4BS6A

Mouse cathepsin s with covalent ligand
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
219
structure length
219
Chain Sequence
TLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKAMDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cathepsin S Nitrile Inhibitors
rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords CATHEPSIN S
total genus 63
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2013-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4bs6A00
5PADA 5FPWA 4QRGA 2E01A 3BOWA 1VSNA 3KW9A 2WBFX 1PE6A 1EWPA 2CB5A 4X6HA 2AU1A 1IWDA 2HHNA 1Q6KA 1HUCB 3HHAA 3RVVA 3KFQA 2OULA 2G7YA 2ATOA 3HD3A 1TU6A 3IEJA 2CIOA 4BPVA 2PREA 1SNKA 4RY2A 1CB5A 4DMYA 3TNXA 3P5UA 2HXZA 3KWBX 4BSQA 1CS8A 4Q8HA 2IBIA 4I05A 2DCDA 1DF0A 4FIPA 1PPPA 1U5IA 2YJ2A 1U9QX 1GCBA 1AYVA 4XUIA 2YJBA 4DMXA 5CVMA 4CDFB 5JH3A 1NPZA 8PCHA 3WXEA 1NLJA 1GLOA 5CVOB 2VHSA 4HWYA 1STFE 1PXVA 1M6DA 1Y4HA 3P5VA 4P6GA 1O0EA 2GFOA 2P7UA 3F5VA 3QJ3A 1POPA 4G54A 3V6EA 1Y08A 3AI8A 1AU3A 2DC6A 2NQAA 4PI3A 2E02A 2AIMA 2G8JA 1U9VA 1KHPA 2P86A 2XU5A 4YYSA 3N4CA 2DC9A 3I3TA 1NL6A 3HHIA 2B1MA 1EWOA 1KHQA 2FT2A 3MTNA 1K3BB 2BDLA 1GMYA 2OP3A 1KFXL 3P5WA 4YYVA 2G6DA 4WA6A 3IOQA 5JA7A 2FUDA 2PNSA 3HWNA 1XKGA 1YVBA 3N3KA 4I07A 4QBBA 1ITOA 2G8EA 4QH6A 1PCIA 3BWKA 3KWZA 3BCNA 1DEUA 4CDEB 4BS5A 2DC7A 2ARYA 1EWMA 3RVWA 1MS6A 4KLBA 2PBHA 4YYWA 2Y6EA 2NQGA 2XU3A 1NQCA 2FYEA 1AECA 3M99A 4X6JA 2NQIA 4BS6A 3DF0A 4W5CA 3NHEA 3BPFA 2C0YA 2R9FA 4CDCB 4YYUA 2R9MA 3OF8A 3KKUA 3IHPA 1THEA 1KXRA 2FO5A 2DCCA 4K7CA 3LXSA 3QT4A 3PNRA 5CHVA 2AUZA 4X6IA 2AYOA 3OF9A 1F2BA 1MIRA 4P6EA 2YJ9A 1ME4A 4W5BA 4OEMA 3C9EA 2R6NA 1QDQA 3OVXA 1NB3A 1CSBB 1SP4B 1BQIA 1AYWA 4PADA 1AU0A 3GCBA 2YJ8A 3CH3X 3N3GA 4XR7A 4PP1A 2YJCA 3U8EA 3H7DA 3RVXA 1F29A 2VHFA 1CV8A 2AUXA 4QRXA 1CJLA 4W4UA 3H8CA 1AYUA 1MHWA 1PPNA 2NQDB 1F2CA 2DZYA 4Q8GA 1KFUL 2OZ2A 5EF4A 4AXMA 2FQ9A 2E00A 2FRAA 1PPDA 4N79A 1YK8A 1TL9A 9PAPA 3V6CA 3OVZA 1QMYA 3H89A 2AVWA 3O0UA 1U9XA 2F7DA 5CVNB 3K24A 1VJVA 3BPMA 2FRQA 4MZSA 3MHHA 3H6SA 1TLOA 1ZCMA 3ZUAA 1ICFA 1EWLA 3KX1A 1BGOA 1CTEA 4YYRA 1FH0A 2BDZA 1BP4A 1QOLA 3CH2X 2JQFR 7PCKA 1GECE 1MEGA 2IPPB 1EF7A 1QXPA 3CBKA 2O6XA 2R9CA 4BQVA 4FJCA 3QSDA 3ERVA 2AYNA 4ZUXU 3S3RA 2E03A 1AU4A 1CQDA 5CHTA 3F75A 2DJFB 2XU1A 1AU2A 1ZIVA 1ME3A 2JQGR 1F2AA 3MHSA 4PP2E 4YYQA 5K16A 4FK5A 2XU4A 4YV8A 1U9WA 2DJGB 1YALA 3IMAA 2HD5A 4MZOA 1PADA 5EGWA 1CVZA 3E1ZB 3H8BA 3WXFA 3B79A 3K9MA 1PPOA 1YT7A 2PADA 2P0RA 2R9NA 3PBHA 4YVAA 4I04A 4QRVA 3USVA 1BY8A 3OISA 1X9YA 1PBHA 1JQPA 4N4ZA 4OELA 4AXLA 2DCBA 6PADA 3BC3A 4N8WA 3LFYA 3P5XA 2ACTA 3WXGA 1NB5A 1S4VA 3I06A 2F1GA 2GHUA 1A6RA 1ATKA 3K8UA 3IUTA 1CPJA 3D6SA 3PW3A 2DCAA 3KSEA 5F02A 4MSXA 4CDDB 2B1NA 3MORA 1YK7A 2FTDA 3PDFA 2DC8A 2DZZA 2HH5A 1PIPA 2AS8A 1MEMA 5J94A 2H7JA 2R9OA 2Y5BA 1AIMA 1MDWA 3O1GA 3S3QA 3CBJA 3IV2A 5A24A 4CZWA
chains in the Genus database with same CATH superfamily
5PADA 5FPWA 4QRGA 2E01A 3RNVA 3BOWA 1VSNA 3KW9A 2WBFX 1PE6A 2AGAA 3W30A 1EWPA 2CB5A 4RKXA 4X6HA 2AU1A 1IWDA 2HHNA 4A5UA 1Q6KA 4BOQA 1HUCB 3HHAA 3RVVA 3KFQA 2OULA 2G7YA 2ATOA 4P16A 3HD3A 1TU6A 3IEJA 2CIOA 4BPVA 3PHXA 2PREA 1SNKA 4RY2A 1CB5A 4DMYA 3TNXA 5EZQA 3P5UA 2HXZA 3KWBX 4BSQA 1CS8A 4Q8HA 2IBIA 4I05A 2DCDA 1DF0A 4FIPA 1PPPA 1U5IA 2YJ2A 1U9QX 1GCBA 4PT5A 1AYVA 4XUIA 2YJBA 4DMXA 5CVMA 4CDFB 5JH3A 1NPZA 8PCHA 3WXEA 4IUMA 1NLJA 1GLOA 5CVOB 2VHSA 4HWYA 1STFE 1PXVA 1M6DA 1Y4HA 3P5VA 4P6GA 1O0EA 2GFOA 2P7UA 3F5VA 3QJ3A 1POPA 4G54A 3V6EA 1Y08A 3AI8A 1AU3A 2DC6A 2NQAA 2UZJA 4PI3A 4MM3B 2E02A 2AIMA 1UKFA 2G8JA 1U9VA 1KHPA 2P86A 2Z84A 2XU5A 2BU3A 4YYSA 4HXDB 4D8BA 4BOUA 3N4CA 2DC9A 3I3TA 1NL6A 3HHIA 2B1MA 1EWOA 1KHQA 2FT2A 3MTNA 3MP2A 1K3BB 2BDLA 1GMYA 2OP3A 1KFXL 3P5WA 4YYVA 2G6DA 4WA6A 3IOQA 5JA7A 2FUDA 2PNSA 4ZTBA 3HWNA 3B21A 1XKGA 1YVBA 3N3KA 2JTCA 4I07A 3BBAA 4QBBA 1PVJA 1ITOA 2G8EA 4QH6A 2J7QC 1PCIA 2HWKA 3BWKA 3KWZA 4BOPA 3BCNA 1DEUA 4CDEB 1YZBA 4BS5A 2DC7A 2ARYA 1EWMA 5KO3A 4OVZB 3RVWA 1MS6A 4KLBA 2PBHA 4YYWA 2Y6EA 2NQGA 2XU3A 1NQCA 2FYEA 1AECA 3M99A 4X6JA 2NQIA 4BS6A 3DF0A 4W5CA 3NHEA 3BPFA 2BTWA 2C0YA 2R9FA 4CDCB 4YYUA 2R9MA 3OF8A 3KKUA 3BY4A 3IHPA 1THEA 1KXRA 3PSEA 2FO5A 2DCCA 4XZXA 4K7CA 3LXSA 3QT4A 3PNRA 3ZNHA 4D8EA 3TMPA 5CHVA 2AUZA 4X6IA 2AYOA 3OF9A 1F2BA 1MIRA 4P6EA 2YJ9A 1ME4A 4W5BA 4OEMA 3C9EA 2R6NA 4BOZA 1QDQA 3OVXA 4OW0A 1NB3A 1CSBB 1SP4B 1BQIA 1AYWA 4PADA 1AU0A 4GUAA 3GCBA 2YJ8A 3MTVA 3CH3X 3N3GA 4RNAA 4XR7A 4PP1A 2YJCA 3U8EA 3H7DA 3RVXA 1F29A 2J7QA 2VHFA 1CV8A 2AUXA 4QRXA 1CJLA 4W4UA 3H8CA 1AYUA 1MHWA 1PPNA 2NQDB 1F2CA 2DZYA 4Q8GA 3PT2A 1KFUL 2OZ2A 5EF4A 4REZA 4AXMA 2FQ9A 2E00A 2FRAA 1PPDA 3TRKA 4N79A 1YK8A 1TL9A 9PAPA 3V6CA 3OVZA 1QMYA 3H89A 4RF1A 2AVWA 2JRIA 3W31A 3PHWA 3O0UA 1U9XA 2F7DA 3O65A 5CVNB 3K24A 1VJVA 3BPMA 5EZSA 2FRQA 4MZSA 3MHHA 3H6SA 1TLOA 1ZCMA 4R3DA 3ZUAA 3E9SA 1ICFA 1EWLA 3KX1A 1BGOA 1CTEA 4IP3A 4YYRA 1FH0A 4BOSA 2BDZA 1BP4A 3PRPA 1QOLA 3CH2X 2JQFR 7PCKA 4M0WA 1GECE 3PRMA 1MEGA 2IPPB 1EF7A 1QXPA 3CBKA 5E6JA 2O6XA 2R9CA 4BQVA 4FJCA 3QSDA 3ERVA 2AYNA 4ZUXU 3C0RA 3S3RA 2E03A 1AU4A 1CQDA 5CHTA 3F75A 4WURA 5JZEA 2DJFB 2XU1A 1AU2A 1ZIVA 1ME3A 2JQGR 1F2AA 4MI7A 3MHSA 4PP2E 4YYQA 5K16A 4FK5A 2XU4A 4YV8A 1U9WA 2DJGB 1YALA 3IMAA 2HD5A 3MJ5A 4MZOA 1PADA 5EGWA 3BB7A 3PHUA 1CVZA 3E1ZB 3H8BA 2FE8A 4OVZA 3WXFA 3B79A 3K9MA 1PPOA 1YT7A 2PADA 2P0RA 2R9NA 3PBHA 4YVAA 4I04A 4QRVA 4RF0A 3USVA 1BY8A 3OISA 1X9YA 1PBHA 1JQPA 3IFUA 4N4ZA 4OELA 4AXLA 2DCBA 6PADA 3BC3A 4N8WA 3LFYA 3P5XA 2ACTA 3WXGA 1NB5A 3OQCA 1DKIA 1S4VA 2DOSA 3I06A 2F1GA 2GHUA 1A6RA 1ATKA 3K8UA 3IUTA 1CPJA 3D6SA 3PW3A 2DCAA 3KSEA 5F02A 4MSXA 4CDDB 2B1NA 4D8IA 3MORA 1YK7A 2FTDA 3PDFA 2DC8A 2DZZA 2HH5A 1PIPA 2AS8A 1MEMA 5J94A 2H7JA 2R9OA 2Y5BA 1AIMA 1MDWA 3O1GA 3CBJA 3S3QA 3IV2A 5A24A 2BTWB 4CZWA
chains in the Genus database with same CATH topology
5PADA 5FPWA 4QRGA 2E01A 3BOWA 1VSNA 3KW9A 2WBFX 1PE6A 1EWPA 2CB5A 4X6HA 2AU1A 1IWDA 2HHNA 1Q6KA 1HUCB 3HHAA 4C5PA 3RVVA 3KFQA 2OULA 2G7YA 2ATOA 3HD3A 1TU6A 3IEJA 2CIOA 4BPVA 1W4TA 2PREA 1SNKA 4RY2A 1CB5A 4DMYA 3TNXA 3P5UA 2HXZA 3KWBX 4BSQA 1CS8A 4Q8HA 2IBIA 4I05A 2DCDA 1DF0A 4FIPA 1PPPA 1U5IA 2YJ2A 1U9QX 1GCBA 1AYVA 4XUIA 2YJBA 4DMXA 5CVMA 4CDFB 5JH3A 1NPZA 8PCHA 3WXEA 1NLJA 1GLOA 5CVOB 2VHSA 4HWYA 1STFE 1PXVA 1M6DA 1Y4HA 3P5VA 4P6GA 1O0EA 2GFOA 2P7UA 3F5VA 3QJ3A 1POPA 4G54A 3V6EA 1Y08A 3AI8A 1AU3A 2DC6A 2NQAA 4PI3A 2E02A 2AIMA 2BSZA 2G8JA 1U9VA 1KHPA 2P86A 2XU5A 4YYSA 3N4CA 2DC9A 3I3TA 1NL6A 3HHIA 2B1MA 1EWOA 1KHQA 2FT2A 3MTNA 1K3BB 2BDLA 1GMYA 2OP3A 1KFXL 3P5WA 4YYVA 2G6DA 4WA6A 3IOQA 5JA7A 2FUDA 2PNSA 3HWNA 1XKGA 1YVBA 3N3KA 4I07A 4QBBA 1ITOA 2G8EA 4QH6A 1PCIA 3BWKA 3KWZA 3BCNA 1DEUA 4CDEB 4BS5A 2DC7A 2ARYA 1EWMA 3RVWA 1MS6A 4KLBA 2PBHA 4YYWA 2Y6EA 2NQGA 2XU3A 1NQCA 2FYEA 1AECA 3M99A 1GX3A 4X6JA 2NQIA 1W5RA 4BS6A 3DF0A 4W5CA 3NHEA 3BPFA 2C0YA 2R9FA 4CDCB 4YYUA 2R9MA 3OF8A 3KKUA 3IHPA 1THEA 1KXRA 1E2TA 4NV7A 2FO5A 2DCCA 4K7CA 3LXSA 3QT4A 3PNRA 5CHVA 2AUZA 4X6IA 2AYOA 3OF9A 1F2BA 1MIRA 4P6EA 2YJ9A 1ME4A 4W5BA 4OEMA 3C9EA 2R6NA 1QDQA 3OVXA 1NB3A 1CSBB 1SP4B 1BQIA 1AYWA 4PADA 1AU0A 3GCBA 2YJ8A 3CH3X 3N3GA 4XR7A 4PP1A 2YJCA 3U8EA 3H7DA 3RVXA 1F29A 2VHFA 1CV8A 2AUXA 4QRXA 1CJLA 4W4UA 3H8CA 1AYUA 1MHWA 1PPNA 2NQDB 1F2CA 2DZYA 4Q8GA 1KFUL 2OZ2A 5EF4A 4AXMA 2FQ9A 2E00A 2VFBA 2FRAA 3LTWA 1PPDA 4N79A 1YK8A 1TL9A 9PAPA 3V6CA 3OVZA 1QMYA 3H89A 2AVWA 3O0UA 1U9XA 4BGFA 2F7DA 5CVNB 3K24A 1VJVA 3BPMA 2FRQA 4MZSA 3MHHA 3H6SA 1TLOA 1ZCMA 3ZUAA 1ICFA 1EWLA 3KX1A 1BGOA 1CTEA 4YYRA 1FH0A 2BDZA 1BP4A 1QOLA 3CH2X 2JQFR 7PCKA 1GECE 1MEGA 2IPPB 1EF7A 1QXPA 3CBKA 2O6XA 2R9CA 4BQVA 4FJCA 3QSDA 3ERVA 2AYNA 4ZUXU 3S3RA 2E03A 1AU4A 1CQDA 5CHTA 3F75A 2DJFB 2XU1A 1AU2A 1ZIVA 1ME3A 2JQGR 1F2AA 3MHSA 4PP2E 4YYQA 5K16A 4FK5A 2XU4A 4YV8A 1U9WA 2DJGB 1YALA 3IMAA 2HD5A 4MZOA 1PADA 5EGWA 4B55A 1CVZA 3E1ZB 3H8BA 3WXFA 3B79A 3K9MA 1PPOA 1YT7A 2PADA 2P0RA 2R9NA 3PBHA 4YVAA 4I04A 4QRVA 3USVA 1BY8A 1W6FA 3OISA 1X9YA 1PBHA 1JQPA 4N4ZA 4OELA 4AXLA 2DCBA 2VFCA 6PADA 3BC3A 4N8WA 3LFYA 3P5XA 2ACTA 4NV8A 3WXGA 1NB5A 1S4VA 3I06A 3D9WA 2F1GA 2GHUA 1A6RA 1ATKA 3K8UA 3IUTA 1CPJA 3D6SA 3PW3A 2DCAA 3KSEA 5F02A 4MSXA 4CDDB 2B1NA 3MORA 1YK7A 2FTDA 3PDFA 2DC8A 2DZZA 2HH5A 1PIPA 2AS8A 1MEMA 5J94A 2H7JA 2R9OA 2Y5BA 1AIMA 1MDWA 3O1GA 3CBJA 3S3QA 4GUZA 3IV2A 5A24A 4CZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5PAD A;  5FPW A;  4QRG A;  2E01 A;  3BOW A;  1VSN A;  3KW9 A;  2WBF X;  1PE6 A;  1EWP A;  2CB5 A;  4X6H A;  2AU1 A;  1IWD A;  2HHN A;  1Q6K A;  1HUC B;  3HHA A;  3RVV A;  3KFQ A;  2OUL A;  2G7Y A;  2ATO A;  3HD3 A;  1TU6 A;  3IEJ A;  2CIO A;  4BPV A;  2PRE A;  1SNK A;  4RY2 A;  1CB5 A;  4DMY A;  3TNX A;  3P5U A;  2HXZ A;  3KWB X;  4BSQ A;  1CS8 A;  4Q8H A;  2IBI A;  4I05 A;  2DCD A;  1DF0 A;  4FIP A;  1PPP A;  1U5I A;  2YJ2 A;  1U9Q X;  1GCB A;  1AYV A;  4XUI A;  2YJB A;  4DMX A;  5CVM A;  4CDF B;  5JH3 A;  1NPZ A;  8PCH A;  3WXE A;  1NLJ A;  1GLO A;  5CVO B;  2VHS A;  4HWY A;  1STF E;  1PXV A;  1M6D A;  1Y4H A;  3P5V A;  4P6G A;  1O0E A;  2GFO A;  2P7U A;  3F5V A;  3QJ3 A;  1POP A;  4G54 A;  3V6E A;  1Y08 A;  3AI8 A;  1AU3 A;  2DC6 A;  2NQA A;  4PI3 A;  2E02 A;  2AIM A;  2G8J A;  1U9V A;  1KHP A;  2P86 A;  2XU5 A;  4YYS A;  3N4C A;  2DC9 A;  3I3T A;  1NL6 A;  3HHI A;  2B1M A;  1EWO A;  1KHQ A;  2FT2 A;  3MTN A;  1K3B B;  2BDL A;  1GMY A;  2OP3 A;  1KFX L;  3P5W A;  4YYV A;  2G6D A;  4WA6 A;  3IOQ A;  5JA7 A;  2FUD A;  2PNS A;  3HWN A;  1XKG A;  1YVB A;  3N3K A;  4I07 A;  4QBB A;  1ITO A;  2G8E A;  4QH6 A;  1PCI A;  3BWK A;  3KWZ A;  3BCN A;  1DEU A;  4CDE B;  4BS5 A;  2DC7 A;  2ARY A;  1EWM A;  3RVW A;  1MS6 A;  4KLB A;  2PBH A;  4YYW A;  2Y6E A;  2NQG A;  2XU3 A;  1NQC A;  2FYE A;  1AEC A;  3M99 A;  4X6J A;  2NQI A;  4BS6 A;  3DF0 A;  4W5C A;  3NHE A;  3BPF A;  2C0Y A;  2R9F A;  4CDC B;  4YYU A;  2R9M A;  3OF8 A;  3KKU A;  3IHP A;  1THE A;  1KXR A;  2FO5 A;  2DCC A;  4K7C A;  3LXS A;  3QT4 A;  3PNR A;  5CHV A;  2AUZ A;  4X6I A;  2AYO A;  3OF9 A;  1F2B A;  1MIR A;  4P6E A;  2YJ9 A;  1ME4 A;  4W5B A;  4OEM A;  3C9E A;  2R6N A;  1QDQ A;  3OVX A;  1NB3 A;  1CSB B;  1SP4 B;  1BQI A;  1AYW A;  4PAD A;  1AU0 A;  3GCB A;  2YJ8 A;  3CH3 X;  3N3G A;  4XR7 A;  4PP1 A;  2YJC A;  3U8E A;  3H7D A;  3RVX A;  1F29 A;  2VHF A;  1CV8 A;  2AUX A;  4QRX A;  1CJL A;  4W4U A;  3H8C A;  1AYU A;  1MHW A;  1PPN A;  2NQD B;  1F2C A;  2DZY A;  4Q8G A;  1KFU L;  2OZ2 A;  5EF4 A;  4AXM A;  2FQ9 A;  2E00 A;  2FRA A;  1PPD A;  4N79 A;  1YK8 A;  1TL9 A;  9PAP A;  3V6C A;  3OVZ A;  1QMY A;  3H89 A;  2AVW A;  3O0U A;  1U9X A;  2F7D A;  5CVN B;  3K24 A;  1VJV A;  3BPM A;  2FRQ A;  4MZS A;  3MHH A;  3H6S A;  1TLO A;  1ZCM A;  3ZUA A;  1ICF A;  1EWL A;  3KX1 A;  1BGO A;  1CTE A;  4YYR A;  1FH0 A;  2BDZ A;  1BP4 A;  1QOL A;  3CH2 X;  2JQF R;  7PCK A;  1GEC E;  1MEG A;  2IPP B;  1EF7 A;  1QXP A;  3CBK A;  2O6X A;  2R9C A;  4BQV A;  4FJC A;  3QSD A;  3ERV A;  2AYN A;  4ZUX U;  3S3R A;  2E03 A;  1AU4 A;  1CQD A;  5CHT A;  3F75 A;  2DJF B;  2XU1 A;  1AU2 A;  1ZIV A;  1ME3 A;  2JQG R;  1F2A A;  3MHS A;  4PP2 E;  4YYQ A;  5K16 A;  4FK5 A;  2XU4 A;  4YV8 A;  1U9W A;  2DJG B;  1YAL A;  3IMA A;  2HD5 A;  4MZO A;  1PAD A;  5EGW A;  1CVZ A;  3E1Z B;  3H8B A;  3WXF A;  3B79 A;  3K9M A;  1PPO A;  1YT7 A;  2PAD A;  2P0R A;  2R9N A;  3PBH A;  4YVA A;  4I04 A;  4QRV A;  3USV A;  1BY8 A;  3OIS A;  1X9Y A;  1PBH A;  1JQP A;  4N4Z A;  4OEL A;  4AXL A;  2DCB A;  6PAD A;  3BC3 A;  4N8W A;  3LFY A;  3P5X A;  2ACT A;  3WXG A;  1NB5 A;  1S4V A;  3I06 A;  2F1G A;  2GHU A;  1A6R A;  1ATK A;  3K8U A;  3IUT A;  1CPJ A;  3D6S A;  3PW3 A;  2DCA A;  3KSE A;  5F02 A;  4MSX A;  4CDD B;  2B1N A;  3MOR A;  1YK7 A;  2FTD A;  3PDF A;  2DC8 A;  2DZZ A;  2HH5 A;  1PIP A;  2AS8 A;  1MEM A;  5J94 A;  2H7J A;  2R9O A;  2Y5B A;  1AIM A;  1MDW A;  3O1G A;  3S3Q A;  3CBJ A;  3IV2 A;  5A24 A;  4CZW A; 
#chains in the Genus database with same CATH topology
 5PAD A;  5FPW A;  4QRG A;  2E01 A;  3RNV A;  3BOW A;  1VSN A;  3KW9 A;  2WBF X;  1PE6 A;  2AGA A;  3W30 A;  1EWP A;  2CB5 A;  4RKX A;  4X6H A;  2AU1 A;  1IWD A;  2HHN A;  4A5U A;  1Q6K A;  4BOQ A;  1HUC B;  3HHA A;  3RVV A;  3KFQ A;  2OUL A;  2G7Y A;  2ATO A;  4P16 A;  3HD3 A;  1TU6 A;  3IEJ A;  2CIO A;  4BPV A;  3PHX A;  2PRE A;  1SNK A;  4RY2 A;  1CB5 A;  4DMY A;  3TNX A;  5EZQ A;  3P5U A;  2HXZ A;  3KWB X;  4BSQ A;  1CS8 A;  4Q8H A;  2IBI A;  4I05 A;  2DCD A;  1DF0 A;  4FIP A;  1PPP A;  1U5I A;  2YJ2 A;  1U9Q X;  1GCB A;  4PT5 A;  1AYV A;  4XUI A;  2YJB A;  4DMX A;  5CVM A;  4CDF B;  5JH3 A;  1NPZ A;  8PCH A;  3WXE A;  4IUM A;  1NLJ A;  1GLO A;  5CVO B;  2VHS A;  4HWY A;  1STF E;  1PXV A;  1M6D A;  1Y4H A;  3P5V A;  4P6G A;  1O0E A;  2GFO A;  2P7U A;  3F5V A;  3QJ3 A;  1POP A;  4G54 A;  3V6E A;  1Y08 A;  3AI8 A;  1AU3 A;  2DC6 A;  2NQA A;  2UZJ A;  4PI3 A;  4MM3 B;  2E02 A;  2AIM A;  1UKF A;  2G8J A;  1U9V A;  1KHP A;  2P86 A;  2Z84 A;  2XU5 A;  2BU3 A;  4YYS A;  4HXD B;  4D8B A;  4BOU A;  3N4C A;  2DC9 A;  3I3T A;  1NL6 A;  3HHI A;  2B1M A;  1EWO A;  1KHQ A;  2FT2 A;  3MTN A;  3MP2 A;  1K3B B;  2BDL A;  1GMY A;  2OP3 A;  1KFX L;  3P5W A;  4YYV A;  2G6D A;  4WA6 A;  3IOQ A;  5JA7 A;  2FUD A;  2PNS A;  4ZTB A;  3HWN A;  3B21 A;  1XKG A;  1YVB A;  3N3K A;  2JTC A;  4I07 A;  3BBA A;  4QBB A;  1PVJ A;  1ITO A;  2G8E A;  4QH6 A;  2J7Q C;  1PCI A;  2HWK A;  3BWK A;  3KWZ A;  4BOP A;  3BCN A;  1DEU A;  4CDE B;  1YZB A;  4BS5 A;  2DC7 A;  2ARY A;  1EWM A;  5KO3 A;  4OVZ B;  3RVW A;  1MS6 A;  4KLB A;  2PBH A;  4YYW A;  2Y6E A;  2NQG A;  2XU3 A;  1NQC A;  2FYE A;  1AEC A;  3M99 A;  4X6J A;  2NQI A;  4BS6 A;  3DF0 A;  4W5C A;  3NHE A;  3BPF A;  2BTW A;  2C0Y A;  2R9F A;  4CDC B;  4YYU A;  2R9M A;  3OF8 A;  3KKU A;  3BY4 A;  3IHP A;  1THE A;  1KXR A;  3PSE A;  2FO5 A;  2DCC A;  4XZX A;  4K7C A;  3LXS A;  3QT4 A;  3PNR A;  3ZNH A;  4D8E A;  3TMP A;  5CHV A;  2AUZ A;  4X6I A;  2AYO A;  3OF9 A;  1F2B A;  1MIR A;  4P6E A;  2YJ9 A;  1ME4 A;  4W5B A;  4OEM A;  3C9E A;  2R6N A;  4BOZ A;  1QDQ A;  3OVX A;  4OW0 A;  1NB3 A;  1CSB B;  1SP4 B;  1BQI A;  1AYW A;  4PAD A;  1AU0 A;  4GUA A;  3GCB A;  2YJ8 A;  3MTV A;  3CH3 X;  3N3G A;  4RNA A;  4XR7 A;  4PP1 A;  2YJC A;  3U8E A;  3H7D A;  3RVX A;  1F29 A;  2J7Q A;  2VHF A;  1CV8 A;  2AUX A;  4QRX A;  1CJL A;  4W4U A;  3H8C A;  1AYU A;  1MHW A;  1PPN A;  2NQD B;  1F2C A;  2DZY A;  4Q8G A;  3PT2 A;  1KFU L;  2OZ2 A;  5EF4 A;  4REZ A;  4AXM A;  2FQ9 A;  2E00 A;  2FRA A;  1PPD A;  3TRK A;  4N79 A;  1YK8 A;  1TL9 A;  9PAP A;  3V6C A;  3OVZ A;  1QMY A;  3H89 A;  4RF1 A;  2AVW A;  2JRI A;  3W31 A;  3PHW A;  3O0U A;  1U9X A;  2F7D A;  3O65 A;  5CVN B;  3K24 A;  1VJV A;  3BPM A;  5EZS A;  2FRQ A;  4MZS A;  3MHH A;  3H6S A;  1TLO A;  1ZCM A;  4R3D A;  3ZUA A;  3E9S A;  1ICF A;  1EWL A;  3KX1 A;  1BGO A;  1CTE A;  4IP3 A;  4YYR A;  1FH0 A;  4BOS A;  2BDZ A;  1BP4 A;  3PRP A;  1QOL A;  3CH2 X;  2JQF R;  7PCK A;  4M0W A;  1GEC E;  3PRM A;  1MEG A;  2IPP B;  1EF7 A;  1QXP A;  3CBK A;  5E6J A;  2O6X A;  2R9C A;  4BQV A;  4FJC A;  3QSD A;  3ERV A;  2AYN A;  4ZUX U;  3C0R A;  3S3R A;  2E03 A;  1AU4 A;  1CQD A;  5CHT A;  3F75 A;  4WUR A;  5JZE A;  2DJF B;  2XU1 A;  1AU2 A;  1ZIV A;  1ME3 A;  2JQG R;  1F2A A;  4MI7 A;  3MHS A;  4PP2 E;  4YYQ A;  5K16 A;  4FK5 A;  2XU4 A;  4YV8 A;  1U9W A;  2DJG B;  1YAL A;  3IMA A;  2HD5 A;  3MJ5 A;  4MZO A;  1PAD A;  5EGW A;  3BB7 A;  3PHU A;  1CVZ A;  3E1Z B;  3H8B A;  2FE8 A;  4OVZ A;  3WXF A;  3B79 A;  3K9M A;  1PPO A;  1YT7 A;  2PAD A;  2P0R A;  2R9N A;  3PBH A;  4YVA A;  4I04 A;  4QRV A;  4RF0 A;  3USV A;  1BY8 A;  3OIS A;  1X9Y A;  1PBH A;  1JQP A;  3IFU A;  4N4Z A;  4OEL A;  4AXL A;  2DCB A;  6PAD A;  3BC3 A;  4N8W A;  3LFY A;  3P5X A;  2ACT A;  3WXG A;  1NB5 A;  3OQC A;  1DKI A;  1S4V A;  2DOS A;  3I06 A;  2F1G A;  2GHU A;  1A6R A;  1ATK A;  3K8U A;  3IUT A;  1CPJ A;  3D6S A;  3PW3 A;  2DCA A;  3KSE A;  5F02 A;  4MSX A;  4CDD B;  2B1N A;  4D8I A;  3MOR A;  1YK7 A;  2FTD A;  3PDF A;  2DC8 A;  2DZZ A;  2HH5 A;  1PIP A;  2AS8 A;  1MEM A;  5J94 A;  2H7J A;  2R9O A;  2Y5B A;  1AIM A;  1MDW A;  3O1G A;  3CBJ A;  3S3Q A;  3IV2 A;  5A24 A;  2BTW B;  4CZW A; 
#chains in the Genus database with same CATH homology
 5PAD A;  5FPW A;  4QRG A;  2E01 A;  3BOW A;  1VSN A;  3KW9 A;  2WBF X;  1PE6 A;  1EWP A;  2CB5 A;  4X6H A;  2AU1 A;  1IWD A;  2HHN A;  1Q6K A;  1HUC B;  3HHA A;  4C5P A;  3RVV A;  3KFQ A;  2OUL A;  2G7Y A;  2ATO A;  3HD3 A;  1TU6 A;  3IEJ A;  2CIO A;  4BPV A;  1W4T A;  2PRE A;  1SNK A;  4RY2 A;  1CB5 A;  4DMY A;  3TNX A;  3P5U A;  2HXZ A;  3KWB X;  4BSQ A;  1CS8 A;  4Q8H A;  2IBI A;  4I05 A;  2DCD A;  1DF0 A;  4FIP A;  1PPP A;  1U5I A;  2YJ2 A;  1U9Q X;  1GCB A;  1AYV A;  4XUI A;  2YJB A;  4DMX A;  5CVM A;  4CDF B;  5JH3 A;  1NPZ A;  8PCH A;  3WXE A;  1NLJ A;  1GLO A;  5CVO B;  2VHS A;  4HWY A;  1STF E;  1PXV A;  1M6D A;  1Y4H A;  3P5V A;  4P6G A;  1O0E A;  2GFO A;  2P7U A;  3F5V A;  3QJ3 A;  1POP A;  4G54 A;  3V6E A;  1Y08 A;  3AI8 A;  1AU3 A;  2DC6 A;  2NQA A;  4PI3 A;  2E02 A;  2AIM A;  2BSZ A;  2G8J A;  1U9V A;  1KHP A;  2P86 A;  2XU5 A;  4YYS A;  3N4C A;  2DC9 A;  3I3T A;  1NL6 A;  3HHI A;  2B1M A;  1EWO A;  1KHQ A;  2FT2 A;  3MTN A;  1K3B B;  2BDL A;  1GMY A;  2OP3 A;  1KFX L;  3P5W A;  4YYV A;  2G6D A;  4WA6 A;  3IOQ A;  5JA7 A;  2FUD A;  2PNS A;  3HWN A;  1XKG A;  1YVB A;  3N3K A;  4I07 A;  4QBB A;  1ITO A;  2G8E A;  4QH6 A;  1PCI A;  3BWK A;  3KWZ A;  3BCN A;  1DEU A;  4CDE B;  4BS5 A;  2DC7 A;  2ARY A;  1EWM A;  3RVW A;  1MS6 A;  4KLB A;  2PBH A;  4YYW A;  2Y6E A;  2NQG A;  2XU3 A;  1NQC A;  2FYE A;  1AEC A;  3M99 A;  1GX3 A;  4X6J A;  2NQI A;  1W5R A;  4BS6 A;  3DF0 A;  4W5C A;  3NHE A;  3BPF A;  2C0Y A;  2R9F A;  4CDC B;  4YYU A;  2R9M A;  3OF8 A;  3KKU A;  3IHP A;  1THE A;  1KXR A;  1E2T A;  4NV7 A;  2FO5 A;  2DCC A;  4K7C A;  3LXS A;  3QT4 A;  3PNR A;  5CHV A;  2AUZ A;  4X6I A;  2AYO A;  3OF9 A;  1F2B A;  1MIR A;  4P6E A;  2YJ9 A;  1ME4 A;  4W5B A;  4OEM A;  3C9E A;  2R6N A;  1QDQ A;  3OVX A;  1NB3 A;  1CSB B;  1SP4 B;  1BQI A;  1AYW A;  4PAD A;  1AU0 A;  3GCB A;  2YJ8 A;  3CH3 X;  3N3G A;  4XR7 A;  4PP1 A;  2YJC A;  3U8E A;  3H7D A;  3RVX A;  1F29 A;  2VHF A;  1CV8 A;  2AUX A;  4QRX A;  1CJL A;  4W4U A;  3H8C A;  1AYU A;  1MHW A;  1PPN A;  2NQD B;  1F2C A;  2DZY A;  4Q8G A;  1KFU L;  2OZ2 A;  5EF4 A;  4AXM A;  2FQ9 A;  2E00 A;  2VFB A;  2FRA A;  3LTW A;  1PPD A;  4N79 A;  1YK8 A;  1TL9 A;  9PAP A;  3V6C A;  3OVZ A;  1QMY A;  3H89 A;  2AVW A;  3O0U A;  1U9X A;  4BGF A;  2F7D A;  5CVN B;  3K24 A;  1VJV A;  3BPM A;  2FRQ A;  4MZS A;  3MHH A;  3H6S A;  1TLO A;  1ZCM A;  3ZUA A;  1ICF A;  1EWL A;  3KX1 A;  1BGO A;  1CTE A;  4YYR A;  1FH0 A;  2BDZ A;  1BP4 A;  1QOL A;  3CH2 X;  2JQF R;  7PCK A;  1GEC E;  1MEG A;  2IPP B;  1EF7 A;  1QXP A;  3CBK A;  2O6X A;  2R9C A;  4BQV A;  4FJC A;  3QSD A;  3ERV A;  2AYN A;  4ZUX U;  3S3R A;  2E03 A;  1AU4 A;  1CQD A;  5CHT A;  3F75 A;  2DJF B;  2XU1 A;  1AU2 A;  1ZIV A;  1ME3 A;  2JQG R;  1F2A A;  3MHS A;  4PP2 E;  4YYQ A;  5K16 A;  4FK5 A;  2XU4 A;  4YV8 A;  1U9W A;  2DJG B;  1YAL A;  3IMA A;  2HD5 A;  4MZO A;  1PAD A;  5EGW A;  4B55 A;  1CVZ A;  3E1Z B;  3H8B A;  3WXF A;  3B79 A;  3K9M A;  1PPO A;  1YT7 A;  2PAD A;  2P0R A;  2R9N A;  3PBH A;  4YVA A;  4I04 A;  4QRV A;  3USV A;  1BY8 A;  1W6F A;  3OIS A;  1X9Y A;  1PBH A;  1JQP A;  4N4Z A;  4OEL A;  4AXL A;  2DCB A;  2VFC A;  6PAD A;  3BC3 A;  4N8W A;  3LFY A;  3P5X A;  2ACT A;  4NV8 A;  3WXG A;  1NB5 A;  1S4V A;  3I06 A;  3D9W A;  2F1G A;  2GHU A;  1A6R A;  1ATK A;  3K8U A;  3IUT A;  1CPJ A;  3D6S A;  3PW3 A;  2DCA A;  3KSE A;  5F02 A;  4MSX A;  4CDD B;  2B1N A;  3MOR A;  1YK7 A;  2FTD A;  3PDF A;  2DC8 A;  2DZZ A;  2HH5 A;  1PIP A;  2AS8 A;  1MEM A;  5J94 A;  2H7J A;  2R9O A;  2Y5B A;  1AIM A;  1MDW A;  3O1G A;  3CBJ A;  3S3Q A;  4GUZ A;  3IV2 A;  5A24 A;  4CZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...