  4XR7 A;  4W5C A;  3PW3 A;  2IPP B;  1GMY A;  1BGO A;  4ZUX U;  1CVZ A;  1MS6 A;  2H7J A;  2B1M A;  2CB5 A;  5A24 A;  2P0R A;  2AS8 A;  1KHQ A;  1AU2 A;  4OEL A;  1AYV A;  5CVO B;  1NLJ A;  4MSX A;  3PDF A;  1S4V A;  4NV8 A;  3H89 A;  1U9X A;  4N8W A;  1XKG A;  3KWB X;  1YK7 A;  1YAL A;  3BOW A;  3KFQ A;  5CVN B;  2FRQ A;  1ATK A;  4AXL A;  2VHS A;  2GFO A;  1NB3 A;  2AYN A;  1MIR A;  3BCN A;  2R6N A;  2R9F A;  3AI8 A;  5JH3 A;  1ME4 A;  1PXV A;  1YK8 A;  3MOR A;  2Y5B A;  1NQC A;  4FIP A;  2HXZ A;  1ITO A;  4OEM A;  3ERV A;  3MHH A;  3KX1 A;  2HD5 A;  2JQG R;  5K16 A;  4BSQ A;  1M6D A;  2E02 A;  3MHS A;  3BPF A;  2XU4 A;  2FT2 A;  3KWZ A;  3RVX A;  3BC3 A;  3OIS A;  2FQ9 A;  3E1Z B;  4X6I A;  2F1G A;  3P5W A;  3B79 A;  3IV2 A;  3IEJ A;  2G8J A;  4PI3 A;  2E03 A;  1BQI A;  3V6C A;  2OUL A;  2G6D A;  2PRE A;  4BS6 A;  3IUT A;  1KHP A;  1EWP A;  1QOL A;  1MDW A;  4YYQ A;  1CS8 A;  2YJC A;  4W5B A;  5J94 A;  1SNK A;  1MHW A;  3S3R A;  3V6E A;  3QSD A;  1F29 A;  3U8E A;  5EGW A;  1FH0 A;  2DC7 A;  2DJF B;  3WXF A;  3F75 A;  2BSZ A;  2NQI A;  1Y4H A;  3HHA A;  4CDD B;  4DMY A;  2DC8 A;  1DF0 A;  3HHI A;  2VHF A;  1KFU L;  1A6R A;  2ARY A;  1Q6K A;  1W5R A;  3KW9 A;  4KLB A;  2PNS A;  1CV8 A;  2IBI A;  3O1G A;  2BDZ A;  3KSE A;  3RVW A;  4N4Z A;  1ZCM A;  4WA6 A;  3CH3 X;  7PCK A;  3P5U A;  1PE6 A;  1NL6 A;  1CQD A;  4CZW A;  4QH6 A;  4YYW A;  3H7D A;  4PAD A;  2O6X A;  2ATO A;  2R9M A;  2HH5 A;  3H6S A;  4I04 A;  2CIO A;  1QDQ A;  3M99 A;  1AYU A;  2PBH A;  4MZS A;  3OF8 A;  3P5V A;  1GX3 A;  2AYO A;  2AUX A;  3LXS A;  2ACT A;  1PIP A;  1PPD A;  1PCI A;  2DZZ A;  3OF9 A;  4HWY A;  3I06 A;  4K7C A;  1VSN A;  1AU4 A;  2DCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...