4BS6A

Mouse cathepsin s with covalent ligand
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
219
structure length
219
Chain Sequence
TLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKAMDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cathepsin S Nitrile Inhibitors
rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords CATHEPSIN S
total genus 63
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2013-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4bs6A00
2Y6EA 1FH0A 2FYEA 5F02A 3HHIA 3KSEA 3HWNA 1KHPA 1CPJA 1IWDA 1ZCMA 3OF9A 1YK7A 4QBBA 1CJLA 2R9CA 3IUTA 3QSDA 1MS6A 3WXFA 2G7YA 2B1MA 3GCBA 1VSNA 2BDZA 4QRVA 3K24A 3V6CA 3F75A 1A6RA 5CHVA 4DMYA 1AYVA 1AYUA 2FQ9A 3E1ZB 1POPA 4XR7A 2AIMA 1PPOA 2F7DA 3PW3A 2VHSA 1X9YA 3BC3A 4YYRA 4I05A 1YALA 3CBKA 2DCDA 1Q6KA 2DCAA 2JQGR 2OULA 2NQGA 3QT4A 2OZ2A 1VJVA 1MIRA 2GHUA 3O0UA 2XU3A 4I07A 1AECA 2DJFB 1SP4B 2CB5A 4Q8GA 5JA7A 7PCKA 1AYWA 1KFXL 5A24A 3IV2A 1DF0A 2FRQA 3P5VA 4QRXA 4AXMA 3HD3A 2R9FA 3N4CA 4P6EA 3U8EA 3OISA 2GFOA 3LXSA 5EGWA 4BS6A 2R6NA 1BQIA 3KWZA 3S3RA 2AS8A 1PIPA 2YJ9A 4I04A 2E02A 4YYUA 1DEUA 3K8UA 3I3TA 3O1GA 5PADA 1CV8A 1TU6A 1KHQA 4YV8A 3V6EA 1EWLA 1NQCA 2JQFR 3TNXA 4YYWA 1THEA 8PCHA 4FJCA 1ATKA 3KX1A 1M6DA 3KFQA 2YJBA 1AU0A 3KW9A 4N4ZA 4BPVA 1HUCB 3NHEA 1PCIA 4MZSA 1NB5A 1S4VA 4MZOA 4X6JA 1PPPA 2DC9A 1NL6A 4QH6A 4RY2A 1Y4HA 4CDFB 6PADA 4OEMA 1U9VA 4PP1A 2FTDA 1EWMA 1F2CA 3RVXA 3IEJA 1F29A 3H89A 2DZYA 4YYVA 2BDLA 1CSBB 4WA6A 4X6HA 1YVBA 4ZUXU 1AU2A 1YK8A 1U5IA 4G54A 3S3QA 2DC7A 4W5BA 5J94A 3H7DA 3HHAA 1NB3A 2FRAA 3MHSA 1U9QX 3H6SA 2IBIA 1STFE 3IOQA 4FK5A 3I06A 1QXPA 3N3KA 3D6SA 3F5VA 3LFYA 1QOLA 4X6IA 2HHNA 1F2AA 2AU1A 2XU4A 2R9MA 1CS8A 3KKUA 4BS5A 2XU5A 1AIMA 1KXRA 2AUXA 2XU1A 2E00A 4FIPA 2G8EA 4PI3A 2ARYA 1BP4A 1K3BB 3MTNA 2PADA 1PBHA 3OVXA 3H8BA 5JH3A 1QDQA 2NQAA 4Q8HA 4YYSA 3KWBX 2DC8A 3K9MA 4BQVA 3H8CA 3QJ3A 1ZIVA 2DJGB 4QRGA 1AU3A 5CVOB 1PPNA 2CIOA 2FT2A 2C0YA 1U9XA 3OVZA 5CHTA 4OELA 2ATOA 2R9NA 3M99A 2DZZA 3C9EA 1PADA 4DMXA 9PAPA 1MDWA 1MHWA 2Y5BA 4XUIA 2AVWA 4YVAA 1PE6A 3BCNA 2AUZA 1PPDA 3PBHA 3IMAA 3CBJA 4N8WA 4MSXA 4CZWA 2AYNA 3CH3X 3CH2X 2H7JA 1MEGA 1F2BA 2G6DA 2HD5A 3MHHA 1EWOA 1ICFA 1TLOA 2P86A 5CVNB 3BOWA 2P0RA 4W4UA 2R9OA 1ME3A 3USVA 4CDEB 1TL9A 3P5UA 1EF7A 1XKGA 2ACTA 1MEMA 4PP2E 3ZUAA 3RVVA 3BPFA 3PDFA 2NQIA 2FUDA 1QMYA 1JQPA 2YJ8A 2E03A 4BSQA 2G8JA 2E01A 2PBHA 4HWYA 2DCCA 1EWPA 2DCBA 3RVWA 1U9WA 1O0EA 1BGOA 1NPZA 2VHFA 3OF8A 2IPPB 3AI8A 2PREA 1ITOA 1CQDA 2AYOA 1GECE 3N3GA 3PNRA 3DF0A 3WXEA 2F1GA 3P5WA 1AU4A 3MORA 1GCBA 3P5XA 2YJCA 3WXGA 2NQDB 1GMYA 2HH5A 2O6XA 1GLOA 5K16A 2OP3A 4PADA 1ME4A 5EF4A 4CDCB 4P6GA 4W5CA 1NLJA 4AXLA 3ERVA 1PXVA 1CTEA 5FPWA 1Y08A 4K7CA 2B1NA 1YT7A 1CB5A 1CVZA 4YYQA 4N79A 1BY8A 3IHPA 5CVMA 1KFUL 2YJ2A 4CDDB 1SNKA 2WBFX 4KLBA 2P7UA 2DC6A 3BPMA 2FO5A 3B79A 2HXZA 3BWKA 2PNSA
chains in the Genus database with same CATH superfamily
2Y6EA 1FH0A 2FYEA 3BBAA 3HHIA 3KSEA 3PSEA 5F02A 3HWNA 1KHPA 1CPJA 1IWDA 1ZCMA 3OF9A 1YK7A 4QBBA 1CJLA 2R9CA 3IUTA 3QSDA 1PVJA 1MS6A 3WXFA 2G7YA 2B1MA 3GCBA 1VSNA 2BDZA 4QRVA 3PHWA 3K24A 3V6CA 3F75A 1A6RA 5CHVA 4DMYA 1AYVA 1AYUA 2FQ9A 3E1ZB 1POPA 4XR7A 2AIMA 1PPOA 2F7DA 3PW3A 2VHSA 1X9YA 3BC3A 3ZNHA 4YYRA 4I05A 4RF0A 1YALA 3CBKA 2DCDA 1Q6KA 2DCAA 2JQGR 2OULA 2NQGA 3QT4A 2OZ2A 1VJVA 1MIRA 2GHUA 3O0UA 2XU3A 4GUAA 4I07A 1AECA 2DJFB 1SP4B 2CB5A 4Q8GA 4IP3A 5JA7A 7PCKA 1AYWA 1KFXL 5A24A 3IFUA 3IV2A 1DF0A 2FRQA 3P5VA 4QRXA 4AXMA 3HD3A 2R9FA 3N4CA 4P6EA 3TMPA 3U8EA 3OISA 4ZTBA 2GFOA 2BTWB 3LXSA 5EGWA 4BS6A 2R6NA 2Z84A 1BQIA 3KWZA 3S3RA 2AS8A 4OW0A 1PIPA 2YJ9A 4I04A 2E02A 4YYUA 1DEUA 3K8UA 5E6JA 3I3TA 3O1GA 5PADA 1CV8A 1TU6A 1KHQA 4YV8A 5EZQA 3V6EA 1EWLA 1NQCA 2JQFR 3TNXA 4YYWA 3BY4A 1THEA 8PCHA 5KO3A 4FJCA 3C0RA 1ATKA 3KX1A 3MP2A 3OQCA 1M6DA 3KFQA 2HWKA 2YJBA 1AU0A 3KW9A 4N4ZA 4BPVA 1HUCB 3NHEA 1PCIA 4MZSA 3O65A 1NB5A 1S4VA 4MZOA 4X6JA 1PPPA 4IUMA 2DC9A 1NL6A 4QH6A 4RY2A 1Y4HA 4CDFB 6PADA 4OEMA 1U9VA 4PP1A 2FTDA 1EWMA 4BOUA 1F2CA 3PRMA 3RVXA 3IEJA 4OVZB 1F29A 2FE8A 2DZYA 3H89A 4YYVA 2BDLA 1CSBB 4MM3B 4M0WA 4D8EA 4WA6A 5JZEA 4X6HA 1YVBA 4ZUXU 4RKXA 1AU2A 4A5UA 1YK8A 1U5IA 4G54A 3S3QA 2DC7A 4W5BA 5EZSA 3W30A 5J94A 3H7DA 3HHAA 1NB3A 2FRAA 3PHXA 3MHSA 1U9QX 3H6SA 2IBIA 1STFE 3IOQA 4FK5A 3I06A 2J7QA 4BOQA 1QXPA 3N3KA 3D6SA 3F5VA 3LFYA 4BOPA 1QOLA 2BTWA 4X6IA 2HHNA 4PT5A 1F2AA 2AU1A 2XU4A 2R9MA 1CS8A 3KKUA 4BS5A 2XU5A 1AIMA 1KXRA 2AUXA 2XU1A 3PRPA 2E00A 2J7QC 4RNAA 2JRIA 4FIPA 2G8EA 4PI3A 3TRKA 2ARYA 1BP4A 1K3BB 3MTNA 2PADA 1PBHA 3OVXA 4OVZA 3H8BA 5JH3A 1QDQA 2NQAA 4Q8HA 4YYSA 3KWBX 2DC8A 3K9MA 4BQVA 3H8CA 3QJ3A 1ZIVA 4D8BA 2DJGB 4QRGA 1AU3A 5CVOB 1PPNA 2CIOA 2FT2A 2C0YA 1U9XA 3OVZA 5CHTA 4D8IA 4OELA 2ATOA 2R9NA 3M99A 2DZZA 3C9EA 1PADA 4DMXA 1DKIA 3B21A 9PAPA 4P16A 1UKFA 1MDWA 1MHWA 2Y5BA 4XUIA 2AVWA 4YVAA 1PE6A 3BCNA 2AUZA 3MTVA 3MJ5A 1PPDA 3PBHA 3IMAA 1YZBA 3CBJA 4N8WA 4MSXA 4CZWA 2AYNA 4HXDB 3CH3X 3CH2X 4BOZA 2H7JA 1MEGA 1F2BA 2G6DA 2HD5A 3MHHA 1EWOA 3PHUA 1ICFA 1TLOA 2P86A 4MI7A 5CVNB 3BOWA 2P0RA 4W4UA 2R9OA 1ME3A 3USVA 4RF1A 4CDEB 1TL9A 3P5UA 1EF7A 1XKGA 2ACTA 1MEMA 4PP2E 3ZUAA 3RVVA 3BPFA 3PDFA 4BOSA 3RNVA 4REZA 2NQIA 2FUDA 1QMYA 1JQPA 3E9SA 2YJ8A 2E03A 4BSQA 2G8JA 2E01A 2BU3A 2PBHA 4HWYA 2DCCA 1EWPA 2AGAA 2DCBA 2UZJA 3RVWA 1U9WA 1O0EA 3BB7A 1BGOA 1NPZA 2VHFA 3OF8A 2IPPB 3AI8A 2PREA 1ITOA 1CQDA 2AYOA 1GECE 2JTCA 3N3GA 3PNRA 3DF0A 2F1GA 3WXEA 3P5WA 1AU4A 3MORA 1GCBA 3P5XA 2YJCA 3WXGA 2NQDB 1GMYA 2HH5A 2O6XA 1GLOA 4WURA 5K16A 2OP3A 4PADA 1ME4A 5EF4A 4CDCB 4P6GA 3PT2A 4W5CA 1NLJA 4AXLA 3ERVA 1PXVA 1CTEA 5FPWA 1Y08A 4K7CA 4R3DA 2B1NA 1YT7A 1CB5A 1CVZA 4YYQA 4XZXA 4N79A 1BY8A 3IHPA 5CVMA 1KFUL 2YJ2A 4CDDB 1SNKA 2WBFX 4KLBA 2P7UA 3W31A 2DC6A 3BPMA 2FO5A 3B79A 2DOSA 2HXZA 3BWKA 2PNSA
chains in the Genus database with same CATH topology
2Y6EA 1FH0A 2FYEA 5F02A 3HHIA 3KSEA 3HWNA 1KHPA 1CPJA 1IWDA 1ZCMA 3OF9A 1YK7A 4QBBA 1CJLA 2R9CA 3IUTA 3QSDA 1MS6A 3WXFA 2G7YA 2B1MA 3GCBA 1VSNA 2BDZA 4QRVA 1GX3A 3K24A 3V6CA 3F75A 1A6RA 5CHVA 4DMYA 1AYVA 1AYUA 2FQ9A 3E1ZB 1POPA 4XR7A 2AIMA 1PPOA 2F7DA 3PW3A 2VHSA 1X9YA 3BC3A 4YYRA 4I05A 1YALA 3CBKA 2DCDA 1Q6KA 2DCAA 2JQGR 2OULA 2NQGA 3QT4A 2OZ2A 1VJVA 1MIRA 2GHUA 3O0UA 2XU3A 4I07A 1AECA 2DJFB 1SP4B 2CB5A 4Q8GA 5JA7A 7PCKA 1AYWA 1W4TA 1KFXL 5A24A 3IV2A 1DF0A 2FRQA 3P5VA 4QRXA 4AXMA 3HD3A 2R9FA 3D9WA 3N4CA 4P6EA 3U8EA 2BSZA 3OISA 2GFOA 3LXSA 5EGWA 4BS6A 2R6NA 1BQIA 3KWZA 3S3RA 2AS8A 1PIPA 2YJ9A 4I04A 2E02A 4YYUA 1DEUA 3K8UA 3I3TA 3O1GA 5PADA 1CV8A 1TU6A 4NV8A 1KHQA 4YV8A 3V6EA 1EWLA 1NQCA 2JQFR 3TNXA 4YYWA 1THEA 8PCHA 4FJCA 1ATKA 3KX1A 1M6DA 3KFQA 2YJBA 1AU0A 3KW9A 4N4ZA 4BPVA 1HUCB 3NHEA 1PCIA 4MZSA 1NB5A 1S4VA 4MZOA 4X6JA 1PPPA 2DC9A 1NL6A 4QH6A 4RY2A 1Y4HA 4CDFB 6PADA 4OEMA 1U9VA 4PP1A 2FTDA 1EWMA 1F2CA 3RVXA 3IEJA 1F29A 3H89A 2DZYA 4YYVA 2BDLA 1CSBB 4WA6A 4X6HA 1YVBA 4ZUXU 1AU2A 1YK8A 1U5IA 4G54A 3S3QA 2DC7A 4W5BA 5J94A 3H7DA 3HHAA 1NB3A 2FRAA 3MHSA 1U9QX 3H6SA 2IBIA 1STFE 3IOQA 4FK5A 4NV7A 3I06A 1QXPA 3N3KA 3D6SA 3F5VA 3LFYA 1QOLA 4X6IA 2HHNA 1F2AA 2AU1A 2XU4A 2R9MA 1CS8A 3KKUA 4BS5A 2XU5A 1AIMA 1KXRA 2AUXA 2XU1A 2E00A 4FIPA 2G8EA 4PI3A 2VFCA 3LTWA 2ARYA 1BP4A 1K3BB 3MTNA 2PADA 1PBHA 3OVXA 3H8BA 5JH3A 1QDQA 2NQAA 4Q8HA 4YYSA 3KWBX 2DC8A 3K9MA 4BQVA 3H8CA 3QJ3A 1ZIVA 2DJGB 4QRGA 1AU3A 5CVOB 1PPNA 2CIOA 2FT2A 2C0YA 1U9XA 3OVZA 5CHTA 4OELA 2ATOA 2R9NA 3M99A 2DZZA 3C9EA 1PADA 4DMXA 9PAPA 1MDWA 1MHWA 2Y5BA 4XUIA 4GUZA 2AVWA 4YVAA 1PE6A 3BCNA 2AUZA 1PPDA 3PBHA 3IMAA 3CBJA 4N8WA 4MSXA 4CZWA 2AYNA 3CH3X 3CH2X 2H7JA 1MEGA 1F2BA 2G6DA 2HD5A 3MHHA 1EWOA 1ICFA 1TLOA 2P86A 5CVNB 3BOWA 2P0RA 4W4UA 2R9OA 1ME3A 3USVA 4CDEB 1TL9A 3P5UA 4C5PA 1EF7A 1XKGA 2ACTA 1MEMA 4PP2E 3ZUAA 3RVVA 3BPFA 3PDFA 2NQIA 2FUDA 1QMYA 1JQPA 2VFBA 2YJ8A 2E03A 4BSQA 4B55A 2G8JA 2E01A 2PBHA 4HWYA 2DCCA 1EWPA 2DCBA 3RVWA 1U9WA 1O0EA 1BGOA 1NPZA 2VHFA 3OF8A 2IPPB 3AI8A 1E2TA 1ITOA 1CQDA 2AYOA 2PREA 1GECE 3N3GA 3PNRA 3DF0A 2F1GA 3WXEA 3P5WA 1AU4A 3MORA 1GCBA 3P5XA 2YJCA 3WXGA 2NQDB 1GMYA 2HH5A 2O6XA 1GLOA 1W6FA 5K16A 2OP3A 4PADA 1ME4A 5EF4A 4CDCB 4P6GA 4W5CA 1NLJA 4AXLA 3ERVA 1PXVA 1CTEA 5FPWA 4BGFA 1Y08A 4K7CA 2B1NA 1YT7A 1CB5A 1CVZA 4YYQA 4N79A 1BY8A 3IHPA 5CVMA 1KFUL 2YJ2A 4CDDB 1SNKA 2WBFX 4KLBA 2P7UA 2DC6A 3BPMA 2FO5A 3B79A 1W5RA 2HXZA 3BWKA 2PNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y6E A;  1FH0 A;  2FYE A;  5F02 A;  3HHI A;  3KSE A;  3HWN A;  1KHP A;  1CPJ A;  1IWD A;  1ZCM A;  3OF9 A;  1YK7 A;  4QBB A;  1CJL A;  2R9C A;  3IUT A;  3QSD A;  1MS6 A;  3WXF A;  2G7Y A;  2B1M A;  3GCB A;  1VSN A;  2BDZ A;  4QRV A;  3K24 A;  3V6C A;  3F75 A;  1A6R A;  5CHV A;  4DMY A;  1AYV A;  1AYU A;  2FQ9 A;  3E1Z B;  1POP A;  4XR7 A;  2AIM A;  1PPO A;  2F7D A;  3PW3 A;  2VHS A;  1X9Y A;  3BC3 A;  4YYR A;  4I05 A;  1YAL A;  3CBK A;  2DCD A;  1Q6K A;  2DCA A;  2JQG R;  2OUL A;  2NQG A;  3QT4 A;  2OZ2 A;  1VJV A;  1MIR A;  2GHU A;  3O0U A;  2XU3 A;  4I07 A;  1AEC A;  2DJF B;  1SP4 B;  2CB5 A;  4Q8G A;  5JA7 A;  7PCK A;  1AYW A;  1KFX L;  5A24 A;  3IV2 A;  1DF0 A;  2FRQ A;  3P5V A;  4QRX A;  4AXM A;  3HD3 A;  2R9F A;  3N4C A;  4P6E A;  3U8E A;  3OIS A;  2GFO A;  3LXS A;  5EGW A;  4BS6 A;  2R6N A;  1BQI A;  3KWZ A;  3S3R A;  2AS8 A;  1PIP A;  2YJ9 A;  4I04 A;  2E02 A;  4YYU A;  1DEU A;  3K8U A;  3I3T A;  3O1G A;  5PAD A;  1CV8 A;  1TU6 A;  1KHQ A;  4YV8 A;  3V6E A;  1EWL A;  1NQC A;  2JQF R;  3TNX A;  4YYW A;  1THE A;  8PCH A;  4FJC A;  1ATK A;  3KX1 A;  1M6D A;  3KFQ A;  2YJB A;  1AU0 A;  3KW9 A;  4N4Z A;  4BPV A;  1HUC B;  3NHE A;  1PCI A;  4MZS A;  1NB5 A;  1S4V A;  4MZO A;  4X6J A;  1PPP A;  2DC9 A;  1NL6 A;  4QH6 A;  4RY2 A;  1Y4H A;  4CDF B;  6PAD A;  4OEM A;  1U9V A;  4PP1 A;  2FTD A;  1EWM A;  1F2C A;  3RVX A;  3IEJ A;  1F29 A;  3H89 A;  2DZY A;  4YYV A;  2BDL A;  1CSB B;  4WA6 A;  4X6H A;  1YVB A;  4ZUX U;  1AU2 A;  1YK8 A;  1U5I A;  4G54 A;  3S3Q A;  2DC7 A;  4W5B A;  5J94 A;  3H7D A;  3HHA A;  1NB3 A;  2FRA A;  3MHS A;  1U9Q X;  3H6S A;  2IBI A;  1STF E;  3IOQ A;  4FK5 A;  3I06 A;  1QXP A;  3N3K A;  3D6S A;  3F5V A;  3LFY A;  1QOL A;  4X6I A;  2HHN A;  1F2A A;  2AU1 A;  2XU4 A;  2R9M A;  1CS8 A;  3KKU A;  4BS5 A;  2XU5 A;  1AIM A;  1KXR A;  2AUX A;  2XU1 A;  2E00 A;  4FIP A;  2G8E A;  4PI3 A;  2ARY A;  1BP4 A;  1K3B B;  3MTN A;  2PAD A;  1PBH A;  3OVX A;  3H8B A;  5JH3 A;  1QDQ A;  2NQA A;  4Q8H A;  4YYS A;  3KWB X;  2DC8 A;  3K9M A;  4BQV A;  3H8C A;  3QJ3 A;  1ZIV A;  2DJG B;  4QRG A;  1AU3 A;  5CVO B;  1PPN A;  2CIO A;  2FT2 A;  2C0Y A;  1U9X A;  3OVZ A;  5CHT A;  4OEL A;  2ATO A;  2R9N A;  3M99 A;  2DZZ A;  3C9E A;  1PAD A;  4DMX A;  9PAP A;  1MDW A;  1MHW A;  2Y5B A;  4XUI A;  2AVW A;  4YVA A;  1PE6 A;  3BCN A;  2AUZ A;  1PPD A;  3PBH A;  3IMA A;  3CBJ A;  4N8W A;  4MSX A;  4CZW A;  2AYN A;  3CH3 X;  3CH2 X;  2H7J A;  1MEG A;  1F2B A;  2G6D A;  2HD5 A;  3MHH A;  1EWO A;  1ICF A;  1TLO A;  2P86 A;  5CVN B;  3BOW A;  2P0R A;  4W4U A;  2R9O A;  1ME3 A;  3USV A;  4CDE B;  1TL9 A;  3P5U A;  1EF7 A;  1XKG A;  2ACT A;  1MEM A;  4PP2 E;  3ZUA A;  3RVV A;  3BPF A;  3PDF A;  2NQI A;  2FUD A;  1QMY A;  1JQP A;  2YJ8 A;  2E03 A;  4BSQ A;  2G8J A;  2E01 A;  2PBH A;  4HWY A;  2DCC A;  1EWP A;  2DCB A;  3RVW A;  1U9W A;  1O0E A;  1BGO A;  1NPZ A;  2VHF A;  3OF8 A;  2IPP B;  3AI8 A;  2PRE A;  1ITO A;  1CQD A;  2AYO A;  1GEC E;  3N3G A;  3PNR A;  3DF0 A;  3WXE A;  2F1G A;  3P5W A;  1AU4 A;  3MOR A;  1GCB A;  3P5X A;  2YJC A;  3WXG A;  2NQD B;  1GMY A;  2HH5 A;  2O6X A;  1GLO A;  5K16 A;  2OP3 A;  4PAD A;  1ME4 A;  5EF4 A;  4CDC B;  4P6G A;  4W5C A;  1NLJ A;  4AXL A;  3ERV A;  1PXV A;  1CTE A;  5FPW A;  1Y08 A;  4K7C A;  2B1N A;  1YT7 A;  1CB5 A;  1CVZ A;  4YYQ A;  4N79 A;  1BY8 A;  3IHP A;  5CVM A;  1KFU L;  2YJ2 A;  4CDD B;  1SNK A;  2WBF X;  4KLB A;  2P7U A;  2DC6 A;  3BPM A;  2FO5 A;  3B79 A;  2HXZ A;  3BWK A;  2PNS A; 
#chains in the Genus database with same CATH topology
 2Y6E A;  1FH0 A;  2FYE A;  3BBA A;  3HHI A;  3KSE A;  3PSE A;  5F02 A;  3HWN A;  1KHP A;  1CPJ A;  1IWD A;  1ZCM A;  3OF9 A;  1YK7 A;  4QBB A;  1CJL A;  2R9C A;  3IUT A;  3QSD A;  1PVJ A;  1MS6 A;  3WXF A;  2G7Y A;  2B1M A;  3GCB A;  1VSN A;  2BDZ A;  4QRV A;  3PHW A;  3K24 A;  3V6C A;  3F75 A;  1A6R A;  5CHV A;  4DMY A;  1AYV A;  1AYU A;  2FQ9 A;  3E1Z B;  1POP A;  4XR7 A;  2AIM A;  1PPO A;  2F7D A;  3PW3 A;  2VHS A;  1X9Y A;  3BC3 A;  3ZNH A;  4YYR A;  4I05 A;  4RF0 A;  1YAL A;  3CBK A;  2DCD A;  1Q6K A;  2DCA A;  2JQG R;  2OUL A;  2NQG A;  3QT4 A;  2OZ2 A;  1VJV A;  1MIR A;  2GHU A;  3O0U A;  2XU3 A;  4GUA A;  4I07 A;  1AEC A;  2DJF B;  1SP4 B;  2CB5 A;  4Q8G A;  4IP3 A;  5JA7 A;  7PCK A;  1AYW A;  1KFX L;  5A24 A;  3IFU A;  3IV2 A;  1DF0 A;  2FRQ A;  3P5V A;  4QRX A;  4AXM A;  3HD3 A;  2R9F A;  3N4C A;  4P6E A;  3TMP A;  3U8E A;  3OIS A;  4ZTB A;  2GFO A;  2BTW B;  3LXS A;  5EGW A;  4BS6 A;  2R6N A;  2Z84 A;  1BQI A;  3KWZ A;  3S3R A;  2AS8 A;  4OW0 A;  1PIP A;  2YJ9 A;  4I04 A;  2E02 A;  4YYU A;  1DEU A;  3K8U A;  5E6J A;  3I3T A;  3O1G A;  5PAD A;  1CV8 A;  1TU6 A;  1KHQ A;  4YV8 A;  5EZQ A;  3V6E A;  1EWL A;  1NQC A;  2JQF R;  3TNX A;  4YYW A;  3BY4 A;  1THE A;  8PCH A;  5KO3 A;  4FJC A;  3C0R A;  1ATK A;  3KX1 A;  3MP2 A;  3OQC A;  1M6D A;  3KFQ A;  2HWK A;  2YJB A;  1AU0 A;  3KW9 A;  4N4Z A;  4BPV A;  1HUC B;  3NHE A;  1PCI A;  4MZS A;  3O65 A;  1NB5 A;  1S4V A;  4MZO A;  4X6J A;  1PPP A;  4IUM A;  2DC9 A;  1NL6 A;  4QH6 A;  4RY2 A;  1Y4H A;  4CDF B;  6PAD A;  4OEM A;  1U9V A;  4PP1 A;  2FTD A;  1EWM A;  4BOU A;  1F2C A;  3PRM A;  3RVX A;  3IEJ A;  4OVZ B;  1F29 A;  2FE8 A;  2DZY A;  3H89 A;  4YYV A;  2BDL A;  1CSB B;  4MM3 B;  4M0W A;  4D8E A;  4WA6 A;  5JZE A;  4X6H A;  1YVB A;  4ZUX U;  4RKX A;  1AU2 A;  4A5U A;  1YK8 A;  1U5I A;  4G54 A;  3S3Q A;  2DC7 A;  4W5B A;  5EZS A;  3W30 A;  5J94 A;  3H7D A;  3HHA A;  1NB3 A;  2FRA A;  3PHX A;  3MHS A;  1U9Q X;  3H6S A;  2IBI A;  1STF E;  3IOQ A;  4FK5 A;  3I06 A;  2J7Q A;  4BOQ A;  1QXP A;  3N3K A;  3D6S A;  3F5V A;  3LFY A;  4BOP A;  1QOL A;  2BTW A;  4X6I A;  2HHN A;  4PT5 A;  1F2A A;  2AU1 A;  2XU4 A;  2R9M A;  1CS8 A;  3KKU A;  4BS5 A;  2XU5 A;  1AIM A;  1KXR A;  2AUX A;  2XU1 A;  3PRP A;  2E00 A;  2J7Q C;  4RNA A;  2JRI A;  4FIP A;  2G8E A;  4PI3 A;  3TRK A;  2ARY A;  1BP4 A;  1K3B B;  3MTN A;  2PAD A;  1PBH A;  3OVX A;  4OVZ A;  3H8B A;  5JH3 A;  1QDQ A;  2NQA A;  4Q8H A;  4YYS A;  3KWB X;  2DC8 A;  3K9M A;  4BQV A;  3H8C A;  3QJ3 A;  1ZIV A;  4D8B A;  2DJG B;  4QRG A;  1AU3 A;  5CVO B;  1PPN A;  2CIO A;  2FT2 A;  2C0Y A;  1U9X A;  3OVZ A;  5CHT A;  4D8I A;  4OEL A;  2ATO A;  2R9N A;  3M99 A;  2DZZ A;  3C9E A;  1PAD A;  4DMX A;  1DKI A;  3B21 A;  9PAP A;  4P16 A;  1UKF A;  1MDW A;  1MHW A;  2Y5B A;  4XUI A;  2AVW A;  4YVA A;  1PE6 A;  3BCN A;  2AUZ A;  3MTV A;  3MJ5 A;  1PPD A;  3PBH A;  3IMA A;  1YZB A;  3CBJ A;  4N8W A;  4MSX A;  4CZW A;  2AYN A;  4HXD B;  3CH3 X;  3CH2 X;  4BOZ A;  2H7J A;  1MEG A;  1F2B A;  2G6D A;  2HD5 A;  3MHH A;  1EWO A;  3PHU A;  1ICF A;  1TLO A;  2P86 A;  4MI7 A;  5CVN B;  3BOW A;  2P0R A;  4W4U A;  2R9O A;  1ME3 A;  3USV A;  4RF1 A;  4CDE B;  1TL9 A;  3P5U A;  1EF7 A;  1XKG A;  2ACT A;  1MEM A;  4PP2 E;  3ZUA A;  3RVV A;  3BPF A;  3PDF A;  4BOS A;  3RNV A;  4REZ A;  2NQI A;  2FUD A;  1QMY A;  1JQP A;  3E9S A;  2YJ8 A;  2E03 A;  4BSQ A;  2G8J A;  2E01 A;  2BU3 A;  2PBH A;  4HWY A;  2DCC A;  1EWP A;  2AGA A;  2DCB A;  2UZJ A;  3RVW A;  1U9W A;  1O0E A;  3BB7 A;  1BGO A;  1NPZ A;  2VHF A;  3OF8 A;  2IPP B;  3AI8 A;  2PRE A;  1ITO A;  1CQD A;  2AYO A;  1GEC E;  2JTC A;  3N3G A;  3PNR A;  3DF0 A;  2F1G A;  3WXE A;  3P5W A;  1AU4 A;  3MOR A;  1GCB A;  3P5X A;  2YJC A;  3WXG A;  2NQD B;  1GMY A;  2HH5 A;  2O6X A;  1GLO A;  4WUR A;  5K16 A;  2OP3 A;  4PAD A;  1ME4 A;  5EF4 A;  4CDC B;  4P6G A;  3PT2 A;  4W5C A;  1NLJ A;  4AXL A;  3ERV A;  1PXV A;  1CTE A;  5FPW A;  1Y08 A;  4K7C A;  4R3D A;  2B1N A;  1YT7 A;  1CB5 A;  1CVZ A;  4YYQ A;  4XZX A;  4N79 A;  1BY8 A;  3IHP A;  5CVM A;  1KFU L;  2YJ2 A;  4CDD B;  1SNK A;  2WBF X;  4KLB A;  2P7U A;  3W31 A;  2DC6 A;  3BPM A;  2FO5 A;  3B79 A;  2DOS A;  2HXZ A;  3BWK A;  2PNS A; 
#chains in the Genus database with same CATH homology
 2Y6E A;  1FH0 A;  2FYE A;  5F02 A;  3HHI A;  3KSE A;  3HWN A;  1KHP A;  1CPJ A;  1IWD A;  1ZCM A;  3OF9 A;  1YK7 A;  4QBB A;  1CJL A;  2R9C A;  3IUT A;  3QSD A;  1MS6 A;  3WXF A;  2G7Y A;  2B1M A;  3GCB A;  1VSN A;  2BDZ A;  4QRV A;  1GX3 A;  3K24 A;  3V6C A;  3F75 A;  1A6R A;  5CHV A;  4DMY A;  1AYV A;  1AYU A;  2FQ9 A;  3E1Z B;  1POP A;  4XR7 A;  2AIM A;  1PPO A;  2F7D A;  3PW3 A;  2VHS A;  1X9Y A;  3BC3 A;  4YYR A;  4I05 A;  1YAL A;  3CBK A;  2DCD A;  1Q6K A;  2DCA A;  2JQG R;  2OUL A;  2NQG A;  3QT4 A;  2OZ2 A;  1VJV A;  1MIR A;  2GHU A;  3O0U A;  2XU3 A;  4I07 A;  1AEC A;  2DJF B;  1SP4 B;  2CB5 A;  4Q8G A;  5JA7 A;  7PCK A;  1AYW A;  1W4T A;  1KFX L;  5A24 A;  3IV2 A;  1DF0 A;  2FRQ A;  3P5V A;  4QRX A;  4AXM A;  3HD3 A;  2R9F A;  3D9W A;  3N4C A;  4P6E A;  3U8E A;  2BSZ A;  3OIS A;  2GFO A;  3LXS A;  5EGW A;  4BS6 A;  2R6N A;  1BQI A;  3KWZ A;  3S3R A;  2AS8 A;  1PIP A;  2YJ9 A;  4I04 A;  2E02 A;  4YYU A;  1DEU A;  3K8U A;  3I3T A;  3O1G A;  5PAD A;  1CV8 A;  1TU6 A;  4NV8 A;  1KHQ A;  4YV8 A;  3V6E A;  1EWL A;  1NQC A;  2JQF R;  3TNX A;  4YYW A;  1THE A;  8PCH A;  4FJC A;  1ATK A;  3KX1 A;  1M6D A;  3KFQ A;  2YJB A;  1AU0 A;  3KW9 A;  4N4Z A;  4BPV A;  1HUC B;  3NHE A;  1PCI A;  4MZS A;  1NB5 A;  1S4V A;  4MZO A;  4X6J A;  1PPP A;  2DC9 A;  1NL6 A;  4QH6 A;  4RY2 A;  1Y4H A;  4CDF B;  6PAD A;  4OEM A;  1U9V A;  4PP1 A;  2FTD A;  1EWM A;  1F2C A;  3RVX A;  3IEJ A;  1F29 A;  3H89 A;  2DZY A;  4YYV A;  2BDL A;  1CSB B;  4WA6 A;  4X6H A;  1YVB A;  4ZUX U;  1AU2 A;  1YK8 A;  1U5I A;  4G54 A;  3S3Q A;  2DC7 A;  4W5B A;  5J94 A;  3H7D A;  3HHA A;  1NB3 A;  2FRA A;  3MHS A;  1U9Q X;  3H6S A;  2IBI A;  1STF E;  3IOQ A;  4FK5 A;  4NV7 A;  3I06 A;  1QXP A;  3N3K A;  3D6S A;  3F5V A;  3LFY A;  1QOL A;  4X6I A;  2HHN A;  1F2A A;  2AU1 A;  2XU4 A;  2R9M A;  1CS8 A;  3KKU A;  4BS5 A;  2XU5 A;  1AIM A;  1KXR A;  2AUX A;  2XU1 A;  2E00 A;  4FIP A;  2G8E A;  4PI3 A;  2VFC A;  3LTW A;  2ARY A;  1BP4 A;  1K3B B;  3MTN A;  2PAD A;  1PBH A;  3OVX A;  3H8B A;  5JH3 A;  1QDQ A;  2NQA A;  4Q8H A;  4YYS A;  3KWB X;  2DC8 A;  3K9M A;  4BQV A;  3H8C A;  3QJ3 A;  1ZIV A;  2DJG B;  4QRG A;  1AU3 A;  5CVO B;  1PPN A;  2CIO A;  2FT2 A;  2C0Y A;  1U9X A;  3OVZ A;  5CHT A;  4OEL A;  2ATO A;  2R9N A;  3M99 A;  2DZZ A;  3C9E A;  1PAD A;  4DMX A;  9PAP A;  1MDW A;  1MHW A;  2Y5B A;  4XUI A;  4GUZ A;  2AVW A;  4YVA A;  1PE6 A;  3BCN A;  2AUZ A;  1PPD A;  3PBH A;  3IMA A;  3CBJ A;  4N8W A;  4MSX A;  4CZW A;  2AYN A;  3CH3 X;  3CH2 X;  2H7J A;  1MEG A;  1F2B A;  2G6D A;  2HD5 A;  3MHH A;  1EWO A;  1ICF A;  1TLO A;  2P86 A;  5CVN B;  3BOW A;  2P0R A;  4W4U A;  2R9O A;  1ME3 A;  3USV A;  4CDE B;  1TL9 A;  3P5U A;  4C5P A;  1EF7 A;  1XKG A;  2ACT A;  1MEM A;  4PP2 E;  3ZUA A;  3RVV A;  3BPF A;  3PDF A;  2NQI A;  2FUD A;  1QMY A;  1JQP A;  2VFB A;  2YJ8 A;  2E03 A;  4BSQ A;  4B55 A;  2G8J A;  2E01 A;  2PBH A;  4HWY A;  2DCC A;  1EWP A;  2DCB A;  3RVW A;  1U9W A;  1O0E A;  1BGO A;  1NPZ A;  2VHF A;  3OF8 A;  2IPP B;  3AI8 A;  1E2T A;  1ITO A;  1CQD A;  2AYO A;  2PRE A;  1GEC E;  3N3G A;  3PNR A;  3DF0 A;  2F1G A;  3WXE A;  3P5W A;  1AU4 A;  3MOR A;  1GCB A;  3P5X A;  2YJC A;  3WXG A;  2NQD B;  1GMY A;  2HH5 A;  2O6X A;  1GLO A;  1W6F A;  5K16 A;  2OP3 A;  4PAD A;  1ME4 A;  5EF4 A;  4CDC B;  4P6G A;  4W5C A;  1NLJ A;  4AXL A;  3ERV A;  1PXV A;  1CTE A;  5FPW A;  4BGF A;  1Y08 A;  4K7C A;  2B1N A;  1YT7 A;  1CB5 A;  1CVZ A;  4YYQ A;  4N79 A;  1BY8 A;  3IHP A;  5CVM A;  1KFU L;  2YJ2 A;  4CDD B;  1SNK A;  2WBF X;  4KLB A;  2P7U A;  2DC6 A;  3BPM A;  2FO5 A;  3B79 A;  1W5R A;  2HXZ A;  3BWK A;  2PNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...