4BS6A

Mouse cathepsin s with covalent ligand
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
219
structure length
219
Chain Sequence
TLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKAMDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN S
publication title Cathepsin S Nitrile Inhibitors
rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 63
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2013-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4bs6A00
4FJCA 4YYQA 1KFUL 4N4ZA 4QRGA 4P6EA 3MHHA 5FPWA 4ZUXU 3ZUAA 1EWPA 2VHSA 4W5BA 1CJLA 3CBJA 1KHPA 2HXZA 2IBIA 1Q6KA 3F5VA 4CDDB 1ME4A 1BP4A 5K16A 4BSQA 1QMYA 9PAPA 3BPFA 4MZSA 1NB5A 3IOQA 1IWDA 4N8WA 1F2BA 1YK7A 1CB5A 5CVOB 2DCCA 1EWLA 4CDEB 1KFXL 1DEUA 3OF9A 1MEGA 2FYEA 3PW3A 2R9OA 5CHVA 1BY8A 1DF0A 2C0YA 1A6RA 5PADA 2AUXA 4YYVA 2E02A 1TU6A 3WXGA 3PBHA 2R9NA 2PADA 2YJ9A 1KXRA 1X9YA 2NQGA 1U9XA 4WA6A 2AS8A 4QH6A 1GLOA 1QXPA 1PPOA 2R6NA 2AVWA 1NPZA 2E03A 1YALA 2P86A 1U9VA 1TLOA 1PE6A 2G6DA 2FUDA 7PCKA 1BQIA 2B1MA 4QBBA 3OVZA 3B79A 4AXMA 3N4CA 2FQ9A 3P5XA 3N3KA 2DJFB 3AI8A 1GMYA 1JQPA 5CVMA 3IMAA 3K9MA 3S3QA 1CV8A 1MHWA 5EGWA 2R9FA 6PADA 1EF7A 1MEMA 1PADA 1THEA 4G54A 4PI3A 4HWYA 1PCIA 4BQVA 4CDCB 4I07A 1CTEA 1PPNA 2FTDA 3TNXA 2AU1A 1NB3A 1ZIVA 3O1GA 2CIOA 4X6HA 1Y08A 5CHTA 3H6SA 4AXLA 2G8EA 4CDFB 1HUCB 1K3BB 2VHFA 4DMYA 2ARYA 1MDWA 2YJCA 2WBFX 5J94A 1AU3A 2G7YA 2DJGB 2OZ2A 3H89A 2CB5A 4N79A 5CVNB 3ERVA 2HH5A 2R9MA 1CQDA 2XU5A 4P6GA 1F29A 1ATKA 4X6IA 4X6JA 2PBHA 1EWMA 1SNKA 2O6XA 2GFOA 1BGOA 3I3TA 4PADA 1VSNA 3I06A 2AIMA 4YYUA 1PXVA 4Q8HA 3QT4A 1GECE 3MTNA 2OP3A 1NL6A 2JQFR 3LFYA 1EWOA 2DC9A 3BOWA 3H8CA 1PPPA 1TL9A 1NQCA 1FH0A 1U9QX 3KSEA 2XU3A 2HD5A 3WXEA 3U8EA 2YJ8A 4K7CA 1POPA 1F2CA 3H8BA 3HHAA 4W5CA 2XU1A 5JH3A 8PCHA 3V6CA 3KKUA 2DC7A 3KX1A 3H7DA 3WXFA 3S3RA 3V6EA 2FO5A 3MHSA 2AYNA 3M99A 1CVZA 2DCAA 1XKGA 2DC8A 3BWKA 3RVVA 2B1NA 1AECA 1STFE 4RY2A 3OF8A 3RVWA 4BS6A 2PREA 3HD3A 4DMXA 1AU0A 1AYWA 1PPDA 3CBKA 3P5VA 3KWZA 3IV2A 4OEMA 1YVBA 4KLBA 2F1GA 3OVXA 2Y6EA 2Y5BA 1Y4HA 2NQIA 3C9EA 2PNSA 3D6SA 2BDZA 3O0UA 2XU4A 3KW9A 4XR7A 4YVAA 1YK8A 3PDFA 3F75A 4YV8A 2NQDB 3DF0A 3BC3A 3BCNA 2DCBA 2GHUA 1VJVA 3IHPA 1AYUA 4I04A 1ICFA 5F02A 3NHEA 2E01A 1GCBA 2FRQA 3LXSA 1AU4A 3CH3X 4Q8GA 1ITOA 3HHIA 2NQAA 5JA7A 4CZWA 1MS6A 1ME3A 2OULA 3MORA 3RVXA 3USVA 3GCBA 2R9CA 3P5WA 3QJ3A 3IUTA 1M6DA 1PBHA 5EF4A 2P7UA 1NLJA 2AYOA 2IPPB 3K24A 2HHNA 4W4UA 4FIPA 1PIPA 1CPJA 4YYSA 4FK5A 2YJ2A 2F7DA 2E00A 1QOLA 4YYWA 2FT2A 2H7JA 2FRAA 2ACTA 2BDLA 4PP2E 1MIRA 2JQGR 4MSXA 1ZCMA 4I05A 2DCDA 3HWNA 2YJBA 3KFQA 3OISA 4BS5A 2AUZA 1U9WA 3E1ZB 4QRXA 1O0EA 1SP4B 2P0RA 2DZZA 4PP1A 2DC6A 3KWBX 4QRVA 3IEJA 1AIMA 3QSDA 4XUIA 1F2AA 1CSBB 4YYRA 4MZOA 3PNRA 3N3GA 1YT7A 5A24A 3P5UA 1AU2A 3K8UA 1S4VA 1QDQA 2DZYA 1KHQA 3CH2X 1AYVA 4BPVA 2G8JA 1U5IA 3BPMA 2ATOA 1CS8A 4OELA
chains in the Genus database with same CATH superfamily
4FJCA 4YYQA 1KFUL 4N4ZA 4QRGA 4P6EA 3MHHA 5FPWA 4ZUXU 3ZUAA 1EWPA 4WURA 4RF0A 2VHSA 4W5BA 1CJLA 3CBJA 3W30A 1KHPA 4BOQA 2HXZA 2IBIA 1Q6KA 3F5VA 5JZEA 4CDDB 1ME4A 1BP4A 5K16A 4BSQA 4RF1A 1QMYA 9PAPA 3BPFA 4MZSA 2JRIA 1NB5A 3IOQA 1IWDA 4N8WA 1F2BA 1YK7A 1CB5A 2UZJA 5CVOB 2DCCA 4R3DA 1EWLA 4CDEB 1KFXL 1DEUA 3OF9A 1MEGA 4D8EA 2FYEA 3PW3A 2R9OA 5CHVA 4RNAA 1PVJA 1BY8A 1DF0A 2C0YA 1A6RA 5PADA 2AUXA 4MI7A 4YYVA 2E02A 1TU6A 3WXGA 3PBHA 2R9NA 2PADA 2YJ9A 1KXRA 1X9YA 2BTWA 1U9XA 2NQGA 2AS8A 4WA6A 4QH6A 1GLOA 1QXPA 1PPOA 2R6NA 2AVWA 1NPZA 2E03A 1YALA 2P86A 1U9VA 1TLOA 1PE6A 4BOSA 2G6DA 2FUDA 7PCKA 4PT5A 4BOPA 1BQIA 2B1MA 4QBBA 4M0WA 1YZBA 3OVZA 3B79A 4AXMA 3N4CA 2FQ9A 3P5XA 3N3KA 2AGAA 2DJFB 3AI8A 1GMYA 1JQPA 5CVMA 3IMAA 3K9MA 3S3QA 1CV8A 1MHWA 5EGWA 5KO3A 2R9FA 6PADA 1EF7A 1MEMA 1PADA 1THEA 4G54A 4PI3A 4HWYA 1PCIA 4BQVA 3PRMA 4CDCB 4I07A 3BBAA 1CTEA 1PPNA 2FTDA 3TNXA 2AU1A 1NB3A 1ZIVA 3PT2A 3O1GA 3W31A 2CIOA 4X6HA 1Y08A 5CHTA 2DOSA 3PHXA 3H6SA 4AXLA 2G8EA 4CDFB 1HUCB 1K3BB 2JTCA 2VHFA 4DMYA 4BOZA 2ARYA 3O65A 1MDWA 2YJCA 2WBFX 5J94A 1AU3A 3C0RA 2G7YA 2DJGB 2OZ2A 3H89A 3MTVA 2CB5A 4N79A 4OVZB 5CVNB 3ERVA 2HH5A 2R9MA 1CQDA 2XU5A 4P6GA 1F29A 3TMPA 1ATKA 4X6IA 4X6JA 2PBHA 1EWMA 1SNKA 2O6XA 2GFOA 1BGOA 3I3TA 4PADA 1VSNA 2FE8A 3I06A 2AIMA 4YYUA 1PXVA 4Q8HA 3QT4A 1GECE 5E6JA 3MTNA 2OP3A 3E9SA 1NL6A 2JQFR 3LFYA 1EWOA 2DC9A 3BOWA 3H8CA 1PPPA 1TL9A 1NQCA 1FH0A 1U9QX 3KSEA 2XU3A 2HD5A 3WXEA 3U8EA 3RNVA 2YJ8A 4K7CA 1POPA 1F2CA 2J7QC 3H8BA 1DKIA 3HHAA 4W5CA 2XU1A 5JH3A 8PCHA 3V6CA 4D8BA 3KKUA 5EZQA 5EZSA 2DC7A 3MP2A 3KX1A 3H7DA 3WXFA 3BY4A 3S3RA 3V6EA 2FO5A 3MHSA 2AYNA 3M99A 1CVZA 2DCAA 1XKGA 2DC8A 3BWKA 3RVVA 2B1NA 2BU3A 1AECA 2BTWB 1STFE 4RY2A 3OF8A 3RVWA 4BS6A 4GUAA 2PREA 3BB7A 3HD3A 4DMXA 1AU0A 1AYWA 3TRKA 3PRPA 1PPDA 3CBKA 3P5VA 3KWZA 4XZXA 3IV2A 4OEMA 1YVBA 4HXDB 4KLBA 2F1GA 3OVXA 2Y6EA 2Y5BA 1Y4HA 2NQIA 3C9EA 2PNSA 3D6SA 2BDZA 3O0UA 2XU4A 3KW9A 4IP3A 4XR7A 1YK8A 4YVAA 3PDFA 3F75A 4YV8A 2NQDB 3DF0A 3PSEA 3BC3A 3BCNA 2DCBA 2GHUA 1VJVA 3IHPA 1AYUA 4I04A 4ZTBA 1ICFA 5F02A 3NHEA 2E01A 4BOUA 1GCBA 2FRQA 3LXSA 1AU4A 3CH3X 4REZA 3IFUA 4Q8GA 1ITOA 3HHIA 2NQAA 5JA7A 4CZWA 1MS6A 1ME3A 3OQCA 2OULA 3MORA 3RVXA 3USVA 3GCBA 2R9CA 2J7QA 3P5WA 3QJ3A 3IUTA 1M6DA 1PBHA 5EF4A 2P7UA 1NLJA 2AYOA 2HWKA 2IPPB 3ZNHA 3K24A 2HHNA 4W4UA 4FIPA 1PIPA 1CPJA 4YYSA 4FK5A 2YJ2A 2F7DA 2E00A 1QOLA 4YYWA 2FT2A 2H7JA 2FRAA 4P16A 4A5UA 2ACTA 2BDLA 4OW0A 3MJ5A 4PP2E 1MIRA 2JQGR 4MSXA 1ZCMA 4I05A 2DCDA 3HWNA 2YJBA 3KFQA 3OISA 4IUMA 4RKXA 1UKFA 4BS5A 4D8IA 2AUZA 1U9WA 3E1ZB 3PHUA 4QRXA 1O0EA 1SP4B 2P0RA 2DZZA 4PP1A 4MM3B 2DC6A 3KWBX 4QRVA 3IEJA 1AIMA 3QSDA 4XUIA 1F2AA 1CSBB 4YYRA 4MZOA 3PNRA 3N3GA 1YT7A 3B21A 3P5UA 5A24A 1AU2A 2Z84A 4OVZA 3K8UA 3PHWA 1S4VA 1QDQA 2DZYA 1KHQA 3CH2X 1AYVA 4BPVA 2G8JA 1U5IA 3BPMA 2ATOA 1CS8A 4OELA
chains in the Genus database with same CATH topology
4FJCA 4YYQA 1KFUL 4N4ZA 4QRGA 4P6EA 3MHHA 5FPWA 4ZUXU 3ZUAA 1EWPA 2VHSA 4W5BA 1CJLA 3CBJA 4C5PA 1KHPA 2VFBA 2HXZA 2IBIA 1Q6KA 3F5VA 4CDDB 1ME4A 1BP4A 5K16A 4BSQA 4NV7A 1QMYA 9PAPA 3BPFA 4MZSA 1NB5A 3IOQA 1IWDA 4N8WA 1F2BA 1YK7A 1CB5A 5CVOB 2DCCA 1EWLA 1E2TA 4CDEB 1KFXL 1DEUA 3OF9A 1MEGA 2FYEA 3PW3A 2R9OA 5CHVA 1BY8A 1DF0A 2C0YA 1A6RA 5PADA 2AUXA 4YYVA 2E02A 1TU6A 3WXGA 3PBHA 2R9NA 2VFCA 2PADA 2YJ9A 1KXRA 1X9YA 2NQGA 1U9XA 4WA6A 2AS8A 4QH6A 1GLOA 1QXPA 1PPOA 2R6NA 2AVWA 1NPZA 2E03A 1YALA 2P86A 1U9VA 1TLOA 1PE6A 2G6DA 2FUDA 7PCKA 1BQIA 2B1MA 4QBBA 3OVZA 3B79A 4AXMA 4GUZA 3N4CA 2FQ9A 3P5XA 3N3KA 2DJFB 3AI8A 1GMYA 1JQPA 5CVMA 3D9WA 3IMAA 3K9MA 3S3QA 1CV8A 1GX3A 1MHWA 5EGWA 2R9FA 6PADA 1EF7A 1MEMA 1PADA 1THEA 4G54A 4PI3A 4HWYA 1PCIA 4BQVA 4CDCB 1W4TA 4I07A 1CTEA 1PPNA 2FTDA 3TNXA 2AU1A 1NB3A 1ZIVA 3O1GA 2CIOA 4X6HA 1Y08A 1W6FA 5CHTA 3H6SA 4AXLA 2G8EA 4CDFB 1HUCB 1K3BB 2VHFA 4DMYA 2ARYA 1MDWA 2YJCA 2WBFX 5J94A 1AU3A 2G7YA 2DJGB 2OZ2A 3H89A 2CB5A 4N79A 5CVNB 3ERVA 2HH5A 2R9MA 1CQDA 2XU5A 4P6GA 1F29A 1ATKA 4X6IA 4X6JA 2PBHA 1EWMA 1SNKA 2O6XA 2GFOA 3LTWA 1BGOA 3I3TA 4PADA 1VSNA 3I06A 2AIMA 4YYUA 1PXVA 4Q8HA 3QT4A 1GECE 3MTNA 2OP3A 1NL6A 2JQFR 3LFYA 1EWOA 2DC9A 3BOWA 3H8CA 1PPPA 1TL9A 1NQCA 1FH0A 1U9QX 3KSEA 2XU3A 2HD5A 3WXEA 3U8EA 2YJ8A 4K7CA 1POPA 1F2CA 3H8BA 3HHAA 4W5CA 2XU1A 5JH3A 8PCHA 3V6CA 3KKUA 2DC7A 3KX1A 3H7DA 3WXFA 3S3RA 3V6EA 2FO5A 3MHSA 2AYNA 3M99A 1CVZA 2DCAA 1XKGA 2DC8A 3BWKA 3RVVA 2B1NA 1AECA 1STFE 4RY2A 3OF8A 3RVWA 4BS6A 2BSZA 2PREA 3HD3A 4DMXA 1AU0A 1AYWA 1PPDA 3CBKA 3P5VA 3KWZA 3IV2A 4OEMA 1YVBA 4KLBA 2F1GA 3OVXA 2Y6EA 2Y5BA 1Y4HA 2NQIA 3C9EA 2PNSA 3D6SA 2BDZA 3O0UA 2XU4A 3KW9A 4XR7A 4YVAA 1YK8A 3PDFA 3F75A 4YV8A 2NQDB 3DF0A 3BC3A 3BCNA 2DCBA 2GHUA 1VJVA 3IHPA 1AYUA 4I04A 1ICFA 5F02A 3NHEA 2E01A 1GCBA 2FRQA 3LXSA 1AU4A 3CH3X 4Q8GA 1ITOA 3HHIA 2NQAA 5JA7A 4NV8A 4CZWA 1MS6A 1ME3A 2OULA 3MORA 3RVXA 3USVA 3GCBA 2R9CA 3P5WA 3QJ3A 3IUTA 1M6DA 1PBHA 5EF4A 2P7UA 1NLJA 2AYOA 2IPPB 3K24A 2HHNA 4BGFA 4W4UA 4FIPA 1PIPA 1CPJA 4YYSA 4FK5A 2YJ2A 2F7DA 2E00A 1QOLA 4YYWA 2FT2A 2H7JA 2FRAA 2ACTA 2BDLA 4PP2E 1MIRA 2JQGR 4MSXA 1ZCMA 4I05A 2DCDA 3HWNA 2YJBA 3KFQA 3OISA 4BS5A 2AUZA 1U9WA 1W5RA 3E1ZB 4QRXA 1O0EA 1SP4B 2P0RA 2DZZA 4PP1A 2DC6A 3KWBX 4QRVA 3IEJA 1AIMA 3QSDA 4XUIA 1F2AA 1CSBB 4YYRA 4MZOA 3PNRA 3N3GA 1YT7A 5A24A 3P5UA 1AU2A 3K8UA 4B55A 1S4VA 1QDQA 2DZYA 1KHQA 3CH2X 1AYVA 4BPVA 2G8JA 1U5IA 3BPMA 2ATOA 1CS8A 4OELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FJC A;  4YYQ A;  1KFU L;  4N4Z A;  4QRG A;  4P6E A;  3MHH A;  5FPW A;  4ZUX U;  3ZUA A;  1EWP A;  2VHS A;  4W5B A;  1CJL A;  3CBJ A;  1KHP A;  2HXZ A;  2IBI A;  1Q6K A;  3F5V A;  4CDD B;  1ME4 A;  1BP4 A;  5K16 A;  4BSQ A;  1QMY A;  9PAP A;  3BPF A;  4MZS A;  1NB5 A;  3IOQ A;  1IWD A;  4N8W A;  1F2B A;  1YK7 A;  1CB5 A;  5CVO B;  2DCC A;  1EWL A;  4CDE B;  1KFX L;  1DEU A;  3OF9 A;  1MEG A;  2FYE A;  3PW3 A;  2R9O A;  5CHV A;  1BY8 A;  1DF0 A;  2C0Y A;  1A6R A;  5PAD A;  2AUX A;  4YYV A;  2E02 A;  1TU6 A;  3WXG A;  3PBH A;  2R9N A;  2PAD A;  2YJ9 A;  1KXR A;  1X9Y A;  2NQG A;  1U9X A;  4WA6 A;  2AS8 A;  4QH6 A;  1GLO A;  1QXP A;  1PPO A;  2R6N A;  2AVW A;  1NPZ A;  2E03 A;  1YAL A;  2P86 A;  1U9V A;  1TLO A;  1PE6 A;  2G6D A;  2FUD A;  7PCK A;  1BQI A;  2B1M A;  4QBB A;  3OVZ A;  3B79 A;  4AXM A;  3N4C A;  2FQ9 A;  3P5X A;  3N3K A;  2DJF B;  3AI8 A;  1GMY A;  1JQP A;  5CVM A;  3IMA A;  3K9M A;  3S3Q A;  1CV8 A;  1MHW A;  5EGW A;  2R9F A;  6PAD A;  1EF7 A;  1MEM A;  1PAD A;  1THE A;  4G54 A;  4PI3 A;  4HWY A;  1PCI A;  4BQV A;  4CDC B;  4I07 A;  1CTE A;  1PPN A;  2FTD A;  3TNX A;  2AU1 A;  1NB3 A;  1ZIV A;  3O1G A;  2CIO A;  4X6H A;  1Y08 A;  5CHT A;  3H6S A;  4AXL A;  2G8E A;  4CDF B;  1HUC B;  1K3B B;  2VHF A;  4DMY A;  2ARY A;  1MDW A;  2YJC A;  2WBF X;  5J94 A;  1AU3 A;  2G7Y A;  2DJG B;  2OZ2 A;  3H89 A;  2CB5 A;  4N79 A;  5CVN B;  3ERV A;  2HH5 A;  2R9M A;  1CQD A;  2XU5 A;  4P6G A;  1F29 A;  1ATK A;  4X6I A;  4X6J A;  2PBH A;  1EWM A;  1SNK A;  2O6X A;  2GFO A;  1BGO A;  3I3T A;  4PAD A;  1VSN A;  3I06 A;  2AIM A;  4YYU A;  1PXV A;  4Q8H A;  3QT4 A;  1GEC E;  3MTN A;  2OP3 A;  1NL6 A;  2JQF R;  3LFY A;  1EWO A;  2DC9 A;  3BOW A;  3H8C A;  1PPP A;  1TL9 A;  1NQC A;  1FH0 A;  1U9Q X;  3KSE A;  2XU3 A;  2HD5 A;  3WXE A;  3U8E A;  2YJ8 A;  4K7C A;  1POP A;  1F2C A;  3H8B A;  3HHA A;  4W5C A;  2XU1 A;  5JH3 A;  8PCH A;  3V6C A;  3KKU A;  2DC7 A;  3KX1 A;  3H7D A;  3WXF A;  3S3R A;  3V6E A;  2FO5 A;  3MHS A;  2AYN A;  3M99 A;  1CVZ A;  2DCA A;  1XKG A;  2DC8 A;  3BWK A;  3RVV A;  2B1N A;  1AEC A;  1STF E;  4RY2 A;  3OF8 A;  3RVW A;  4BS6 A;  2PRE A;  3HD3 A;  4DMX A;  1AU0 A;  1AYW A;  1PPD A;  3CBK A;  3P5V A;  3KWZ A;  3IV2 A;  4OEM A;  1YVB A;  4KLB A;  2F1G A;  3OVX A;  2Y6E A;  2Y5B A;  1Y4H A;  2NQI A;  3C9E A;  2PNS A;  3D6S A;  2BDZ A;  3O0U A;  2XU4 A;  3KW9 A;  4XR7 A;  4YVA A;  1YK8 A;  3PDF A;  3F75 A;  4YV8 A;  2NQD B;  3DF0 A;  3BC3 A;  3BCN A;  2DCB A;  2GHU A;  1VJV A;  3IHP A;  1AYU A;  4I04 A;  1ICF A;  5F02 A;  3NHE A;  2E01 A;  1GCB A;  2FRQ A;  3LXS A;  1AU4 A;  3CH3 X;  4Q8G A;  1ITO A;  3HHI A;  2NQA A;  5JA7 A;  4CZW A;  1MS6 A;  1ME3 A;  2OUL A;  3MOR A;  3RVX A;  3USV A;  3GCB A;  2R9C A;  3P5W A;  3QJ3 A;  3IUT A;  1M6D A;  1PBH A;  5EF4 A;  2P7U A;  1NLJ A;  2AYO A;  2IPP B;  3K24 A;  2HHN A;  4W4U A;  4FIP A;  1PIP A;  1CPJ A;  4YYS A;  4FK5 A;  2YJ2 A;  2F7D A;  2E00 A;  1QOL A;  4YYW A;  2FT2 A;  2H7J A;  2FRA A;  2ACT A;  2BDL A;  4PP2 E;  1MIR A;  2JQG R;  4MSX A;  1ZCM A;  4I05 A;  2DCD A;  3HWN A;  2YJB A;  3KFQ A;  3OIS A;  4BS5 A;  2AUZ A;  1U9W A;  3E1Z B;  4QRX A;  1O0E A;  1SP4 B;  2P0R A;  2DZZ A;  4PP1 A;  2DC6 A;  3KWB X;  4QRV A;  3IEJ A;  1AIM A;  3QSD A;  4XUI A;  1F2A A;  1CSB B;  4YYR A;  4MZO A;  3PNR A;  3N3G A;  1YT7 A;  5A24 A;  3P5U A;  1AU2 A;  3K8U A;  1S4V A;  1QDQ A;  2DZY A;  1KHQ A;  3CH2 X;  1AYV A;  4BPV A;  2G8J A;  1U5I A;  3BPM A;  2ATO A;  1CS8 A;  4OEL A; 
#chains in the Genus database with same CATH topology
 4FJC A;  4YYQ A;  1KFU L;  4N4Z A;  4QRG A;  4P6E A;  3MHH A;  5FPW A;  4ZUX U;  3ZUA A;  1EWP A;  4WUR A;  4RF0 A;  2VHS A;  4W5B A;  1CJL A;  3CBJ A;  3W30 A;  1KHP A;  4BOQ A;  2HXZ A;  2IBI A;  1Q6K A;  3F5V A;  5JZE A;  4CDD B;  1ME4 A;  1BP4 A;  5K16 A;  4BSQ A;  4RF1 A;  1QMY A;  9PAP A;  3BPF A;  4MZS A;  2JRI A;  1NB5 A;  3IOQ A;  1IWD A;  4N8W A;  1F2B A;  1YK7 A;  1CB5 A;  2UZJ A;  5CVO B;  2DCC A;  4R3D A;  1EWL A;  4CDE B;  1KFX L;  1DEU A;  3OF9 A;  1MEG A;  4D8E A;  2FYE A;  3PW3 A;  2R9O A;  5CHV A;  4RNA A;  1PVJ A;  1BY8 A;  1DF0 A;  2C0Y A;  1A6R A;  5PAD A;  2AUX A;  4MI7 A;  4YYV A;  2E02 A;  1TU6 A;  3WXG A;  3PBH A;  2R9N A;  2PAD A;  2YJ9 A;  1KXR A;  1X9Y A;  2BTW A;  1U9X A;  2NQG A;  2AS8 A;  4WA6 A;  4QH6 A;  1GLO A;  1QXP A;  1PPO A;  2R6N A;  2AVW A;  1NPZ A;  2E03 A;  1YAL A;  2P86 A;  1U9V A;  1TLO A;  1PE6 A;  4BOS A;  2G6D A;  2FUD A;  7PCK A;  4PT5 A;  4BOP A;  1BQI A;  2B1M A;  4QBB A;  4M0W A;  1YZB A;  3OVZ A;  3B79 A;  4AXM A;  3N4C A;  2FQ9 A;  3P5X A;  3N3K A;  2AGA A;  2DJF B;  3AI8 A;  1GMY A;  1JQP A;  5CVM A;  3IMA A;  3K9M A;  3S3Q A;  1CV8 A;  1MHW A;  5EGW A;  5KO3 A;  2R9F A;  6PAD A;  1EF7 A;  1MEM A;  1PAD A;  1THE A;  4G54 A;  4PI3 A;  4HWY A;  1PCI A;  4BQV A;  3PRM A;  4CDC B;  4I07 A;  3BBA A;  1CTE A;  1PPN A;  2FTD A;  3TNX A;  2AU1 A;  1NB3 A;  1ZIV A;  3PT2 A;  3O1G A;  3W31 A;  2CIO A;  4X6H A;  1Y08 A;  5CHT A;  2DOS A;  3PHX A;  3H6S A;  4AXL A;  2G8E A;  4CDF B;  1HUC B;  1K3B B;  2JTC A;  2VHF A;  4DMY A;  4BOZ A;  2ARY A;  3O65 A;  1MDW A;  2YJC A;  2WBF X;  5J94 A;  1AU3 A;  3C0R A;  2G7Y A;  2DJG B;  2OZ2 A;  3H89 A;  3MTV A;  2CB5 A;  4N79 A;  4OVZ B;  5CVN B;  3ERV A;  2HH5 A;  2R9M A;  1CQD A;  2XU5 A;  4P6G A;  1F29 A;  3TMP A;  1ATK A;  4X6I A;  4X6J A;  2PBH A;  1EWM A;  1SNK A;  2O6X A;  2GFO A;  1BGO A;  3I3T A;  4PAD A;  1VSN A;  2FE8 A;  3I06 A;  2AIM A;  4YYU A;  1PXV A;  4Q8H A;  3QT4 A;  1GEC E;  5E6J A;  3MTN A;  2OP3 A;  3E9S A;  1NL6 A;  2JQF R;  3LFY A;  1EWO A;  2DC9 A;  3BOW A;  3H8C A;  1PPP A;  1TL9 A;  1NQC A;  1FH0 A;  1U9Q X;  3KSE A;  2XU3 A;  2HD5 A;  3WXE A;  3U8E A;  3RNV A;  2YJ8 A;  4K7C A;  1POP A;  1F2C A;  2J7Q C;  3H8B A;  1DKI A;  3HHA A;  4W5C A;  2XU1 A;  5JH3 A;  8PCH A;  3V6C A;  4D8B A;  3KKU A;  5EZQ A;  5EZS A;  2DC7 A;  3MP2 A;  3KX1 A;  3H7D A;  3WXF A;  3BY4 A;  3S3R A;  3V6E A;  2FO5 A;  3MHS A;  2AYN A;  3M99 A;  1CVZ A;  2DCA A;  1XKG A;  2DC8 A;  3BWK A;  3RVV A;  2B1N A;  2BU3 A;  1AEC A;  2BTW B;  1STF E;  4RY2 A;  3OF8 A;  3RVW A;  4BS6 A;  4GUA A;  2PRE A;  3BB7 A;  3HD3 A;  4DMX A;  1AU0 A;  1AYW A;  3TRK A;  3PRP A;  1PPD A;  3CBK A;  3P5V A;  3KWZ A;  4XZX A;  3IV2 A;  4OEM A;  1YVB A;  4HXD B;  4KLB A;  2F1G A;  3OVX A;  2Y6E A;  2Y5B A;  1Y4H A;  2NQI A;  3C9E A;  2PNS A;  3D6S A;  2BDZ A;  3O0U A;  2XU4 A;  3KW9 A;  4IP3 A;  4XR7 A;  1YK8 A;  4YVA A;  3PDF A;  3F75 A;  4YV8 A;  2NQD B;  3DF0 A;  3PSE A;  3BC3 A;  3BCN A;  2DCB A;  2GHU A;  1VJV A;  3IHP A;  1AYU A;  4I04 A;  4ZTB A;  1ICF A;  5F02 A;  3NHE A;  2E01 A;  4BOU A;  1GCB A;  2FRQ A;  3LXS A;  1AU4 A;  3CH3 X;  4REZ A;  3IFU A;  4Q8G A;  1ITO A;  3HHI A;  2NQA A;  5JA7 A;  4CZW A;  1MS6 A;  1ME3 A;  3OQC A;  2OUL A;  3MOR A;  3RVX A;  3USV A;  3GCB A;  2R9C A;  2J7Q A;  3P5W A;  3QJ3 A;  3IUT A;  1M6D A;  1PBH A;  5EF4 A;  2P7U A;  1NLJ A;  2AYO A;  2HWK A;  2IPP B;  3ZNH A;  3K24 A;  2HHN A;  4W4U A;  4FIP A;  1PIP A;  1CPJ A;  4YYS A;  4FK5 A;  2YJ2 A;  2F7D A;  2E00 A;  1QOL A;  4YYW A;  2FT2 A;  2H7J A;  2FRA A;  4P16 A;  4A5U A;  2ACT A;  2BDL A;  4OW0 A;  3MJ5 A;  4PP2 E;  1MIR A;  2JQG R;  4MSX A;  1ZCM A;  4I05 A;  2DCD A;  3HWN A;  2YJB A;  3KFQ A;  3OIS A;  4IUM A;  4RKX A;  1UKF A;  4BS5 A;  4D8I A;  2AUZ A;  1U9W A;  3E1Z B;  3PHU A;  4QRX A;  1O0E A;  1SP4 B;  2P0R A;  2DZZ A;  4PP1 A;  4MM3 B;  2DC6 A;  3KWB X;  4QRV A;  3IEJ A;  1AIM A;  3QSD A;  4XUI A;  1F2A A;  1CSB B;  4YYR A;  4MZO A;  3PNR A;  3N3G A;  1YT7 A;  3B21 A;  3P5U A;  5A24 A;  1AU2 A;  2Z84 A;  4OVZ A;  3K8U A;  3PHW A;  1S4V A;  1QDQ A;  2DZY A;  1KHQ A;  3CH2 X;  1AYV A;  4BPV A;  2G8J A;  1U5I A;  3BPM A;  2ATO A;  1CS8 A;  4OEL A; 
#chains in the Genus database with same CATH homology
 4FJC A;  4YYQ A;  1KFU L;  4N4Z A;  4QRG A;  4P6E A;  3MHH A;  5FPW A;  4ZUX U;  3ZUA A;  1EWP A;  2VHS A;  4W5B A;  1CJL A;  3CBJ A;  4C5P A;  1KHP A;  2VFB A;  2HXZ A;  2IBI A;  1Q6K A;  3F5V A;  4CDD B;  1ME4 A;  1BP4 A;  5K16 A;  4BSQ A;  4NV7 A;  1QMY A;  9PAP A;  3BPF A;  4MZS A;  1NB5 A;  3IOQ A;  1IWD A;  4N8W A;  1F2B A;  1YK7 A;  1CB5 A;  5CVO B;  2DCC A;  1EWL A;  1E2T A;  4CDE B;  1KFX L;  1DEU A;  3OF9 A;  1MEG A;  2FYE A;  3PW3 A;  2R9O A;  5CHV A;  1BY8 A;  1DF0 A;  2C0Y A;  1A6R A;  5PAD A;  2AUX A;  4YYV A;  2E02 A;  1TU6 A;  3WXG A;  3PBH A;  2R9N A;  2VFC A;  2PAD A;  2YJ9 A;  1KXR A;  1X9Y A;  2NQG A;  1U9X A;  4WA6 A;  2AS8 A;  4QH6 A;  1GLO A;  1QXP A;  1PPO A;  2R6N A;  2AVW A;  1NPZ A;  2E03 A;  1YAL A;  2P86 A;  1U9V A;  1TLO A;  1PE6 A;  2G6D A;  2FUD A;  7PCK A;  1BQI A;  2B1M A;  4QBB A;  3OVZ A;  3B79 A;  4AXM A;  4GUZ A;  3N4C A;  2FQ9 A;  3P5X A;  3N3K A;  2DJF B;  3AI8 A;  1GMY A;  1JQP A;  5CVM A;  3D9W A;  3IMA A;  3K9M A;  3S3Q A;  1CV8 A;  1GX3 A;  1MHW A;  5EGW A;  2R9F A;  6PAD A;  1EF7 A;  1MEM A;  1PAD A;  1THE A;  4G54 A;  4PI3 A;  4HWY A;  1PCI A;  4BQV A;  4CDC B;  1W4T A;  4I07 A;  1CTE A;  1PPN A;  2FTD A;  3TNX A;  2AU1 A;  1NB3 A;  1ZIV A;  3O1G A;  2CIO A;  4X6H A;  1Y08 A;  1W6F A;  5CHT A;  3H6S A;  4AXL A;  2G8E A;  4CDF B;  1HUC B;  1K3B B;  2VHF A;  4DMY A;  2ARY A;  1MDW A;  2YJC A;  2WBF X;  5J94 A;  1AU3 A;  2G7Y A;  2DJG B;  2OZ2 A;  3H89 A;  2CB5 A;  4N79 A;  5CVN B;  3ERV A;  2HH5 A;  2R9M A;  1CQD A;  2XU5 A;  4P6G A;  1F29 A;  1ATK A;  4X6I A;  4X6J A;  2PBH A;  1EWM A;  1SNK A;  2O6X A;  2GFO A;  3LTW A;  1BGO A;  3I3T A;  4PAD A;  1VSN A;  3I06 A;  2AIM A;  4YYU A;  1PXV A;  4Q8H A;  3QT4 A;  1GEC E;  3MTN A;  2OP3 A;  1NL6 A;  2JQF R;  3LFY A;  1EWO A;  2DC9 A;  3BOW A;  3H8C A;  1PPP A;  1TL9 A;  1NQC A;  1FH0 A;  1U9Q X;  3KSE A;  2XU3 A;  2HD5 A;  3WXE A;  3U8E A;  2YJ8 A;  4K7C A;  1POP A;  1F2C A;  3H8B A;  3HHA A;  4W5C A;  2XU1 A;  5JH3 A;  8PCH A;  3V6C A;  3KKU A;  2DC7 A;  3KX1 A;  3H7D A;  3WXF A;  3S3R A;  3V6E A;  2FO5 A;  3MHS A;  2AYN A;  3M99 A;  1CVZ A;  2DCA A;  1XKG A;  2DC8 A;  3BWK A;  3RVV A;  2B1N A;  1AEC A;  1STF E;  4RY2 A;  3OF8 A;  3RVW A;  4BS6 A;  2BSZ A;  2PRE A;  3HD3 A;  4DMX A;  1AU0 A;  1AYW A;  1PPD A;  3CBK A;  3P5V A;  3KWZ A;  3IV2 A;  4OEM A;  1YVB A;  4KLB A;  2F1G A;  3OVX A;  2Y6E A;  2Y5B A;  1Y4H A;  2NQI A;  3C9E A;  2PNS A;  3D6S A;  2BDZ A;  3O0U A;  2XU4 A;  3KW9 A;  4XR7 A;  4YVA A;  1YK8 A;  3PDF A;  3F75 A;  4YV8 A;  2NQD B;  3DF0 A;  3BC3 A;  3BCN A;  2DCB A;  2GHU A;  1VJV A;  3IHP A;  1AYU A;  4I04 A;  1ICF A;  5F02 A;  3NHE A;  2E01 A;  1GCB A;  2FRQ A;  3LXS A;  1AU4 A;  3CH3 X;  4Q8G A;  1ITO A;  3HHI A;  2NQA A;  5JA7 A;  4NV8 A;  4CZW A;  1MS6 A;  1ME3 A;  2OUL A;  3MOR A;  3RVX A;  3USV A;  3GCB A;  2R9C A;  3P5W A;  3QJ3 A;  3IUT A;  1M6D A;  1PBH A;  5EF4 A;  2P7U A;  1NLJ A;  2AYO A;  2IPP B;  3K24 A;  2HHN A;  4BGF A;  4W4U A;  4FIP A;  1PIP A;  1CPJ A;  4YYS A;  4FK5 A;  2YJ2 A;  2F7D A;  2E00 A;  1QOL A;  4YYW A;  2FT2 A;  2H7J A;  2FRA A;  2ACT A;  2BDL A;  4PP2 E;  1MIR A;  2JQG R;  4MSX A;  1ZCM A;  4I05 A;  2DCD A;  3HWN A;  2YJB A;  3KFQ A;  3OIS A;  4BS5 A;  2AUZ A;  1U9W A;  1W5R A;  3E1Z B;  4QRX A;  1O0E A;  1SP4 B;  2P0R A;  2DZZ A;  4PP1 A;  2DC6 A;  3KWB X;  4QRV A;  3IEJ A;  1AIM A;  3QSD A;  4XUI A;  1F2A A;  1CSB B;  4YYR A;  4MZO A;  3PNR A;  3N3G A;  1YT7 A;  5A24 A;  3P5U A;  1AU2 A;  3K8U A;  4B55 A;  1S4V A;  1QDQ A;  2DZY A;  1KHQ A;  3CH2 X;  1AYV A;  4BPV A;  2G8J A;  1U5I A;  3BPM A;  2ATO A;  1CS8 A;  4OEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...