2Y6EA

Structure of the d1d2 domain of usp4, the conserved catalytic domain
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
357
structure length
336
Chain Sequence
IQPGLCGLGNLGNTFMNSALQCLSNTAPLTDYFLKDEYEAEINRDNPLGMKGEIAEAYAELIKQMWSGRDAHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLELKDANGRPDAVVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLPLPLTVALRDCIELFTTMETLGEDPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWRDKLDTVVEFPIRGLNMSEFVCNLSARPYVYDLIAVSNHYGAMGVGHYTAYAKNKLNGKWYYFDDSNVSLASEDQIVTKAAYVLFYQRRDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 4
publication title The Dusp-Ubl Domain of Usp4 Enhances its Catalytic Efficiency by Promoting Ubiquitin Exchange.
pubmed doi rcsb
source organism Homo sapiens
total genus 104
structure length 336
sequence length 357
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2y6eA00
2HD5A 5EGWA 4CDCB 4W4UA 1PCIA 1AIMA 3LXSA 4WA6A 4MZOA 1Y4HA 3D6SA 3OF9A 1VSNA 1ICFA 2G7YA 2R6NA 1XKGA 1PBHA 2Y5BA 3RVVA 4XUIA 1MS6A 4YYSA 2FUDA 3KKUA 2JQGR 2PREA 4YYUA 1FH0A 3HD3A 4OELA 2OULA 3TNXA 1TU6A 1GMYA 1NL6A 2FRQA 2O6XA 1ZCMA 4CZWA 1KFUL 2AYNA 3IUTA 3OVXA 1YVBA 2YJ2A 4DMYA 1ME3A 2DCCA 3RVXA 4OEMA 2R9OA 3KSEA 1PPPA 3H8CA 4QH6A 2VHSA 3DF0A 2E02A 1U9WA 2NQIA 2YJ8A 4MSXA 3BWKA 3HHIA 1AYWA 7PCKA 4I05A 3WXFA 2IPPB 3KX1A 1QXPA 3N3GA 3QT4A 2BDLA 4YVAA 2P7UA 3CBKA 4FK5A 1F2AA 3BCNA 2AU1A 1DEUA 3AI8A 2B1NA 5CVNB 3CH3X 2CIOA 4FJCA 3M99A 3F5VA 2DC6A 2DZYA 3OISA 4QRVA 3E1ZB 4W5BA 1CPJA 3P5WA 3MTNA 1U9VA 1VJVA 2YJ9A 4QRGA 1CJLA 3USVA 2OZ2A 6PADA 1CQDA 2FYEA 1QDQA 1CTEA 1K3BB 1MEMA 4YV8A 3MORA 1O0EA 1TL9A 2P0RA 2FT2A 4N8WA 1CB5A 2XU5A 1F2CA 3KWBX 4YYVA 1YK8A 2AUZA 4BS5A 1EWMA 4I04A 4P6EA 4QBBA 2F1GA 5CHVA 3IOQA 1KXRA 1AECA 2E03A 1GLOA 1YK7A 1DF0A 3H8BA 3I06A 1M6DA 2DCAA 3P5UA 4CDEB 2AS8A 1NB3A 4BQVA 3ZUAA 4DMXA 1PPDA 2FO5A 1KHPA 4BSQA 1MIRA 3BC3A 1PPOA 5EF4A 1KFXL 2G8JA 3IHPA 1QMYA 2C0YA 3OVZA 3BOWA 2B1MA 2P86A 3H6SA 1CSBB 2HHNA 3NHEA 1ME4A 1U9XA 4Q8GA 2DC7A 4Q8HA 2PBHA 2BDZA 3KWZA 2AUXA 4AXLA 3C9EA 3WXEA 3V6EA 5K16A 4P6GA 3ERVA 4CDFB 1NB5A 2DCDA 3KFQA 4PP1A 4X6IA 4BS6A 3HWNA 1CV8A 3K8UA 4N79A 3QSDA 1X9YA 3S3RA 2GHUA 3O1GA 2YJCA 5JH3A 2R9NA 3PNRA 1NLJA 1EF7A 4PADA 2AYOA 3U8EA 3IV2A 4I07A 2DC8A 1BQIA 3I3TA 1CS8A 3HHAA 3PBHA 1BY8A 5JA7A 4YYQA 1EWPA 2XU4A 1JQPA 5PADA 1MEGA 3K24A 2OP3A 4PI3A 4XR7A 2ACTA 1GCBA 2XU1A 2R9MA 4PP2E 1YT7A 1NQCA 1EWOA 1MHWA 1PE6A 1AU4A 2NQDB 3IEJA 3BPMA 4YYRA 1ITOA 1AU2A 4FIPA 3LFYA 4RY2A 3B79A 2CB5A 4ZUXU 1AYVA 1Q6KA 3H89A 2PADA 3N4CA 3BPFA 5CHTA 5FPWA 1A6RA 1AYUA 2AIMA 2HH5A 2DJGB 2WBFX 2ATOA 1IWDA 2G6DA 3KW9A 4X6HA 1F2BA 2H7JA 2NQAA 1SP4B 2Y6EA 3GCBA 1U5IA 3OF8A 1AU0A 2PNSA 3S3QA 2YJBA 4X6JA 3V6CA 1BP4A 1TLOA 1U9QX 2XU3A 1AU3A 2HXZA 1Y08A 2DZZA 2VHFA 3MHHA 1F29A 3P5VA 1HUCB 1KHQA 2ARYA 3O0UA 1STFE 3N3KA 8PCHA 1SNKA 1YALA 1PADA 2E00A 2NQGA 4K7CA 3P5XA 2R9CA 9PAPA 4BPVA 4CDDB 1PPNA 1THEA 3WXGA 4QRXA 2GFOA 2FQ9A 5CVMA 2R9FA 3H7DA 2G8EA 4KLBA 5CVOB 5A24A 1BGOA 1MDWA 1PXVA 4G54A 2DCBA 2JQFR 1NPZA 5F02A 3IMAA 1EWLA 1POPA 1ZIVA 2F7DA 4MZSA 4W5CA 2FRAA 3PDFA 3CBJA 3K9MA 1S4VA 1QOLA 2IBIA 2DC9A 4YYWA 4N4ZA 3CH2X 1ATKA 1GECE 2AVWA 2FTDA 3PW3A 3MHSA 4AXMA 1CVZA 2DJFB 3QJ3A 1PIPA 3RVWA 2E01A 4HWYA 3F75A 5J94A
chains in the Genus database with same CATH superfamily
5JZEA 2J7QA 2HD5A 2HWKA 5EGWA 4CDCB 4W4UA 1PCIA 1AIMA 3LXSA 4WA6A 4MZOA 1Y4HA 3D6SA 3OF9A 4OW0A 3B21A 1VSNA 1ICFA 2G7YA 2R6NA 1XKGA 4WURA 1PBHA 2Y5BA 3RVVA 4XUIA 1MS6A 4YYSA 2FUDA 4XZXA 3KKUA 4BOZA 2JQGR 2PREA 4YYUA 1FH0A 3HD3A 4OELA 2OULA 3TNXA 1TU6A 3PSEA 1GMYA 1NL6A 2FRQA 2O6XA 1ZCMA 4CZWA 4D8EA 2FE8A 1KFUL 2AYNA 3IUTA 3OVXA 1YVBA 4RNAA 4GUAA 2YJ2A 4DMYA 1ME3A 2DCCA 3RVXA 4OEMA 2R9OA 3BBAA 4BOSA 3KSEA 1PPPA 3H8CA 4QH6A 2VHSA 2AGAA 3C0RA 3DF0A 2E02A 1U9WA 2NQIA 2YJ8A 4M0WA 4MSXA 3BWKA 3HHIA 4REZA 1AYWA 7PCKA 4I05A 3WXFA 2BTWA 2IPPB 3KX1A 1QXPA 3N3GA 3QT4A 2BDLA 4YVAA 2P7UA 3CBKA 4FK5A 4BOQA 1F2AA 3BCNA 2AU1A 1DEUA 4RF1A 3AI8A 2B1NA 5CVNB 3CH3X 2CIOA 4FJCA 3M99A 3F5VA 2DC6A 2DZYA 2Z84A 3OISA 4QRVA 3E1ZB 4W5BA 1CPJA 3P5WA 3MTNA 3RNVA 1U9VA 1VJVA 2YJ9A 4QRGA 1CJLA 3USVA 2OZ2A 6PADA 1CQDA 3BY4A 2FYEA 1QDQA 1CTEA 1K3BB 1MEMA 4YV8A 3MORA 4MM3B 1O0EA 1TL9A 2P0RA 2UZJA 2FT2A 4N8WA 4A5UA 1CB5A 2XU5A 1F2CA 3KWBX 4YYVA 1YK8A 2AUZA 4BS5A 1EWMA 4I04A 4P6EA 4QBBA 2F1GA 3TRKA 5CHVA 3BB7A 3OQCA 3IOQA 1KXRA 1AECA 2E03A 1GLOA 1YK7A 1DF0A 3H8BA 3I06A 1M6DA 4BOPA 2DCAA 3P5UA 4CDEB 2AS8A 1NB3A 4BQVA 3ZUAA 4DMXA 1PPDA 2FO5A 1KHPA 4RF0A 4BSQA 1MIRA 5KO3A 3BC3A 1PPOA 5EF4A 1KFXL 2G8JA 3IHPA 1QMYA 2C0YA 3OVZA 3BOWA 3W30A 1YZBA 2B1MA 2JTCA 2P86A 3H6SA 1CSBB 2HHNA 3NHEA 1ME4A 1U9XA 4Q8GA 2DC7A 2BTWB 4Q8HA 2PBHA 2BDZA 4ZTBA 3KWZA 2AUXA 4AXLA 3PHWA 3C9EA 3WXEA 3V6EA 4IP3A 5K16A 3W31A 4P6GA 3ERVA 4CDFB 1NB5A 2DCDA 5EZQA 3KFQA 4PP1A 4X6IA 4BS6A 3HWNA 1CV8A 3K8UA 4N79A 3O65A 3QSDA 1X9YA 3S3RA 2GHUA 3O1GA 2YJCA 5JH3A 2R9NA 4R3DA 2BU3A 3PNRA 1NLJA 4OVZA 1EF7A 4PADA 2AYOA 3PHXA 3U8EA 3IV2A 4I07A 2DC8A 5EZSA 3PT2A 1BQIA 3I3TA 1CS8A 2JRIA 3HHAA 3PBHA 1BY8A 5JA7A 4YYQA 1EWPA 2XU4A 1JQPA 5PADA 5E6JA 1MEGA 3K24A 2OP3A 4PI3A 4XR7A 2ACTA 1GCBA 2XU1A 2R9MA 4PP2E 1YT7A 1NQCA 1EWOA 1MHWA 1PE6A 1AU4A 2NQDB 3IFUA 3IEJA 3BPMA 4YYRA 1ITOA 1AU2A 4FIPA 3LFYA 4RY2A 3B79A 2CB5A 4ZUXU 1AYVA 1Q6KA 4D8IA 3H89A 2PADA 3N4CA 3BPFA 5CHTA 5FPWA 1A6RA 1AYUA 3TMPA 2AIMA 2HH5A 3MJ5A 2DJGB 2WBFX 2ATOA 1IWDA 2G6DA 3KW9A 4X6HA 1F2BA 2H7JA 2NQAA 1SP4B 2Y6EA 4RKXA 3GCBA 1U5IA 3OF8A 1AU0A 2PNSA 4MI7A 3S3QA 2YJBA 3PRPA 4X6JA 3V6CA 1BP4A 1TLOA 1U9QX 2XU3A 1AU3A 2HXZA 1Y08A 2DZZA 2VHFA 4HXDB 3MHHA 1F29A 3P5VA 1HUCB 1KHQA 2ARYA 2DOSA 3O0UA 1STFE 4P16A 3N3KA 8PCHA 1SNKA 1YALA 1PADA 2E00A 1PVJA 2NQGA 4K7CA 3P5XA 4D8BA 2R9CA 2J7QC 9PAPA 4OVZB 4BPVA 4CDDB 1PPNA 1THEA 3E9SA 3WXGA 4QRXA 4BOUA 2GFOA 3ZNHA 3PRMA 2FQ9A 5CVMA 1UKFA 3PHUA 2R9FA 3H7DA 2G8EA 4KLBA 5CVOB 5A24A 1BGOA 1MDWA 4IUMA 1PXVA 4G54A 4PT5A 2DCBA 2JQFR 1NPZA 3MTVA 5F02A 3IMAA 1EWLA 1POPA 1ZIVA 2F7DA 4MZSA 4W5CA 2FRAA 3PDFA 3CBJA 3K9MA 1S4VA 1QOLA 2IBIA 2DC9A 4YYWA 4N4ZA 3CH2X 1ATKA 1DKIA 1GECE 2AVWA 2FTDA 3PW3A 3MHSA 4AXMA 1CVZA 3MP2A 2DJFB 3QJ3A 1PIPA 3RVWA 2E01A 4HWYA 3F75A 5J94A
chains in the Genus database with same CATH topology
2HD5A 1W6FA 5EGWA 4CDCB 4W4UA 1PCIA 1AIMA 3LXSA 4WA6A 3D9WA 4MZOA 1Y4HA 3D6SA 3OF9A 1VSNA 1ICFA 2G7YA 2R6NA 1XKGA 1PBHA 2Y5BA 3RVVA 4XUIA 1MS6A 4YYSA 2FUDA 3KKUA 2JQGR 2PREA 4YYUA 1FH0A 3HD3A 4OELA 2OULA 3TNXA 1TU6A 1GMYA 1NL6A 2FRQA 2O6XA 1ZCMA 4CZWA 1E2TA 1KFUL 2AYNA 3IUTA 3OVXA 1YVBA 2YJ2A 4DMYA 1ME3A 2DCCA 3RVXA 4OEMA 2R9OA 3KSEA 1PPPA 3H8CA 4QH6A 2VHSA 2BSZA 3DF0A 2E02A 1U9WA 2NQIA 2YJ8A 4MSXA 3BWKA 3HHIA 1AYWA 7PCKA 4I05A 3WXFA 2IPPB 3KX1A 1QXPA 3N3GA 3QT4A 2BDLA 4YVAA 2P7UA 3CBKA 4FK5A 1F2AA 3BCNA 2AU1A 1DEUA 3AI8A 2B1NA 5CVNB 3CH3X 2CIOA 4FJCA 3M99A 3F5VA 2DC6A 2DZYA 3OISA 4BGFA 4QRVA 3E1ZB 4W5BA 1CPJA 3P5WA 3MTNA 2VFCA 1U9VA 4GUZA 1VJVA 2YJ9A 4QRGA 1CJLA 3USVA 2OZ2A 6PADA 1CQDA 2FYEA 1QDQA 1CTEA 1K3BB 1MEMA 4YV8A 3MORA 1O0EA 1TL9A 2P0RA 2FT2A 4N8WA 1CB5A 2XU5A 1F2CA 3KWBX 4YYVA 1YK8A 2AUZA 1W5RA 4BS5A 1EWMA 4I04A 4P6EA 4QBBA 2F1GA 5CHVA 3IOQA 1KXRA 1W4TA 1AECA 2E03A 1GLOA 1YK7A 1DF0A 3H8BA 3I06A 1M6DA 2DCAA 3P5UA 4CDEB 2AS8A 1NB3A 4BQVA 3ZUAA 4DMXA 1PPDA 2FO5A 1KHPA 4BSQA 1MIRA 3BC3A 1PPOA 5EF4A 1KFXL 2G8JA 3IHPA 1QMYA 4NV8A 2C0YA 3OVZA 3BOWA 2B1MA 2P86A 3H6SA 1CSBB 2HHNA 3NHEA 1ME4A 1U9XA 4Q8GA 2DC7A 4Q8HA 2PBHA 2BDZA 3KWZA 2AUXA 4AXLA 3C9EA 3WXEA 3V6EA 5K16A 4P6GA 3ERVA 4CDFB 1NB5A 2DCDA 3KFQA 4PP1A 4X6IA 4BS6A 3HWNA 1CV8A 2VFBA 3K8UA 4N79A 3QSDA 1X9YA 3S3RA 2GHUA 3O1GA 2YJCA 5JH3A 2R9NA 3PNRA 1NLJA 1EF7A 4PADA 2AYOA 3U8EA 3IV2A 4I07A 2DC8A 1BQIA 3I3TA 1CS8A 3HHAA 3PBHA 1BY8A 5JA7A 4B55A 4YYQA 1EWPA 2XU4A 1JQPA 5PADA 1MEGA 3K24A 2OP3A 4PI3A 4XR7A 2ACTA 4NV7A 1GCBA 2XU1A 2R9MA 4PP2E 1YT7A 1NQCA 1EWOA 1MHWA 1PE6A 1AU4A 2NQDB 3IEJA 3BPMA 4YYRA 1ITOA 1AU2A 4FIPA 3LFYA 4RY2A 3B79A 2CB5A 4ZUXU 1AYVA 1Q6KA 3H89A 2PADA 3N4CA 3BPFA 5CHTA 5FPWA 1A6RA 1AYUA 2AIMA 2HH5A 2DJGB 2WBFX 2ATOA 1IWDA 2G6DA 3KW9A 4X6HA 1F2BA 2H7JA 2NQAA 1SP4B 2Y6EA 3GCBA 1U5IA 3OF8A 1AU0A 2PNSA 3S3QA 2YJBA 4X6JA 3V6CA 1BP4A 1TLOA 1U9QX 2XU3A 1AU3A 2HXZA 1Y08A 2DZZA 2VHFA 3MHHA 1F29A 3P5VA 1HUCB 1KHQA 2ARYA 3O0UA 1STFE 3N3KA 8PCHA 1SNKA 1YALA 1GX3A 1PADA 2E00A 2NQGA 4K7CA 3P5XA 2R9CA 9PAPA 4BPVA 4CDDB 1PPNA 1THEA 3WXGA 4QRXA 2GFOA 3LTWA 2FQ9A 5CVMA 2R9FA 3H7DA 2G8EA 4KLBA 5CVOB 5A24A 1BGOA 1MDWA 1PXVA 4G54A 2DCBA 2JQFR 1NPZA 5F02A 4C5PA 3IMAA 1EWLA 1POPA 1ZIVA 2F7DA 4MZSA 4W5CA 2FRAA 3PDFA 3CBJA 3K9MA 1S4VA 1QOLA 2IBIA 2DC9A 4YYWA 4N4ZA 3CH2X 1ATKA 1GECE 2AVWA 2FTDA 3PW3A 3MHSA 4AXMA 1CVZA 2DJFB 3QJ3A 1PIPA 3RVWA 2E01A 4HWYA 3F75A 5J94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HD5 A;  5EGW A;  4CDC B;  4W4U A;  1PCI A;  1AIM A;  3LXS A;  4WA6 A;  4MZO A;  1Y4H A;  3D6S A;  3OF9 A;  1VSN A;  1ICF A;  2G7Y A;  2R6N A;  1XKG A;  1PBH A;  2Y5B A;  3RVV A;  4XUI A;  1MS6 A;  4YYS A;  2FUD A;  3KKU A;  2JQG R;  2PRE A;  4YYU A;  1FH0 A;  3HD3 A;  4OEL A;  2OUL A;  3TNX A;  1TU6 A;  1GMY A;  1NL6 A;  2FRQ A;  2O6X A;  1ZCM A;  4CZW A;  1KFU L;  2AYN A;  3IUT A;  3OVX A;  1YVB A;  2YJ2 A;  4DMY A;  1ME3 A;  2DCC A;  3RVX A;  4OEM A;  2R9O A;  3KSE A;  1PPP A;  3H8C A;  4QH6 A;  2VHS A;  3DF0 A;  2E02 A;  1U9W A;  2NQI A;  2YJ8 A;  4MSX A;  3BWK A;  3HHI A;  1AYW A;  7PCK A;  4I05 A;  3WXF A;  2IPP B;  3KX1 A;  1QXP A;  3N3G A;  3QT4 A;  2BDL A;  4YVA A;  2P7U A;  3CBK A;  4FK5 A;  1F2A A;  3BCN A;  2AU1 A;  1DEU A;  3AI8 A;  2B1N A;  5CVN B;  3CH3 X;  2CIO A;  4FJC A;  3M99 A;  3F5V A;  2DC6 A;  2DZY A;  3OIS A;  4QRV A;  3E1Z B;  4W5B A;  1CPJ A;  3P5W A;  3MTN A;  1U9V A;  1VJV A;  2YJ9 A;  4QRG A;  1CJL A;  3USV A;  2OZ2 A;  6PAD A;  1CQD A;  2FYE A;  1QDQ A;  1CTE A;  1K3B B;  1MEM A;  4YV8 A;  3MOR A;  1O0E A;  1TL9 A;  2P0R A;  2FT2 A;  4N8W A;  1CB5 A;  2XU5 A;  1F2C A;  3KWB X;  4YYV A;  1YK8 A;  2AUZ A;  4BS5 A;  1EWM A;  4I04 A;  4P6E A;  4QBB A;  2F1G A;  5CHV A;  3IOQ A;  1KXR A;  1AEC A;  2E03 A;  1GLO A;  1YK7 A;  1DF0 A;  3H8B A;  3I06 A;  1M6D A;  2DCA A;  3P5U A;  4CDE B;  2AS8 A;  1NB3 A;  4BQV A;  3ZUA A;  4DMX A;  1PPD A;  2FO5 A;  1KHP A;  4BSQ A;  1MIR A;  3BC3 A;  1PPO A;  5EF4 A;  1KFX L;  2G8J A;  3IHP A;  1QMY A;  2C0Y A;  3OVZ A;  3BOW A;  2B1M A;  2P86 A;  3H6S A;  1CSB B;  2HHN A;  3NHE A;  1ME4 A;  1U9X A;  4Q8G A;  2DC7 A;  4Q8H A;  2PBH A;  2BDZ A;  3KWZ A;  2AUX A;  4AXL A;  3C9E A;  3WXE A;  3V6E A;  5K16 A;  4P6G A;  3ERV A;  4CDF B;  1NB5 A;  2DCD A;  3KFQ A;  4PP1 A;  4X6I A;  4BS6 A;  3HWN A;  1CV8 A;  3K8U A;  4N79 A;  3QSD A;  1X9Y A;  3S3R A;  2GHU A;  3O1G A;  2YJC A;  5JH3 A;  2R9N A;  3PNR A;  1NLJ A;  1EF7 A;  4PAD A;  2AYO A;  3U8E A;  3IV2 A;  4I07 A;  2DC8 A;  1BQI A;  3I3T A;  1CS8 A;  3HHA A;  3PBH A;  1BY8 A;  5JA7 A;  4YYQ A;  1EWP A;  2XU4 A;  1JQP A;  5PAD A;  1MEG A;  3K24 A;  2OP3 A;  4PI3 A;  4XR7 A;  2ACT A;  1GCB A;  2XU1 A;  2R9M A;  4PP2 E;  1YT7 A;  1NQC A;  1EWO A;  1MHW A;  1PE6 A;  1AU4 A;  2NQD B;  3IEJ A;  3BPM A;  4YYR A;  1ITO A;  1AU2 A;  4FIP A;  3LFY A;  4RY2 A;  3B79 A;  2CB5 A;  4ZUX U;  1AYV A;  1Q6K A;  3H89 A;  2PAD A;  3N4C A;  3BPF A;  5CHT A;  5FPW A;  1A6R A;  1AYU A;  2AIM A;  2HH5 A;  2DJG B;  2WBF X;  2ATO A;  1IWD A;  2G6D A;  3KW9 A;  4X6H A;  1F2B A;  2H7J A;  2NQA A;  1SP4 B;  2Y6E A;  3GCB A;  1U5I A;  3OF8 A;  1AU0 A;  2PNS A;  3S3Q A;  2YJB A;  4X6J A;  3V6C A;  1BP4 A;  1TLO A;  1U9Q X;  2XU3 A;  1AU3 A;  2HXZ A;  1Y08 A;  2DZZ A;  2VHF A;  3MHH A;  1F29 A;  3P5V A;  1HUC B;  1KHQ A;  2ARY A;  3O0U A;  1STF E;  3N3K A;  8PCH A;  1SNK A;  1YAL A;  1PAD A;  2E00 A;  2NQG A;  4K7C A;  3P5X A;  2R9C A;  9PAP A;  4BPV A;  4CDD B;  1PPN A;  1THE A;  3WXG A;  4QRX A;  2GFO A;  2FQ9 A;  5CVM A;  2R9F A;  3H7D A;  2G8E A;  4KLB A;  5CVO B;  5A24 A;  1BGO A;  1MDW A;  1PXV A;  4G54 A;  2DCB A;  2JQF R;  1NPZ A;  5F02 A;  3IMA A;  1EWL A;  1POP A;  1ZIV A;  2F7D A;  4MZS A;  4W5C A;  2FRA A;  3PDF A;  3CBJ A;  3K9M A;  1S4V A;  1QOL A;  2IBI A;  2DC9 A;  4YYW A;  4N4Z A;  3CH2 X;  1ATK A;  1GEC E;  2AVW A;  2FTD A;  3PW3 A;  3MHS A;  4AXM A;  1CVZ A;  2DJF B;  3QJ3 A;  1PIP A;  3RVW A;  2E01 A;  4HWY A;  3F75 A;  5J94 A; 
#chains in the Genus database with same CATH topology
 5JZE A;  2J7Q A;  2HD5 A;  2HWK A;  5EGW A;  4CDC B;  4W4U A;  1PCI A;  1AIM A;  3LXS A;  4WA6 A;  4MZO A;  1Y4H A;  3D6S A;  3OF9 A;  4OW0 A;  3B21 A;  1VSN A;  1ICF A;  2G7Y A;  2R6N A;  1XKG A;  4WUR A;  1PBH A;  2Y5B A;  3RVV A;  4XUI A;  1MS6 A;  4YYS A;  2FUD A;  4XZX A;  3KKU A;  4BOZ A;  2JQG R;  2PRE A;  4YYU A;  1FH0 A;  3HD3 A;  4OEL A;  2OUL A;  3TNX A;  1TU6 A;  3PSE A;  1GMY A;  1NL6 A;  2FRQ A;  2O6X A;  1ZCM A;  4CZW A;  4D8E A;  2FE8 A;  1KFU L;  2AYN A;  3IUT A;  3OVX A;  1YVB A;  4RNA A;  4GUA A;  2YJ2 A;  4DMY A;  1ME3 A;  2DCC A;  3RVX A;  4OEM A;  2R9O A;  3BBA A;  4BOS A;  3KSE A;  1PPP A;  3H8C A;  4QH6 A;  2VHS A;  2AGA A;  3C0R A;  3DF0 A;  2E02 A;  1U9W A;  2NQI A;  2YJ8 A;  4M0W A;  4MSX A;  3BWK A;  3HHI A;  4REZ A;  1AYW A;  7PCK A;  4I05 A;  3WXF A;  2BTW A;  2IPP B;  3KX1 A;  1QXP A;  3N3G A;  3QT4 A;  2BDL A;  4YVA A;  2P7U A;  3CBK A;  4FK5 A;  4BOQ A;  1F2A A;  3BCN A;  2AU1 A;  1DEU A;  4RF1 A;  3AI8 A;  2B1N A;  5CVN B;  3CH3 X;  2CIO A;  4FJC A;  3M99 A;  3F5V A;  2DC6 A;  2DZY A;  2Z84 A;  3OIS A;  4QRV A;  3E1Z B;  4W5B A;  1CPJ A;  3P5W A;  3MTN A;  3RNV A;  1U9V A;  1VJV A;  2YJ9 A;  4QRG A;  1CJL A;  3USV A;  2OZ2 A;  6PAD A;  1CQD A;  3BY4 A;  2FYE A;  1QDQ A;  1CTE A;  1K3B B;  1MEM A;  4YV8 A;  3MOR A;  4MM3 B;  1O0E A;  1TL9 A;  2P0R A;  2UZJ A;  2FT2 A;  4N8W A;  4A5U A;  1CB5 A;  2XU5 A;  1F2C A;  3KWB X;  4YYV A;  1YK8 A;  2AUZ A;  4BS5 A;  1EWM A;  4I04 A;  4P6E A;  4QBB A;  2F1G A;  3TRK A;  5CHV A;  3BB7 A;  3OQC A;  3IOQ A;  1KXR A;  1AEC A;  2E03 A;  1GLO A;  1YK7 A;  1DF0 A;  3H8B A;  3I06 A;  1M6D A;  4BOP A;  2DCA A;  3P5U A;  4CDE B;  2AS8 A;  1NB3 A;  4BQV A;  3ZUA A;  4DMX A;  1PPD A;  2FO5 A;  1KHP A;  4RF0 A;  4BSQ A;  1MIR A;  5KO3 A;  3BC3 A;  1PPO A;  5EF4 A;  1KFX L;  2G8J A;  3IHP A;  1QMY A;  2C0Y A;  3OVZ A;  3BOW A;  3W30 A;  1YZB A;  2B1M A;  2JTC A;  2P86 A;  3H6S A;  1CSB B;  2HHN A;  3NHE A;  1ME4 A;  1U9X A;  4Q8G A;  2DC7 A;  2BTW B;  4Q8H A;  2PBH A;  2BDZ A;  4ZTB A;  3KWZ A;  2AUX A;  4AXL A;  3PHW A;  3C9E A;  3WXE A;  3V6E A;  4IP3 A;  5K16 A;  3W31 A;  4P6G A;  3ERV A;  4CDF B;  1NB5 A;  2DCD A;  5EZQ A;  3KFQ A;  4PP1 A;  4X6I A;  4BS6 A;  3HWN A;  1CV8 A;  3K8U A;  4N79 A;  3O65 A;  3QSD A;  1X9Y A;  3S3R A;  2GHU A;  3O1G A;  2YJC A;  5JH3 A;  2R9N A;  4R3D A;  2BU3 A;  3PNR A;  1NLJ A;  4OVZ A;  1EF7 A;  4PAD A;  2AYO A;  3PHX A;  3U8E A;  3IV2 A;  4I07 A;  2DC8 A;  5EZS A;  3PT2 A;  1BQI A;  3I3T A;  1CS8 A;  2JRI A;  3HHA A;  3PBH A;  1BY8 A;  5JA7 A;  4YYQ A;  1EWP A;  2XU4 A;  1JQP A;  5PAD A;  5E6J A;  1MEG A;  3K24 A;  2OP3 A;  4PI3 A;  4XR7 A;  2ACT A;  1GCB A;  2XU1 A;  2R9M A;  4PP2 E;  1YT7 A;  1NQC A;  1EWO A;  1MHW A;  1PE6 A;  1AU4 A;  2NQD B;  3IFU A;  3IEJ A;  3BPM A;  4YYR A;  1ITO A;  1AU2 A;  4FIP A;  3LFY A;  4RY2 A;  3B79 A;  2CB5 A;  4ZUX U;  1AYV A;  1Q6K A;  4D8I A;  3H89 A;  2PAD A;  3N4C A;  3BPF A;  5CHT A;  5FPW A;  1A6R A;  1AYU A;  3TMP A;  2AIM A;  2HH5 A;  3MJ5 A;  2DJG B;  2WBF X;  2ATO A;  1IWD A;  2G6D A;  3KW9 A;  4X6H A;  1F2B A;  2H7J A;  2NQA A;  1SP4 B;  2Y6E A;  4RKX A;  3GCB A;  1U5I A;  3OF8 A;  1AU0 A;  2PNS A;  4MI7 A;  3S3Q A;  2YJB A;  3PRP A;  4X6J A;  3V6C A;  1BP4 A;  1TLO A;  1U9Q X;  2XU3 A;  1AU3 A;  2HXZ A;  1Y08 A;  2DZZ A;  2VHF A;  4HXD B;  3MHH A;  1F29 A;  3P5V A;  1HUC B;  1KHQ A;  2ARY A;  2DOS A;  3O0U A;  1STF E;  4P16 A;  3N3K A;  8PCH A;  1SNK A;  1YAL A;  1PAD A;  2E00 A;  1PVJ A;  2NQG A;  4K7C A;  3P5X A;  4D8B A;  2R9C A;  2J7Q C;  9PAP A;  4OVZ B;  4BPV A;  4CDD B;  1PPN A;  1THE A;  3E9S A;  3WXG A;  4QRX A;  4BOU A;  2GFO A;  3ZNH A;  3PRM A;  2FQ9 A;  5CVM A;  1UKF A;  3PHU A;  2R9F A;  3H7D A;  2G8E A;  4KLB A;  5CVO B;  5A24 A;  1BGO A;  1MDW A;  4IUM A;  1PXV A;  4G54 A;  4PT5 A;  2DCB A;  2JQF R;  1NPZ A;  3MTV A;  5F02 A;  3IMA A;  1EWL A;  1POP A;  1ZIV A;  2F7D A;  4MZS A;  4W5C A;  2FRA A;  3PDF A;  3CBJ A;  3K9M A;  1S4V A;  1QOL A;  2IBI A;  2DC9 A;  4YYW A;  4N4Z A;  3CH2 X;  1ATK A;  1DKI A;  1GEC E;  2AVW A;  2FTD A;  3PW3 A;  3MHS A;  4AXM A;  1CVZ A;  3MP2 A;  2DJF B;  3QJ3 A;  1PIP A;  3RVW A;  2E01 A;  4HWY A;  3F75 A;  5J94 A; 
#chains in the Genus database with same CATH homology
 2HD5 A;  1W6F A;  5EGW A;  4CDC B;  4W4U A;  1PCI A;  1AIM A;  3LXS A;  4WA6 A;  3D9W A;  4MZO A;  1Y4H A;  3D6S A;  3OF9 A;  1VSN A;  1ICF A;  2G7Y A;  2R6N A;  1XKG A;  1PBH A;  2Y5B A;  3RVV A;  4XUI A;  1MS6 A;  4YYS A;  2FUD A;  3KKU A;  2JQG R;  2PRE A;  4YYU A;  1FH0 A;  3HD3 A;  4OEL A;  2OUL A;  3TNX A;  1TU6 A;  1GMY A;  1NL6 A;  2FRQ A;  2O6X A;  1ZCM A;  4CZW A;  1E2T A;  1KFU L;  2AYN A;  3IUT A;  3OVX A;  1YVB A;  2YJ2 A;  4DMY A;  1ME3 A;  2DCC A;  3RVX A;  4OEM A;  2R9O A;  3KSE A;  1PPP A;  3H8C A;  4QH6 A;  2VHS A;  2BSZ A;  3DF0 A;  2E02 A;  1U9W A;  2NQI A;  2YJ8 A;  4MSX A;  3BWK A;  3HHI A;  1AYW A;  7PCK A;  4I05 A;  3WXF A;  2IPP B;  3KX1 A;  1QXP A;  3N3G A;  3QT4 A;  2BDL A;  4YVA A;  2P7U A;  3CBK A;  4FK5 A;  1F2A A;  3BCN A;  2AU1 A;  1DEU A;  3AI8 A;  2B1N A;  5CVN B;  3CH3 X;  2CIO A;  4FJC A;  3M99 A;  3F5V A;  2DC6 A;  2DZY A;  3OIS A;  4BGF A;  4QRV A;  3E1Z B;  4W5B A;  1CPJ A;  3P5W A;  3MTN A;  2VFC A;  1U9V A;  4GUZ A;  1VJV A;  2YJ9 A;  4QRG A;  1CJL A;  3USV A;  2OZ2 A;  6PAD A;  1CQD A;  2FYE A;  1QDQ A;  1CTE A;  1K3B B;  1MEM A;  4YV8 A;  3MOR A;  1O0E A;  1TL9 A;  2P0R A;  2FT2 A;  4N8W A;  1CB5 A;  2XU5 A;  1F2C A;  3KWB X;  4YYV A;  1YK8 A;  2AUZ A;  1W5R A;  4BS5 A;  1EWM A;  4I04 A;  4P6E A;  4QBB A;  2F1G A;  5CHV A;  3IOQ A;  1KXR A;  1W4T A;  1AEC A;  2E03 A;  1GLO A;  1YK7 A;  1DF0 A;  3H8B A;  3I06 A;  1M6D A;  2DCA A;  3P5U A;  4CDE B;  2AS8 A;  1NB3 A;  4BQV A;  3ZUA A;  4DMX A;  1PPD A;  2FO5 A;  1KHP A;  4BSQ A;  1MIR A;  3BC3 A;  1PPO A;  5EF4 A;  1KFX L;  2G8J A;  3IHP A;  1QMY A;  4NV8 A;  2C0Y A;  3OVZ A;  3BOW A;  2B1M A;  2P86 A;  3H6S A;  1CSB B;  2HHN A;  3NHE A;  1ME4 A;  1U9X A;  4Q8G A;  2DC7 A;  4Q8H A;  2PBH A;  2BDZ A;  3KWZ A;  2AUX A;  4AXL A;  3C9E A;  3WXE A;  3V6E A;  5K16 A;  4P6G A;  3ERV A;  4CDF B;  1NB5 A;  2DCD A;  3KFQ A;  4PP1 A;  4X6I A;  4BS6 A;  3HWN A;  1CV8 A;  2VFB A;  3K8U A;  4N79 A;  3QSD A;  1X9Y A;  3S3R A;  2GHU A;  3O1G A;  2YJC A;  5JH3 A;  2R9N A;  3PNR A;  1NLJ A;  1EF7 A;  4PAD A;  2AYO A;  3U8E A;  3IV2 A;  4I07 A;  2DC8 A;  1BQI A;  3I3T A;  1CS8 A;  3HHA A;  3PBH A;  1BY8 A;  5JA7 A;  4B55 A;  4YYQ A;  1EWP A;  2XU4 A;  1JQP A;  5PAD A;  1MEG A;  3K24 A;  2OP3 A;  4PI3 A;  4XR7 A;  2ACT A;  4NV7 A;  1GCB A;  2XU1 A;  2R9M A;  4PP2 E;  1YT7 A;  1NQC A;  1EWO A;  1MHW A;  1PE6 A;  1AU4 A;  2NQD B;  3IEJ A;  3BPM A;  4YYR A;  1ITO A;  1AU2 A;  4FIP A;  3LFY A;  4RY2 A;  3B79 A;  2CB5 A;  4ZUX U;  1AYV A;  1Q6K A;  3H89 A;  2PAD A;  3N4C A;  3BPF A;  5CHT A;  5FPW A;  1A6R A;  1AYU A;  2AIM A;  2HH5 A;  2DJG B;  2WBF X;  2ATO A;  1IWD A;  2G6D A;  3KW9 A;  4X6H A;  1F2B A;  2H7J A;  2NQA A;  1SP4 B;  2Y6E A;  3GCB A;  1U5I A;  3OF8 A;  1AU0 A;  2PNS A;  3S3Q A;  2YJB A;  4X6J A;  3V6C A;  1BP4 A;  1TLO A;  1U9Q X;  2XU3 A;  1AU3 A;  2HXZ A;  1Y08 A;  2DZZ A;  2VHF A;  3MHH A;  1F29 A;  3P5V A;  1HUC B;  1KHQ A;  2ARY A;  3O0U A;  1STF E;  3N3K A;  8PCH A;  1SNK A;  1YAL A;  1GX3 A;  1PAD A;  2E00 A;  2NQG A;  4K7C A;  3P5X A;  2R9C A;  9PAP A;  4BPV A;  4CDD B;  1PPN A;  1THE A;  3WXG A;  4QRX A;  2GFO A;  3LTW A;  2FQ9 A;  5CVM A;  2R9F A;  3H7D A;  2G8E A;  4KLB A;  5CVO B;  5A24 A;  1BGO A;  1MDW A;  1PXV A;  4G54 A;  2DCB A;  2JQF R;  1NPZ A;  5F02 A;  4C5P A;  3IMA A;  1EWL A;  1POP A;  1ZIV A;  2F7D A;  4MZS A;  4W5C A;  2FRA A;  3PDF A;  3CBJ A;  3K9M A;  1S4V A;  1QOL A;  2IBI A;  2DC9 A;  4YYW A;  4N4Z A;  3CH2 X;  1ATK A;  1GEC E;  2AVW A;  2FTD A;  3PW3 A;  3MHS A;  4AXM A;  1CVZ A;  2DJF B;  3QJ3 A;  1PIP A;  3RVW A;  2E01 A;  4HWY A;  3F75 A;  5J94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...